HHsearch alignment for GI: 254780337 and conserved domain: TIGR01179

>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5.1.3.2 from EC) interconverts UDP-glucose and UDP-galactose which are precursors of glucose- and galactose-containing exopolysaccharides (EPS). A set of related proteins, some of which are tentatively identified as UDP-glucose-4-epimerase in Thermotoga maritima, Bacillus halodurans, and several archaea, but deeply branched from this set and lacking experimental evidence, are excluded and described by a separate model. ; GO: 0003978 UDP-glucose 4-epimerase activity, 0006012 galactose metabolic process.
Probab=99.10  E-value=1.2e-09  Score=84.71  Aligned_cols=162  Identities=27%  Similarity=0.289  Sum_probs=116.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH-HHHHHHCCCCE
Q ss_conf             99938998688999999998899899997-89899999999998649928999878999999999999-99998189879
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKT-YIAKRWGKLDI   98 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~-r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~-~~~~~~g~iDi   98 (257)
T Consensus         2 iLVTGGAGYIGSHt~~~Ll~~G~ev~vlDNLs~G~~~~l~~~~~~~G~~~~fv~gDL~D~~~l~~~f~kqql~--~~idA   79 (341)
T TIGR01179         2 ILVTGGAGYIGSHTVRQLLESGYEVVVLDNLSNGSAEALKRGEEITGKEVTFVEGDLRDRELLRRVFEKQQLE--HKIDA   79 (341)
T ss_pred             EEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCEECCCCCEEEEECCHHHHHHHHHHHHHHHC--CCCCE
T ss_conf             2686146644358878876359728998157888488750023414853205871751579999998774311--67546


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC-------------CC
Q ss_conf             98768758888886765999999999999899999999999999860898699978835647889-------------83
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRP-------------LW  165 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~-------------~~  165 (257)
T Consensus        80 ViHFAg~~-~VgE----Sv~~Pl~YY~NNv~nTl~L~~~m~~~GV-----~~~iFSSsAaVYG~p~~~Pi~E~~pl~~Pi  149 (341)
T TIGR01179        80 VIHFAGLI-AVGE----SVQKPLKYYRNNVVNTLNLLEAMQETGV-----KKFIFSSSAAVYGEPESIPISEDSPLGDPI  149 (341)
T ss_pred             EEEECCCC-CCHH----HHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCEEECCCCEEECCCCCCCCCCCCCCCCCC
T ss_conf             75201121-2525----5752454400046899999999998189-----741530421450778855502225677874


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             6889899999999999999854438699755
Q gi|254780337|r  166 GAYSASKAAIEALARTWSKETVNTALRVINI  196 (257)
Q Consensus       166 ~~Y~asKaal~~lt~~la~E~~~~gIrvn~I  196 (257)
T Consensus       150 nPYG~sKlM~E~iL~D~~~a--~~~~~~v~L  178 (341)
T TIGR01179       150 NPYGRSKLMVERILRDLSKA--DPDLSYVIL  178 (341)
T ss_pred             CCCCCCHHHHHHHHHHHHHH--CCCCCEEEE
T ss_conf             86655668899999999873--876779985