Query         gi|254780337|ref|YP_003064750.1| oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 257
No_of_seqs    119 out of 23026
Neff          7.2 
Searched_HMMs 39220
Date          Sun May 29 17:15:50 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780337.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01830 3oxo_ACP_reduc 3-oxo 100.0       0       0  530.0  24.7  228   21-250     1-238 (238)
  2 PRK06172 short chain dehydroge 100.0       0       0  486.3  31.2  240   12-251     1-252 (253)
  3 PRK07478 short chain dehydroge 100.0       0       0  475.8  30.9  239   14-252     2-252 (254)
  4 PRK07063 short chain dehydroge 100.0       0       0  473.3  30.9  240   12-252     1-256 (259)
  5 PRK06841 short chain dehydroge 100.0       0       0  472.6  30.2  240    8-251     5-254 (255)
  6 PRK06227 consensus             100.0       0       0  471.8  30.5  239   14-253     1-252 (256)
  7 PRK06138 short chain dehydroge 100.0       0       0  471.9  30.1  236   14-251     1-251 (252)
  8 PRK13394 3-hydroxybutyrate deh 100.0       0       0  470.4  30.6  239   12-251     1-261 (262)
  9 PRK07067 sorbitol dehydrogenas 100.0       0       0  471.1  29.7  235   14-252     1-256 (256)
 10 PRK12939 short chain dehydroge 100.0       0       0  469.4  30.9  239   12-251     1-249 (250)
 11 PRK12935 acetoacetyl-CoA reduc 100.0       0       0  469.6  30.2  237   14-251     2-247 (247)
 12 PRK12829 short chain dehydroge 100.0       0       0  468.2  29.8  238   10-249     3-261 (264)
 13 PRK06346 consensus             100.0       0       0  465.5  30.3  237   14-250     1-250 (251)
 14 PRK06124 gluconate 5-dehydroge 100.0       0       0  465.9  30.0  242   11-253     7-259 (259)
 15 TIGR03206 benzo_BadH 2-hydroxy 100.0       0       0  463.9  31.2  235   16-251     1-250 (250)
 16 PRK06935 2-deoxy-D-gluconate 3 100.0       0       0  466.6  29.0  239   11-251     7-257 (258)
 17 PRK08085 gluconate 5-dehydroge 100.0       0       0  465.2  30.0  238   14-252     5-253 (254)
 18 PRK07523 gluconate 5-dehydroge 100.0       0       0  465.7  29.4  237   12-252     2-250 (251)
 19 PRK08226 short chain dehydroge 100.0       0       0  464.3  30.1  235   15-251     3-255 (263)
 20 PRK12828 short chain dehydroge 100.0       0       0  464.5  29.2  237   12-251     1-238 (239)
 21 PRK08213 gluconate 5-dehydroge 100.0       0       0  464.7  28.8  236   14-250     8-257 (259)
 22 PRK08277 D-mannonate oxidoredu 100.0       0       0  461.8  30.8  239   13-251     5-274 (278)
 23 PRK07097 gluconate 5-dehydroge 100.0       0       0  461.4  30.4  237   14-251     6-259 (265)
 24 PRK08589 short chain dehydroge 100.0       0       0  461.2  30.3  235   14-250     2-253 (272)
 25 PRK07062 short chain dehydroge 100.0       0       0  459.9  30.6  239   11-250     1-262 (265)
 26 PRK06114 short chain dehydroge 100.0       0       0  458.8  31.1  239   10-250     9-260 (262)
 27 PRK06057 short chain dehydroge 100.0       0       0  460.9  29.5  240   12-256     1-254 (255)
 28 PRK05875 short chain dehydroge 100.0       0       0  459.0  30.0  241   12-252     1-255 (277)
 29 PRK07890 short chain dehydroge 100.0       0       0  457.5  30.9  236   14-250     1-256 (258)
 30 TIGR01963 PHB_DH 3-hydroxybuty 100.0       0       0  469.6  21.5  233   18-251     1-257 (258)
