HHsearch alignment for GI: 254780337 and conserved domain: TIGR02824

>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family; InterPro: IPR014189 Members of this family are putative quinone oxidoreductases that belong to the broader superfamily of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxidoreductases. An alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, consequently members of this entry are likely to be quinone oxidoreductases. A member of this family in Homo sapiens (Human), PIG3, is induced by p53 but is otherwise uncharacterised..
Probab=96.92  E-value=0.0064  Score=39.67  Aligned_cols=174  Identities=17%  Similarity=0.209  Sum_probs=109.6

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
T Consensus       144 ~GEtvLiHGGaSGIGttAIqLAKA~Ga~V~~TaGS~eK~~~a~---~~LGAd---~aINY~e~DFve~~k~~t~g~-kGv  216 (334)
T TIGR02824       144 AGETVLIHGGASGIGTTAIQLAKAFGARVFTTAGSDEKCATAC---EALGAD---IAINYREEDFVEVVKEETGGG-KGV  216 (334)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHH---HHCCCE---EEEECCCCCHHHHHHHHCCCC-CCC
T ss_conf             8972899713673679999999856975999828989999999---860980---786077734799999826899-853


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-CCCCHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478-89836889899999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC-RPLWGAYSASKAAI  175 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~-~~~~~~Y~asKaal  175 (257)
T Consensus       217 DVILD~vGg-~Y---------------l~~N~~-------al------A~dGRlV~Ig~~gG~~A~e~dL~---------  258 (334)
T TIGR02824       217 DVILDIVGG-SY---------------LARNIK-------AL------ALDGRLVQIGFQGGAKAEELDLG---------  258 (334)
T ss_pred             CEEEECCCH-HH---------------HHHHHH-------HH------HCCCCEEEEECCCCCCCCCCCHH---------
T ss_conf             179857766-88---------------998999-------98------40793999850678320116848---------


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCC-CCH------HHHHHCCCCCCC-------CCCCHHHHHHHHHHHHCHHHCCCCC
Q ss_conf             99999999985443869975532883-797------798441444324-------5888899999999961975626685
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPT-RTS------MRAKAMPAEDPN-------TVPHPQKVAKIISFLCATQKIETGK  241 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v-~T~------m~~~~~~~~~~~-------~~~~pediA~~v~fL~s~~~~~tG~  241 (257)
T Consensus       259 ----~Ll~KR~---~~tGSTLR~R~~G~~KA~Ia~~l~~~VWPll~~G~~~P~I~~~fpL~~A~~AH~~me--~g~h~GK  329 (334)
T TIGR02824       259 ----PLLAKRL---TITGSTLRARPVGAEKAAIAAELREQVWPLLASGRVRPVIDKVFPLEDAAKAHALME--SGDHIGK  329 (334)
T ss_pred             ----HHHHHHH---HHEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCHHHHHHHHHHHH--CCCCCCE
T ss_conf             ----9998875---430102589883589999999988873046665852578421079899999999974--5896014


Q ss_pred             EEE
Q ss_conf             798
Q gi|254780337|r  242 LFS  244 (257)
Q Consensus       242 ~~~  244 (257)
T Consensus       330 iVL  332 (334)
T TIGR02824       330 IVL  332 (334)
T ss_pred             EEE
T ss_conf             774