HHsearch alignment for GI: 254780337 and conserved domain: PRK09135

>PRK09135 pteridine reductase; Provisional.
Probab=100.00  E-value=0  Score=446.18  Aligned_cols=237  Identities=24%  Similarity=0.346  Sum_probs=218.4

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             652488999993899868899999999889989999789-89999999999864-9928999878999999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKI-NKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~-g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
T Consensus         1 ~M~~sgKvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~l~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~   80 (249)
T PRK09135          1 TMTDSSKVALITGGARRIGAAIARTLHAAGYRVAVHYHRSAAEADALAAELNRLRPGSAAALQADLLDPDALEQLVAAAV   80 (249)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             97899988999688758999999999987998999818987999999999985059818999816999999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
T Consensus        81 ~~~G~iDiLVNNAg~~~-~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~-G~IInisS~~~~~~~~~~~~Y~a  158 (249)
T PRK09135         81 AAFGRLDALVNNASSFY-PTPLGEITEAQWDDLFASNAKAPFFLSQAAAPQLRKQR-GAIVNITDIHAERPLKNYPVYCA  158 (249)
T ss_pred             HHCCCCCEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCCHHHHH
T ss_conf             98399989998998899-99815599999999999833999999999999987478-87899987122778898567899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH---------HCCCCCCCCCCCHHHHHHHHHHHHCHHHCCCCC
Q ss_conf             99999999999999854438699755328837977984---------414443245888899999999961975626685
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK---------AMPAEDPNTVPHPQKVAKIISFLCATQKIETGK  241 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~---------~~~~~~~~~~~~pediA~~v~fL~s~~~~~tG~  241 (257)
T Consensus       159 sKaal~~ltr~lA~ela~~-IrVNaVaPG~i~t~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fLasdasyiTGq  237 (249)
T PRK09135        159 AKAALEMLTRSLALELAPE-VRVNAVAPGAILWPENDQGLDAEARQAILARTPLKRIGTPEDIAEAVLFLLEDASFITGQ  237 (249)
T ss_pred             HHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             9999999999999997799-889999307736776334499999999985799999819999999999996567874298


Q ss_pred             EEEECCCCEEC
Q ss_conf             79876876315
Q gi|254780337|r  242 LFSVPQNRFVN  252 (257)
Q Consensus       242 ~~~vdgG~~~n  252 (257)
T Consensus       238 ~i~VDGG~slt  248 (249)
T PRK09135        238 ILAVDGGRSLT  248 (249)
T ss_pred             EEEECCCCCCC
T ss_conf             48859894576