HHsearch alignment for GI: 254780337 and conserved domain: TIGR02354

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF; InterPro: IPR012729 Members of the HesA/MoeB/ThiF family of proteins (IPR000594 from INTERPRO) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees. The Escherichia coli ThiF and MoeB proteins are seemingly more closely related than the E. coli ThiF and Campylobacter (for example) ThiF. This entry represents the divergent clade of putative ThiF proteins as found in Campylobacter..
Probab=93.99  E-value=0.3  Score=28.45  Aligned_cols=122  Identities=22%  Similarity=0.261  Sum_probs=81.4

Q ss_pred             CCCCCCCEEECCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECC------------------HHHHHHHHHHHHHC
Q ss_conf             447897326524889999938998688999999998899-89999789------------------89999999999864
Q gi|254780337|r    5 ESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRS------------------ISQLEKLKNALQKI   65 (257)
Q Consensus         5 ~~~~~~~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~------------------~~~l~~~~~~~~~~   65 (257)
T Consensus         8 var~tpk~~~kL~~a~VAicGl-GGLGS~~AinLAR~GigkLiLvDfDvvepsNLnRQqY~~s~~G~~KteAlke~i~ei   86 (200)
T TIGR02354         8 VARHTPKVYEKLKKASVAICGL-GGLGSNVAINLARAGIGKLILVDFDVVEPSNLNRQQYKVSDVGKKKTEALKENISEI   86 (200)
T ss_pred             HHCCCHHHHHHHCCCCEEEEEC-CCCHHHHHHHHHHHCCCCEEEEEECEECCCCCCHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             7417826889850582789701-611689999998730220256640432366561325787624862179999878650


Q ss_pred             CCCEEEEECCC-CCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99289998789-99999999999999981898799876875888888676599999999999989999999999999986
Q gi|254780337|r   66 NKKIDIFAFDL-RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKK  144 (257)
Q Consensus        66 g~~~~~~~~Dv-~d~~~v~~~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~  144 (257)
T Consensus        87 nPy~~ie~~d~ki~E~N~~~~fk-------daDiv~E-A--FD--na~a-----------------Kam~~n~vl~~ykd  137 (200)
T TIGR02354        87 NPYVEIEIIDEKIDEENLDKLFK-------DADIVCE-A--FD--NAEA-----------------KAMLVNAVLEKYKD  137 (200)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHH-------CCCEEEE-C--CC--CHHH-----------------HHHHHHHHHHHCCC
T ss_conf             88421231102127667987840-------6747887-1--69--9889-----------------99999999976786


Q ss_pred             CCCCEEEEECCHHHC
Q ss_conf             089869997883564
Q gi|254780337|r  145 SHCGRAIILSSGAAY  159 (257)
Q Consensus       145 ~~~G~IInisS~~g~  159 (257)
T Consensus       138 ---k~li~ASGlAGy  149 (200)
T TIGR02354       138 ---KKLIAASGLAGY  149 (200)
T ss_pred             ---CEEEEECCCCCC
T ss_conf             ---458760266452