HHsearch alignment for GI: 254780337 and conserved domain: TIGR02813

>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432 Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is found together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologues of PfaA, also included in this entry, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis; an alternative to the more familiar iterated mechanism of chain extension and desaturation, and like PfaA the more distant homologues are likewise found near genes for homologues of PfaB, PfaC, and/or PfaD..
Probab=99.25  E-value=6.2e-10  Score=86.57  Aligned_cols=184  Identities=22%  Similarity=0.304  Sum_probs=145.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCC-CEEEEEECCHH--H---------------------------------------
Q ss_conf             88999993899868899999999889-98999978989--9---------------------------------------
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSG-AYVIACGRSIS--Q---------------------------------------   54 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G-~~Vi~~~r~~~--~---------------------------------------   54 (257)
T Consensus      2158 ~~~~~LV~GGAKGVT~~C~l~lAK~~~a~FiL~GRS~~~~~~~~P~WA~G~s~~~~LK~AA~~~l~~~GeKPTP~~V~~l 2237 (2773)
T TIGR02813      2158 KDDKVLVTGGAKGVTFECALELAKQCQAHFILAGRSSHIADDELPSWAQGKSDENELKKAAIQHLQASGEKPTPKKVDAL 2237 (2773)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHCCCEEEECCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             68717883787622599999998753211455033045552068741046503567899999999863899885225866


Q ss_pred             ---------HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH--C--CCCEEEECCCCCCCCCCHHHCCHHHHH
Q ss_conf             ---------999999998649928999878999999999999999981--8--987998768758888886765999999
Q gi|254780337|r   55 ---------LEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW--G--KLDILIANAGILGSISPIWQIKEKSFA  121 (257)
Q Consensus        55 ---------l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~--g--~iDilVNNAGi~~~~~~~~~~~~e~~~  121 (257)
T Consensus      2238 v~PV~s~~EI~~aLaA~~a~Ga~A~Y~s~DV~~s~sva~~~~~~~~~~g~gsl~iTGiIHGAGVLAD-K~I~~KTL~E~~ 2316 (2773)
T TIGR02813      2238 VKPVLSSLEIAQALAAFKAVGASAEYLSVDVTDSVSVAATVAPLNKLLGQGSLDITGIIHGAGVLAD-KHIQDKTLEEFN 2316 (2773)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCHHHHH-HHHHHHHHHHHH
T ss_conf             4123545789999999985188714788604884789999999998616876210036644113423-445340178775


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCC
Q ss_conf             99999989999999999999986089869997883564788983688989999999999999985443869975532883
Q gi|254780337|r  122 DVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT  201 (257)
Q Consensus       122 ~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v  201 (257)
T Consensus      2317 ~VYgTKv~GL~~lL~a----~~~~~~K~~~lFSSAAGFYGN~GQSDYa~sNdILNKaAl~l~~~~-P~-A~V~SF~WGPW 2390 (2773)
T TIGR02813      2317 AVYGTKVDGLESLLAA----LNAEKIKLVALFSSAAGFYGNTGQSDYAMSNDILNKAALQLKARN-PE-AKVLSFNWGPW 2390 (2773)
T ss_pred             HHHCCHHHHHHHHHHH----HCHHCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC-CC-CEEEECCCCCC
T ss_conf             3520016889999975----143106577875110245788885317788888889999998619-97-33873147888


Q ss_pred             CCHHHH
Q ss_conf             797798
Q gi|254780337|r  202 RTSMRA  207 (257)
Q Consensus       202 ~T~m~~  207 (257)
T Consensus      2391 DGGMV~ 2396 (2773)
T TIGR02813      2391 DGGMVN 2396 (2773)
T ss_pred             CCCCCC
T ss_conf             876227