HHsearch alignment for GI: 254780337 and conserved domain: TIGR03206

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=100.00  E-value=0  Score=463.87  Aligned_cols=235  Identities=23%  Similarity=0.345  Sum_probs=224.1

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             48899999389986889999999988998999978989999999999864992899987899999999999999998189
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
T Consensus         1 L~gKvalITG~s~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~v~~~~~~~G~   80 (250)
T TIGR03206         1 LKDKTAIVTGGGGGIGGATCRRFAEEGAKVAVFDLNREAAEKVAADIRAKGGNAQAFACDITDRDSVDTAVAAAEQALGP   80 (250)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             95199999685768999999999987999999979889999999999953992899994489999999999999997599


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             87998768758888886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
T Consensus        81 iDilvnnAg~~-~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaav  159 (250)
T TIGR03206        81 VDVLVNNAGWD-KFGPFTKTEPPLWERLIAINLTGALHMHHAVLPGMVERGAGRIVNIASDAARVGSSGEAVYAACKGGL  159 (250)
T ss_pred             CCEEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             97999898889-99890349999999999998299999999999999974991799965577576899858899999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             9999999998544386997553288379779844--------------14443245888899999999961975-62668
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
T Consensus       160 ~~ltk~lA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~e~~~~~~~~~~Pl~R~g~pediA~~v~fL~Sd~s~~itG  239 (250)
T TIGR03206       160 VAFSKTMAREHARHGITVNVVCPGPTDTALLDDICGGAENPEKLREAFTRAIPLGRLGQPDDLPGAILFFSSDDASFITG  239 (250)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             99999999996532918999976888867789876443886999999984799899839999999999995834338458


Q ss_pred             CEEEECCCCEE
Q ss_conf             57987687631
Q gi|254780337|r  241 KLFSVPQNRFV  251 (257)
Q Consensus       241 ~~~~vdgG~~~  251 (257)
T Consensus       240 ~~i~VDGG~t~  250 (250)
T TIGR03206       240 QVLSVSGGLTM  250 (250)
T ss_pred             CEEEECCCEEC
T ss_conf             83886869049