HHsearch alignment for GI: 254780337 and conserved domain: TIGR03649

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=98.98  E-value=1.3e-07  Score=71.08  Aligned_cols=189  Identities=14%  Similarity=0.113  Sum_probs=119.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
T Consensus         1 TIlVtGATG~iG~~v~~~L~~~g~~v~~~~R~~~~~~~---------~~~~~v~~d~~d~~~~~~a~~~~d~~~~~v~~v   71 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQAASVPFLVASRSSSSSAG---------PNEKHVKFDWLDEDTWDNPFSSDDGMEPEISAV   71 (285)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHCCC---------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             98999899818999999998689978999588566466---------667536864448114888976353231274189


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             87687588888867659999999999998999999999999998608986999788356478898368898999999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALA  179 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt  179 (257)
T Consensus        72 ~l~~p~----~~----~~~~--------------~~~~~i~aA~~aGV~~iV~lS~~~~~~~~~~~~-----~--~~---  119 (285)
T TIGR03649        72 YLVAPP----IP----DLAP--------------PMIKFIDFARSKGVRRFVLLSASIIEKGGPAMG-----Q--VH---  119 (285)
T ss_pred             EECCCC----CC----CHHH--------------HHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCH-----H--HH---
T ss_conf             983899----87----7678--------------999999999984998899983035667986103-----8--99---


Q ss_pred             HHHHHHHHHHCCEEEEECCCCCCCHHH----HHHC-------C--CCCCCCCCCHHHHHHHHHHHHCHHHCCCCCEEEEC
Q ss_conf             999998544386997553288379779----8441-------4--44324588889999999996197562668579876
Q gi|254780337|r  180 RTWSKETVNTALRVINIDPGPTRTSMR----AKAM-------P--AEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP  246 (257)
Q Consensus       180 ~~la~E~~~~gIrvn~I~PG~v~T~m~----~~~~-------~--~~~~~~~~~pediA~~v~fL~s~~~~~tG~~~~vd  246 (257)
T Consensus       120 ~~~~---~~sg~~~tiLRp~~fm~N~~~~~~~~~i~~~g~~~~~~gd~~~~~V~~~DiA~vaa~~L~~~~~-~~~~~~lt  195 (285)
T TIGR03649       120 AHLD---SLGGVEYTVLRPTWFMENFSEEFHVEAIRKENKIYSATGDGKIPFVSADDIARVAYRALTDKVA-PNTDYVVL  195 (285)
T ss_pred             HHHH---HHCCCCEEEEECHHHHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCC-CCCEEEEE
T ss_conf             9999---7369976999663998750566658999748978444788775735587899999999749776-89779986


Q ss_pred             CCCEECC
Q ss_conf             8763154
Q gi|254780337|r  247 QNRFVNY  253 (257)
Q Consensus       247 gG~~~n~  253 (257)
T Consensus       196 Gpe~lt~  202 (285)
T TIGR03649       196 GPELLTY  202 (285)
T ss_pred             CCCCCCH
T ss_conf             8865799