HHsearch alignment for GI: 254780337 and conserved domain: PRK12744

>PRK12744 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=425.40  Aligned_cols=237  Identities=22%  Similarity=0.324  Sum_probs=212.5

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC----HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             2652488999993899868899999999889989999789----899999999998649928999878999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS----ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKT   87 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~----~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~   87 (257)
T Consensus         2 ~~~~L~gKvalVTGgs~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~   81 (257)
T PRK12744          2 ADHSLKGKVVLIAGGAKNLGGLIARDLAAQGAKAVAIHYNSAATKADAEETVAAVKAAGAKAVAFQADLTTAAAVEKLFD   81 (257)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH
T ss_conf             99998999899928875899999999998799899993787436899999999999739928999768899999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHH
Q ss_conf             99998189879987687588888867659999999999998999999999999998608986999788356478898368
Q gi|254780337|r   88 YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA  167 (257)
Q Consensus        88 ~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~  167 (257)
T Consensus        82 ~~~~~~G~iDilVnnAG~~-~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~--~G~ii~i~ss~~~~~~~~~~~  158 (257)
T PRK12744         82 DAKAAFGRPDIAINTVGKV-LKKPIVEISEAEYDEMFAVNSKSAFFFIKEAGRHLND--NGKIVTLVTSLLGAFTPFYSA  158 (257)
T ss_pred             HHHHHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCEEEEEECHHHCCCCCHHH
T ss_conf             9999809988999766445-6772333228888889888876699999999998741--894999981154467895188


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------------CCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             898999999999999998544386997553288379779844--------------144432458888999999999619
Q gi|254780337|r  168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------------MPAEDPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       168 Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------------~~~~~~~~~~~pediA~~v~fL~s  233 (257)
T Consensus       159 Y~asKaav~~ltr~lA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pedia~~v~fLaS  238 (257)
T PRK12744        159 YAGSKAPVEHFTRAASKEFGARGISVTAVGPGPMDTPFFYPQEGAEAVAYHKTAAALSPFSKTGLTDIEDIVPFIRFLVT  238 (257)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             99999999999999999965449699999638898776576557045777778886287688999999999999999947


Q ss_pred             HHHCCCCCEEEECCCCEE
Q ss_conf             756266857987687631
Q gi|254780337|r  234 TQKIETGKLFSVPQNRFV  251 (257)
Q Consensus       234 ~~~~~tG~~~~vdgG~~~  251 (257)
T Consensus       239 da~~iTGq~i~VDGG~T~  256 (257)
T PRK12744        239 DGWWITGQTILINGGYTT  256 (257)
T ss_pred             CCCCCCCCEEEECCCEEC
T ss_conf             588832983897948017