 31 PRK06949 short chain dehydroge 100.0       0       0  457.5  30.6  238   11-249     2-257 (258)
 32 PRK12827 short chain dehydroge 100.0       0       0  457.3  30.7  236   14-250     2-251 (251)
 33 PRK05867 short chain dehydroge 100.0       0       0  458.6  29.6  240   11-251     1-252 (253)
 34 PRK06113 7-alpha-hydroxysteroi 100.0       0       0  457.8  30.1  239   10-250     3-251 (255)
 35 PRK05653 fabG 3-ketoacyl-(acyl 100.0       0       0  456.0  30.4  237   14-251     1-246 (246)
 36 PRK06198 short chain dehydroge 100.0       0       0  454.7  30.5  235   15-250     3-255 (268)
 37 PRK07479 consensus             100.0       0       0  453.9  30.6  238   14-251     1-252 (252)
 38 PRK06484 short chain dehydroge 100.0       0       0  455.2  29.4  237   13-253   269-517 (530)
 39 PRK08936 glucose-1-dehydrogena 100.0       0       0  454.4  29.8  239   12-251     1-252 (261)
 40 PRK09242 tropinone reductase;  100.0       0       0  453.9  30.2  241   13-254     5-258 (258)
 41 PRK07231 fabG 3-ketoacyl-(acyl 100.0       0       0  452.4  30.8  237   13-251     1-250 (250)
 42 PRK12936 3-ketoacyl-(acyl-carr 100.0       0       0  451.7  29.9  234   14-251     2-244 (245)
 43 PRK08643 acetoin reductase; Va 100.0       0       0  450.4  30.8  234   18-252     2-256 (256)
 44 PRK07454 short chain dehydroge 100.0       0       0  451.9  29.2  237   12-250     1-241 (241)
 45 PRK06128 oxidoreductase; Provi 100.0       0       0  453.1  28.2  238   13-252    50-300 (300)
 46 PRK07814 short chain dehydroge 100.0       0       0  448.6  31.4  242   14-257     6-262 (263)
 47 PRK08339 short chain dehydroge 100.0       0       0  449.8  30.4  242   11-254     1-263 (263)
 48 PRK07576 short chain dehydroge 100.0       0       0  449.9  30.1  241   14-256     4-256 (260)
 49 PRK12826 3-ketoacyl-(acyl-carr 100.0       0       0  449.3  30.1  237   14-251     2-251 (253)
 50 PRK07776 consensus             100.0       0       0  451.0  28.7  239   11-252     1-248 (252)
 51 TIGR01829 AcAcCoA_reduct aceto 100.0       0       0  462.4  19.6  232   19-251     1-244 (244)
 52 PRK07774 short chain dehydroge 100.0       0       0  448.9  29.7  236   14-252     2-249 (250)
 53 PRK06484 short chain dehydroge 100.0       0       0  449.4  29.2  232   17-253     4-247 (530)
 54 PRK06701 short chain dehydroge 100.0       0       0  448.7  29.3  239   13-253    40-289 (289)
 55 PRK12824 acetoacetyl-CoA reduc 100.0       0       0  447.4  30.2  234   18-252     2-245 (245)
 56 PRK12938 acetyacetyl-CoA reduc 100.0       0       0  447.4  29.2  235   16-251     1-245 (246)
 57 PRK07831 short chain dehydroge 100.0       0       0  446.1  29.8  234   15-249    13-260 (261)
 58 PRK08063 enoyl-(acyl carrier p 100.0       0       0  446.7  29.2  235   16-251     2-248 (250)
 59 PRK12745 3-ketoacyl-(acyl-carr 100.0       0       0  445.6  29.7  240   14-253     1-258 (259)
 60 PRK12429 3-hydroxybutyrate deh 100.0       0       0  446.6  28.6  235   16-251     2-257 (258)
 61 PRK09135 pteridine reductase;  100.0       0       0  446.2  28.9  237   13-252     1-248 (249)
 62 PRK07035 short chain dehydroge 100.0       0       0  445.6  29.1  237   14-250     4-251 (252)
 63 PRK08265 short chain dehydroge 100.0       0       0  444.8  29.4  234   14-253     2-248 (261)
