HHsearch alignment for GI: 254780337 and conserved domain: PRK08309

>PRK08309 short chain dehydrogenase; Provisional.
Probab=98.26  E-value=1.6e-05  Score=57.15  Aligned_cols=171  Identities=16%  Similarity=0.093  Sum_probs=108.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
T Consensus         2 haLVIGGTG-ML~~vs~~L~~qg~~VsiiaR~~~kl~~~~~~~~-~p~~i~~l~~DY~d~~~l~~~l~~ai~q~Gp~dl~   79 (182)
T PRK08309          2 HALVIGGTG-MLKRVSLWLCEEGFHVSIIARDEVKLENVKRESG-TPESITCLPLDYHDDDAVKLAIKRTIEQNGPITLA   79 (182)
T ss_pred             CEEEECCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC-CCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCEE
T ss_conf             169972417-5599999997379999999448788653686237-98632578746488699999999999618985689


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCEEEEE-CCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             876875888888676599999999999989999999999999986-089869997-883564788983688989999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKK-SHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~-~~~G~IIni-sS~~g~~~~~~~~~Y~asKaal~~  177 (257)
T Consensus        80 Va---WiHssa~------~a---------------l~~v~~~l~~~~~~~~l~HVlGS~~~----~~~~-----------  120 (182)
T PRK08309         80 VA---WIHSSAK------DA---------------LSVVCRELDLSSETYRLFHVLGSPAK----ASRI-----------  120 (182)
T ss_pred             EE---EEECCCH------HH---------------HHHHHHHHHCCCCCCEEEEEECCCCC----CCCC-----------
T ss_conf             99---9835722------45---------------99999998548998169999468778----6535-----------


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH-CHHH-CCCCCEEE
Q ss_conf             9999999854438699755328837977984414443245888899999999961-9756-26685798
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC-ATQK-IETGKLFS  244 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~-s~~~-~~tG~~~~  244 (257)
T Consensus       121 ----~~e~~~~~~~~y~~ViLGFv~e---------~~~sRWLTHeEIS~GVi~Ai~~~~~~~ivG~vep  176 (182)
T PRK08309        121 ----ASEKIGPLRCSYRRVILGFILE---------DTYSRWLTHEEISDGVIKAIESDCDEHIVGRVEP  176 (182)
T ss_pred             ----CCCCCCCCCCCEEEEEEEEEEE---------CCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             ----1000233578628899888971---------8864146458999999999865797279877634