HHsearch alignment for GI: 254780337 and conserved domain: PRK07523

>PRK07523 gluconate 5-dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=465.68  Aligned_cols=237  Identities=24%  Similarity=0.373  Sum_probs=220.8

Q ss_pred             EE-ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             26-52488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   12 IH-VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        12 m~-~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
T Consensus         2 m~~f~L~gK~alVTG~s~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~~l---~~~~~~~~~Dvtd~~~v~~~v~~~~   78 (251)
T PRK07523          2 FNLFDLTGRRALITGSSQGIGYALAKGLAQAGAEVILNGRDAAKLAAAAESL---KGSAHTLAFDVTDHDAVRAAIDAFE   78 (251)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC---CCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             8862689998999583669999999999987999999969989999999981---8872799995799999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
T Consensus        79 ~~~G~iDiLVNNAG~~-~~~~~~~~~~e~~~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~a  157 (251)
T PRK07523         79 AEIGPIDILVNNAGMQ-HRTPLEDFPADAFERLLQTNISSVFYVGQAVARHMIARGAGKIINIASVQSALARPGIAPYTA  157 (251)
T ss_pred             HHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHH
T ss_conf             9759986999898879-999905599999999999973999999999989988639967999941576076899478999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC----------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             9999999999999985443869975532883797798441----------4443245888899999999961975-6266
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM----------PAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~----------~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
T Consensus       158 sKaav~~lTr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~PlgR~g~peeia~~v~fLaSd~s~~iT  237 (251)
T PRK07523        158 TKGAVGNLTKGMATDWAKHGLQCNAIAPGYFDTPLNAALVADPEFSAWLEKRTPAGRWGKVEELVGACIFLASDASSFVN  237 (251)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999970209499999737898732432138999999998579999978999999999999487424826


Q ss_pred             CCEEEECCCCEEC
Q ss_conf             8579876876315
Q gi|254780337|r  240 GKLFSVPQNRFVN  252 (257)
Q Consensus       240 G~~~~vdgG~~~n  252 (257)
T Consensus       238 G~~i~VDGG~tAs  250 (251)
T PRK07523        238 GHVLYVDGGITAS  250 (251)
T ss_pred             CCEEEECCCCCCC
T ss_conf             8748809381137