HHsearch alignment for GI: 254780337 and conserved domain: PRK09730

>PRK09730 hypothetical protein; Provisional.
Probab=100.00  E-value=0  Score=431.69  Aligned_cols=231  Identities=27%  Similarity=0.296  Sum_probs=213.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9999938998688999999998899899997-898999999999986499289998789999999999999999818987
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~-r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
T Consensus         2 KValITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~i~~~~g~id   81 (247)
T PRK09730          2 AIALVTGGSRGIGRATALLLAQEGYTVAVNYQQNLHAAQEVVNLITQAGGKAFVLQADISDENQVVAMFTAIDQHDEPLA   81 (247)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             79999062269999999999987999999669987899999999997499289998258999999999999999759955


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCEEEEECCHHHCCCCCCC-HHHHHHHH
Q ss_conf             9987687588888867659999999999998999999999999998608---9869997883564788983-68898999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH---CGRAIILSSGAAYKCRPLW-GAYSASKA  173 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~---~G~IInisS~~g~~~~~~~-~~Y~asKa  173 (257)
T Consensus        82 ~LVNNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~~~~~~~g~IVnisS~~~~~g~~~~~~~Y~asKa  161 (247)
T PRK09730         82 ALVNNAGILFTQCTVENLTAERINRVLSTNVTGYFLCCREAVKRMALKNGGSGGAIVNVSSVASRLGSPGEYVDYAASKG  161 (247)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHCCCCCCCHHHHHHHHH
T ss_conf             99989863568998133999999999999738999999999999999628999769998126546589841277799999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEE
Q ss_conf             999999999998544386997553288379779844---------14443245888899999999961975-62668579
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF  243 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~  243 (257)
T Consensus       162 av~~ltk~lA~ela~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~Sd~a~~iTGq~i  241 (247)
T PRK09730        162 AIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASGGEPGRVDRVKSNIPMQRGGQAEEVAQAIVWLLSDKASYVTGSFI  241 (247)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEE
T ss_conf             99999999999970549289999778897854323499699999985799899849999999999996872248348347


Q ss_pred             EECCCC
Q ss_conf             876876
Q gi|254780337|r  244 SVPQNR  249 (257)
Q Consensus       244 ~vdgG~  249 (257)
T Consensus       242 ~VDGG~  247 (247)
T PRK09730        242 DLAGGK  247 (247)
T ss_pred             EECCCC
T ss_conf             857999