HHsearch alignment for GI: 254780337 and conserved domain: cd05291

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine
Probab=94.45  E-value=0.45  Score=27.31  Aligned_cols=110  Identities=22%  Similarity=0.223  Sum_probs=68.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHC----CCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             999938998688999999998899--8999978989999999999864----9928999878999999999999999981
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGA--YVIACGRSISQLEKLKNALQKI----NKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~--~Vi~~~r~~~~l~~~~~~~~~~----g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
T Consensus         2 KI~IIGa-G~VG~~~a~~l~~~~l~~el~L~Di~~~~a~G~a~DL~~~~~~~~~~~~i~~~---~~~-----------~~   66 (306)
T cd05291           2 KVVIIGA-GHVGSSFAYSLVNQGIADELVLIDINEEKAEGEALDLEDALAFLPSPVKIKAG---DYS-----------DC   66 (306)
T ss_pred             EEEEECC-CHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEC---CHH-----------HH
T ss_conf             5999996-98899999999857998779998189870176999887013305997399608---878-----------84


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECC
Q ss_conf             89879987687588888867659999999999998999999999999998608-986999788
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSS  155 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS  155 (257)
T Consensus        67 ~~aDvvVitAG~~rk~g----~~R~---dLl~~N~~----I~k~i~~~i~~~~p~aivivvtN  118 (306)
T cd05291          67 KDADIVVITAGAPQKPG----ETRL---DLLEKNAK----IMKSIVPKIKASGFDGIFLVASN  118 (306)
T ss_pred             CCCCEEEECCCCCCCCC----CCHH---HHHHHHHH----HHHHHHHHHHHCCCCCEEEEECC
T ss_conf             78999999067667999----9878---99997899----99999999872299718999358