HHsearch alignment for GI: 254780337 and conserved domain: PRK07831

>PRK07831 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=446.11  Aligned_cols=234  Identities=22%  Similarity=0.340  Sum_probs=217.9

Q ss_pred             CCCCCEEEEECCC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-C-CCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             2488999993899-86889999999988998999978989999999999864-9-9289998789999999999999999
Q gi|254780337|r   15 NLDNRLALVTGSS-RGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-N-KKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        15 ~l~~K~alVTGas-~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g-~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
T Consensus        13 ~L~gKvalVTGgsg~GIG~a~a~~la~~Ga~V~i~d~~~~~~~e~~~~~~~~~g~~~v~~~~~Dvt~~~~v~~~v~~~~~   92 (261)
T PRK07831         13 LLAGKVVVVTAAAGTGIGSATARRALEEGADVVISDIHERRLGETADELAAELGLGRVEGVVCDVTSEAQVDALIDAAVE   92 (261)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             46998499949996478999999999879989998087777899999999843877289997568999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             8189879987687588888867659999999999998999999999999998608-986999788356478898368898
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
T Consensus        93 ~~G~iDiLVNNAG~~-~~~~~~e~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~gG~IinisS~~~~~~~~~~~~Y~a  171 (261)
T PRK07831         93 RLGRLDVLVNNAGLG-GQTPVVDMTDDEWSRVLDVTLTGTFRATRAALRYMRAAPHGGVIVNNASVLGWRAQHSQAHYAA  171 (261)
T ss_pred             HHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCHHHHH
T ss_conf             829986999888668-9988144999999998613215199999999999997699978984544030567887436899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             999999999999998544386997553288379779844---------14443245888899999999961975-62668
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
T Consensus       172 sKaav~~lTk~lA~e~a~~gIrVNaI~PG~i~t~~~~~~~~~~~~~~~~~~~p~gR~g~pediA~~v~fLaSd~s~~iTG  251 (261)
T PRK07831        172 AKAGVMALTRCSAIEAAEYGVRINAVAPSIARHKFLKKVTSAELLDRLASGEAFGRAAEPWEVAAVIAFLASDYSSYLTG  251 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCHHHCCCCC
T ss_conf             99999999999999984529089999558767702221399999999870799789759999999999995815469757


Q ss_pred             CEEEECCCC
Q ss_conf             579876876
Q gi|254780337|r  241 KLFSVPQNR  249 (257)
Q Consensus       241 ~~~~vdgG~  249 (257)
T Consensus       252 q~i~V~gg~  260 (261)
T PRK07831        252 EVVSVSSQH  260 (261)
T ss_pred             EEEEECCCC
T ss_conf             388988997