HHsearch alignment for GI: 254780337 and conserved domain: PRK12743

>PRK12743 acetoin dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=441.27  Aligned_cols=235  Identities=23%  Similarity=0.314  Sum_probs=220.3

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             89999938998688999999998899899997-89899999999998649928999878999999999999999981898
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~-r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
T Consensus         2 ~KValITGgs~GIG~a~a~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~i   81 (253)
T PRK12743          2 AQVAIVTASDSGIGKACALLLAQQGFDIGITWHSDEEGAKETAEEVVSHGVRAEIVHLDLSNLPEGAQAIEKLIQRLGRL   81 (253)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99899907588999999999998799899974899799999999999459918999904899999999999999981999


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608-98699978835647889836889899999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
T Consensus        82 DilVNnAG~~-~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~k~~~~G~IVnisS~~~~~~~~~~~~Y~asKaal  160 (253)
T PRK12743         82 DVLVNNAGAM-TKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARHMVKQGQGGRIINITSVHEHTPLPDASAYTAAKHAL  160 (253)
T ss_pred             CEEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHHCCCCCCCHHHHHHHHHH
T ss_conf             8999899899-999800299999999999985999999999999999758996389996366557889858999999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH--------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEEC
Q ss_conf             999999999854438699755328837977984--------414443245888899999999961975-62668579876
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAK--------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVP  246 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~--------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vd  246 (257)
T Consensus       161 ~~ltk~lA~ela~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~~iPl~R~g~pedia~~v~fL~Sd~s~yiTG~~i~VD  240 (253)
T PRK12743        161 GGLTKAMALELVEHKILVNAVAPGAIATPMNGMDDSDVKPDAEPSIPLRRPGHTHEIASLVAWLCSEGASYTTGQSLIVD  240 (253)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEEC
T ss_conf             99999999997021929999964889877666787779999985799899849999999999993852258258648978


Q ss_pred             CCCEECC
Q ss_conf             8763154
Q gi|254780337|r  247 QNRFVNY  253 (257)
Q Consensus       247 gG~~~n~  253 (257)
T Consensus       241 GG~~l~~  247 (253)
T PRK12743        241 GGFMLAN  247 (253)
T ss_pred             CCEECCC
T ss_conf             6868076