 64 PRK05565 fabG 3-ketoacyl-(acyl 100.0       0       0  443.6  30.2  236   14-250     1-246 (247)
 65 PRK07677 short chain dehydroge 100.0       0       0  442.9  30.1  238   16-254     1-252 (254)
 66 PRK09134 short chain dehydroge 100.0       0       0  443.9  29.1  243   11-257     3-252 (256)
 67 PRK06947 glucose-1-dehydrogena 100.0       0       0  442.5  30.1  235   15-249     3-252 (252)
 68 PRK06463 fabG 3-ketoacyl-(acyl 100.0       0       0  444.5  28.4  235   12-253     1-250 (254)
 69 PRK12743 acetoin dehydrogenase 100.0       0       0  441.3  30.6  235   18-253     2-247 (253)
 70 PRK05557 fabG 3-ketoacyl-(acyl 100.0       0       0  441.5  30.2  237   14-251     1-247 (248)
 71 PRK12825 fabG 3-ketoacyl-(acyl 100.0       0       0  441.0  30.5  238   12-250     1-248 (250)
 72 PRK06398 aldose dehydrogenase; 100.0       0       0  445.5  26.5  232   14-257     2-255 (256)
 73 PRK06171 sorbitol-6-phosphate  100.0       0       0  442.2  28.1  229   14-251     5-265 (266)
 74 PRK12481 2-deoxy-D-gluconate 3 100.0       0       0  441.1  28.4  235   14-251     4-250 (251)
 75 PRK06125 short chain dehydroge 100.0       0       0  440.1  29.0  237   12-253     1-257 (259)
 76 PRK06500 short chain dehydroge 100.0       0       0  440.0  28.9  231   15-251     3-248 (249)
 77 PRK12746 short chain dehydroge 100.0       0       0  439.6  28.9  235   14-251     2-254 (254)
 78 PRK12937 short chain dehydroge 100.0       0       0  438.4  29.5  233   14-249     1-244 (245)
 79 PRK08628 short chain dehydroge 100.0       0       0  439.2  28.9  237   12-252     1-254 (258)
 80 PRK08220 2,3-dihydroxybenzoate 100.0       0       0  439.5  28.6  232   12-252     2-252 (253)
 81 PRK06123 short chain dehydroge 100.0       0       0  436.3  30.3  234   16-249     1-249 (249)
 82 PRK07985 oxidoreductase; Provi 100.0       0       0  436.1  29.3  237   13-251    44-293 (294)
 83 PRK07791 short chain dehydroge 100.0       0       0  433.9  30.3  235   15-251     3-258 (285)
 84 PRK07856 short chain dehydroge 100.0       0       0  436.6  28.2  233   11-254     1-245 (254)
 85 PRK08945 short chain dehydroge 100.0       0       0  433.1  30.5  231   15-245    10-244 (245)
 86 PRK07666 fabG 3-ketoacyl-(acyl 100.0       0       0  436.0  28.1  230   14-244     2-234 (238)
 87 PRK12748 3-ketoacyl-(acyl-carr 100.0       0       0  433.4  30.0  236   14-250     1-255 (257)
 88 PRK07060 short chain dehydroge 100.0       0       0  435.1  28.3  232   10-251     1-244 (245)
 89 PRK08278 short chain dehydroge 100.0       0       0  434.5  28.6  235   14-250     2-248 (273)
 90 PRK06550 fabG 3-ketoacyl-(acyl 100.0       0       0  435.9  27.5  223   15-251     2-236 (237)
 91 PRK12859 3-ketoacyl-(acyl-carr 100.0       0       0  431.7  29.9  234   15-249     3-255 (257)
 92 PRK09730 hypothetical protein; 100.0       0       0  431.7  29.7  231   19-249     2-247 (247)
 93 PRK07792 fabG 3-ketoacyl-(acyl 100.0       0       0  431.6  28.2  236   13-251     4-253 (303)
 94 PRK12384 sorbitol-6-phosphate  100.0       0       0  430.1  29.3  233   18-251     2-258 (259)
 95 PRK08416 7-alpha-hydroxysteroi 100.0       0       0  426.3  30.1  241   11-251     1-259 (260)
