HHsearch alignment for GI: 254780337 and conserved domain: PRK13394

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=470.36  Aligned_cols=239  Identities=28%  Similarity=0.383  Sum_probs=225.3

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
T Consensus         1 Mm~~l~gKvalVTGgs~GIG~a~A~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~   80 (262)
T PRK13394          1 MMSNLNGKTAVVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVADEINKAGGKAIGVAMDVTNEDAVNAGIDKVAE   80 (262)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             99788999899958577899999999998799999997988999999999996299399998158999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-HCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             8189879987687588888867659999999999998999999999999998-608986999788356478898368898
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLK-KSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~-~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
T Consensus        81 ~~G~iDiLVnnAG~~-~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~M~k~~~~G~IVnisS~~~~~~~~~~~~Y~a  159 (262)
T PRK13394         81 RFGSVDILVSNAGIQ-IVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVT  159 (262)
T ss_pred             HHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
T ss_conf             819999999899889-9999165999999999999758999999999999998379968999745776767999768999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC--------------------CCCCCCCCCHHHHHHHHHH
Q ss_conf             99999999999999854438699755328837977984414--------------------4432458888999999999
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP--------------------AEDPNTVPHPQKVAKIISF  230 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~--------------------~~~~~~~~~pediA~~v~f  230 (257)
T Consensus       160 sKaal~~ltk~lA~E~a~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~r~g~p~dvA~~v~f  239 (262)
T PRK13394        160 AKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGKTVDGVFTTVEDVAQTVLF  239 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999999852319699999758788702331365578763788589999998617998897299999999999


Q ss_pred             HHCHH-HCCCCCEEEECCCCEE
Q ss_conf             61975-6266857987687631
Q gi|254780337|r  231 LCATQ-KIETGKLFSVPQNRFV  251 (257)
Q Consensus       231 L~s~~-~~~tG~~~~vdgG~~~  251 (257)
T Consensus       240 LaS~~a~~iTG~~i~VDGG~~m  261 (262)
T PRK13394        240 LSAFPSAALTGQSFVVSHGWFM  261 (262)
T ss_pred             HHCHHHCCCCCCEEEECCCHHH
T ss_conf             9385756916972898927641