HHsearch alignment for GI: 254780337 and conserved domain: PRK07666

>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.
Probab=100.00  E-value=0  Score=436.02  Aligned_cols=230  Identities=27%  Similarity=0.363  Sum_probs=216.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
T Consensus         2 ksL~gKvalITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~   81 (238)
T PRK07666          2 ESLQGKNALITGAGRGIGRAVAIALAKEGVNVGLLARSEENLKAVAKEVEAEGVKAVIATADVSDYEEVTTAIETLKNGL   81 (238)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             89999989991637789999999999879989999899999999999999559927999930799999999999999981


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
T Consensus        82 G~iDiLVNNAGi~-~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IInisS~ag~~~~~~~~~Y~aSK~  160 (238)
T PRK07666         82 GSIDILINNAGIS-KFGKFLELDVAEWEKIIQVNLMGVYYVTRAVLPSMIEQQSGDIINISSTAGQKGAPVTSAYSASKF  160 (238)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHCCCCCCCHHHHHHH
T ss_conf             9987899847457-999823399999999998962999999999999999749958999877777067999806999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-CCCCCCCCCCHHHHHHHHHHHHC-HH-HCCCCCEEE
Q ss_conf             9999999999985443869975532883797798441-44432458888999999999619-75-626685798
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-PAEDPNTVPHPQKVAKIISFLCA-TQ-KIETGKLFS  244 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-~~~~~~~~~~pediA~~v~fL~s-~~-~~~tG~~~~  244 (257)
T Consensus       161 av~glt~~la~El~~~gIrVn~v~PG~v~T~m~~~~~~~~~~~~~~~~PedVA~~vv~~l~~~~~~~i~~~~~~  234 (238)
T PRK07666        161 AVLGLTESLMMEVRKHNIRVTALTPSTVATDMAVDLGLTDGNPDKVMQPEDLAEFIVAQLKLNPRTFIKSAGLW  234 (238)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEECCCEEE
T ss_conf             99999999999854139699999858898624678777878830257999999999999839986377464030