 96 PRK12747 short chain dehydroge 100.0       0       0  429.0  27.8  233   16-251     2-252 (252)
 97 PRK12823 benD 1,6-dihydroxycyc 100.0       0       0  425.5  30.2  237   11-250     1-259 (260)
 98 PRK06077 fabG 3-ketoacyl-(acyl 100.0       0       0  427.5  28.4  233   16-253     1-246 (249)
 99 PRK07074 short chain dehydroge 100.0       0       0  424.6  30.4  229   17-250     1-241 (256)
100 PRK07069 short chain dehydroge 100.0       0       0  424.9  29.9  229   21-250     2-249 (251)
101 PRK05717 oxidoreductase; Valid 100.0       0       0  427.7  27.7  233   14-251     6-249 (255)
102 PRK08642 fabG 3-ketoacyl-(acyl 100.0       0       0  428.0  27.4  236   14-252     2-254 (254)
103 PRK12744 short chain dehydroge 100.0       0       0  425.4  28.7  237   12-251     2-256 (257)
104 PRK06523 short chain dehydroge 100.0       0       0  427.1  27.2  231   11-250     2-257 (260)
105 PRK08217 fabG 3-ketoacyl-(acyl 100.0       0       0  423.5  29.7  236   14-251     1-253 (253)
106 PRK07775 short chain dehydroge 100.0       0       0  424.4  28.1  235   15-250     7-257 (275)
107 PRK08993 2-deoxy-D-gluconate 3 100.0       0       0  424.1  27.9  235   14-251     6-252 (253)
108 PRK08324 short chain dehydroge 100.0       0       0  420.7  30.2  235   14-250   417-671 (676)
109 PRK08261 fabG 3-ketoacyl-(acyl 100.0       0       0  422.3  28.8  235   13-251   202-445 (447)
110 PRK09186 flagellin modificatio 100.0       0       0  418.2  29.4  236   16-251     2-255 (255)
111 PRK07326 short chain dehydroge 100.0       0       0  419.8  27.6  219   14-236     1-219 (235)
112 TIGR02415 23BDH acetoin reduct 100.0       0       0  427.2  20.7  231   19-250     1-256 (258)
113 TIGR03325 BphB_TodD cis-2,3-di 100.0       0       0  417.1  28.1  236   14-254     1-260 (262)
114 PRK08303 short chain dehydroge 100.0       0       0  414.5  29.7  239   12-250     2-271 (305)
115 PRK08703 short chain dehydroge 100.0       0       0  416.0  28.3  232   14-245     2-239 (239)
116 PRK06200 2,3-dihydroxy-2,3-dih 100.0       0       0  409.8  29.2  235   15-254     3-262 (263)
117 PRK07370 enoyl-(acyl carrier p 100.0       0       0  412.4  27.2  241   12-254     1-259 (259)
118 PRK07577 short chain dehydroge 100.0       0       0  411.1  27.0  222   16-251     1-234 (234)
119 PRK07707 consensus             100.0       0       0  409.8  27.0  227   18-250     2-238 (239)
120 PRK08415 enoyl-(acyl carrier p 100.0       0       0  408.2  27.2  237   14-253     1-253 (274)
121 PRK05786 fabG 3-ketoacyl-(acyl 100.0       0       0  403.2  27.2  232   14-251     1-237 (238)
122 PRK06139 short chain dehydroge 100.0       0       0  401.4  27.4  219   15-234     3-227 (324)
123 PRK08340 glucose-1-dehydrogena 100.0       0       0  398.9  28.8  230   20-250     2-254 (259)
124 PRK07041 short chain dehydroge 100.0       0       0  398.2  27.6  227   12-251     1-239 (240)
125 PRK06505 enoyl-(acyl carrier p 100.0       0       0  397.8  27.5  237   12-251     1-253 (271)
126 PRK05855 short chain dehydroge 100.0       0       0  395.4  27.7  218   14-232   311-545 (582)
127 PRK07825 short chain dehydroge 100.0       0       0  397.2  26.2  214   15-234     2-215 (273)
128 PRK10538 3-hydroxy acid dehydr 100.0       0       0  396.1  26.7  227   20-249     2-240 (248)
