HHsearch alignment for GI: 254780337 and conserved domain: PRK09242

>PRK09242 tropinone reductase; Provisional.
Probab=100.00  E-value=0  Score=453.88  Aligned_cols=241  Identities=23%  Similarity=0.350  Sum_probs=225.4

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             65248899999389986889999999988998999978989999999999864--9928999878999999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
T Consensus         5 ~f~L~gK~alITGgs~GIG~a~a~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~   84 (258)
T PRK09242          5 RWRLDGQTALITGASKGIGLAIARELLGLGADVLIVARDADALAQARDELAEEFPERELHGLAADVSDDEDRRAILDWVE   84 (258)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHH
T ss_conf             76379999999484868999999999987998999969889999999999864479729999930799999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
T Consensus        85 ~~~g~iDiLVnnAG~~-~~~~~~~~s~~~w~~~~~vNl~~~~~l~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~a  163 (258)
T PRK09242         85 DHWDGLHILVNNAGGN-ITKAAIDYTEDEWRGIFETNLFSAFELSRYAYPLLKRHAASSIVNIGSVSGLTHVRSGAPYGM  163 (258)
T ss_pred             HHCCCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHH
T ss_conf             9749997999899889-999800199999999999981999999999999999759927999930421168987556799


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC----------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             9999999999999985443869975532883797798441----------4443245888899999999961975-6266
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM----------PAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~----------~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
T Consensus       164 sKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fLaSd~s~~iT  243 (258)
T PRK09242        164 TKAALQQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLSDPDYYEQVIERTPMRRIGEPEEVAAAVAFLCLPAASYIT  243 (258)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999980279899998358898721202237999999998579989987999999999999585324754


Q ss_pred             CCEEEECCCCEECCC
Q ss_conf             857987687631543
Q gi|254780337|r  240 GKLFSVPQNRFVNYL  254 (257)
Q Consensus       240 G~~~~vdgG~~~n~~  254 (257)
T Consensus       244 Gq~i~VDGG~~~~g~  258 (258)
T PRK09242        244 GECIAVDGGFLRYGF  258 (258)
T ss_pred             CCEEEECCCHHCCCC
T ss_conf             853898907322469