HHsearch alignment for GI: 254780337 and conserved domain: PRK07814

>PRK07814 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=448.58  Aligned_cols=242  Identities=26%  Similarity=0.361  Sum_probs=224.5

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
T Consensus         6 ~~L~gKvalITGgs~GIG~aia~~la~~Ga~V~i~~~~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~   85 (263)
T PRK07814          6 FRLDGQVAVVTGAGRGLGAAIALAFAEAGADVLIAARTESQLDEVAEQIRAAGRRAHVVAADLAHPEATAGLAGQAVEAF   85 (263)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             08999989995896689999999999879989999698999999999998529928999815899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             8987998768758888886765999999999999899999999999999860-898699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS-HCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~-~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
T Consensus        86 G~iDiLVnNAg~~~-~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~Y~asK  164 (263)
T PRK07814         86 GRLDIVVNNVGGTM-PNPLLSTSTKDLADAFTFNVATAHALTRAAVPLMLEHSGGGSIINITSTMGRLAGRGFAAYGTAK  164 (263)
T ss_pred             CCCCEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHH
T ss_conf             99889998986678-88445488999999999971999999999999999847994699981265477899848899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             9999999999998544386997553288379779844----------14443245888899999999961975-626685
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
T Consensus       165 aal~~ltk~lA~e~a~~-IrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~FL~Sd~s~~iTG~  243 (263)
T PRK07814        165 AALAHYTRLAALDLCPR-IRVNAIAPGSILTSALEVVAANDELRAPMEKATPLRRLGDPEDIAAAAVYLASPAGSYLTGK  243 (263)
T ss_pred             HHHHHHHHHHHHHHCCC-CEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999997799-78999977988860454325999999999857998898099999999999948432594488


Q ss_pred             EEEECCCCEE---CCCCCC
Q ss_conf             7987687631---543799
Q gi|254780337|r  242 LFSVPQNRFV---NYLTPN  257 (257)
Q Consensus       242 ~~~vdgG~~~---n~~~p~  257 (257)
T Consensus       244 ~i~VDGG~t~~~~~~~~~~  262 (263)
T PRK07814        244 TLEVDGGLTFPNLDLPIPD  262 (263)
T ss_pred             EEEECCCEECCCCCCCCCC
T ss_conf             2886879828999999999