HHsearch alignment for GI: 254780337 and conserved domain: PRK07774

>PRK07774 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=448.91  Aligned_cols=236  Identities=23%  Similarity=0.339  Sum_probs=220.4

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
T Consensus         2 ~~L~gK~alVTGgs~GiG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~f   81 (250)
T PRK07774          2 FDFDDKVAIVTGAAGGIGQAYAEALAREGASVVVADINAEGAERVAKQIVADGGTAIAVQVDVSDPDSAKAMADRTVSAF   81 (250)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             07799889997976889999999999869999999798899999999998559849999825899999999999999983


Q ss_pred             CCCCEEEECCCCCC--CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             89879987687588--8888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   94 GKLDILIANAGILG--SISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        94 g~iDilVNNAGi~~--~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
T Consensus        82 G~iDilVNnAg~~~~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IIn~sS~~~~---~~~~~Y~as  158 (250)
T PRK07774         82 GGIDYLVNNAAIYGGMKLDLLITVPWDYYKKFMSVNLDGALVCTRAVYKHMAKRGGGAIVNQSSTAAW---LYSNFYGLA  158 (250)
T ss_pred             CCCCEEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC---CCCHHHHHH
T ss_conf             99989998884357899974212999999999999889999999999999998299589997750045---785389999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             99999999999998544386997553288379779844---------14443245888899999999961975-626685
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
T Consensus       159 Kaal~~ltk~lA~el~~~gIrVN~V~PG~i~t~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~S~~s~~iTGq  238 (250)
T PRK07774        159 KVGINGLTQQLARELGGMNIRVNAIAPGPIDTEATRTVTPKEFVADMVKGIPLSRMGTPEDLVGMCLFLLSDAASWITGQ  238 (250)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999999706494899997387877220014979999999857998898599999999999948242686498


Q ss_pred             EEEECCCCEEC
Q ss_conf             79876876315
Q gi|254780337|r  242 LFSVPQNRFVN  252 (257)
Q Consensus       242 ~~~vdgG~~~n  252 (257)
T Consensus       239 ~i~VDGG~~~r  249 (250)
T PRK07774        239 IFNVDGGQIIR  249 (250)
T ss_pred             EEEECCCCCCC
T ss_conf             39978881214