129 PRK07533 enoyl-(acyl carrier p 100.0       0       0  392.9  28.2  235   14-251     2-252 (254)
130 PRK12742 oxidoreductase; Provi 100.0       0       0  393.3  26.9  224   15-250     3-236 (237)
131 PRK06603 enoyl-(acyl carrier p 100.0       0       0  391.6  27.4  236   15-253     5-256 (260)
132 PRK08690 enoyl-(acyl carrier p 100.0       0       0  391.1  27.4  239   15-255     3-258 (261)
133 PRK07109 short chain dehydroge 100.0       0       0  389.0  29.0  222   12-234     2-230 (338)
134 PRK06924 short chain dehydroge 100.0       0       0  391.1  27.2  227   19-247     2-249 (251)
135 PRK07806 short chain dehydroge 100.0       0       0  389.6  28.1  228   14-251     2-245 (248)
136 PRK05872 short chain dehydroge 100.0       0       0  391.7  26.2  216   14-234     5-232 (296)
137 PRK06079 enoyl-(acyl carrier p 100.0       0       0  390.4  26.8  235   12-251     1-251 (252)
138 PRK07201 short chain dehydroge 100.0       0       0  390.0  26.6  220   13-234   371-592 (663)
139 PRK08594 enoyl-(acyl carrier p 100.0       0       0  388.4  27.5  237   14-252     2-255 (256)
140 PRK08159 enoyl-(acyl carrier p 100.0       0       0  388.3  27.5  238   15-255     7-260 (272)
141 PRK06181 short chain dehydroge 100.0       0       0  387.6  27.3  215   18-234     1-225 (263)
142 PRK06300 enoyl-(acyl carrier p 100.0       0       0  388.9  26.1  245   11-257     1-293 (298)
143 PRK06997 enoyl-(acyl carrier p 100.0       0       0  386.4  27.3  233   15-250     3-252 (260)
144 PRK05866 short chain dehydroge 100.0       0       0  387.1  26.5  220   11-232    33-255 (290)
145 PRK06194 hypothetical protein; 100.0       0       0  387.2  26.2  218   14-232     2-250 (301)
146 TIGR01832 kduD 2-deoxy-D-gluco 100.0       0       0  391.7  20.9  232   14-248     1-245 (249)
147 PRK05876 short chain dehydroge 100.0       0       0  381.6  26.8  217   14-231     2-236 (275)
148 PRK08267 short chain dehydroge 100.0       0       0  381.4  26.8  212   19-233     2-219 (258)
149 PRK07889 enoyl-(acyl carrier p 100.0       0       0  379.8  27.1  236   12-253     1-255 (256)
150 PRK06914 short chain dehydroge 100.0       0       0  378.6  27.0  217   16-234     1-242 (280)
151 PRK09072 short chain dehydroge 100.0       0       0  378.8  26.8  217   14-234     1-220 (262)
152 PRK08263 short chain dehydroge 100.0       0       0  379.5  25.9  215   16-234     1-233 (275)
153 PRK06483 short chain dehydroge 100.0       0       0  379.0  26.1  226   18-251     2-235 (236)
154 PRK05650 short chain dehydroge 100.0       0       0  374.6  28.4  223   20-248     2-234 (270)
155 PRK07984 enoyl-(acyl carrier p 100.0       0       0  371.7  28.2  239   15-256     3-258 (262)
156 PRK07832 short chain dehydroge 100.0       0       0  373.4  26.2  215   19-234     1-231 (272)
157 PRK06182 short chain dehydroge 100.0       0       0  372.8  25.9  211   16-233     1-235 (273)
158 PRK06180 short chain dehydroge 100.0       0       0  371.6  26.1  212   17-232     3-235 (277)
159 PRK06179 short chain dehydroge 100.0       0       0  374.3  24.0  208   17-233     3-229 (270)
160 KOG0725 consensus              100.0       0       0  370.9  26.3  243   12-254     2-266 (270)
161 PRK08219 short chain dehydroge 100.0       0       0  366.6  25.4  214   18-244     3-222 (226)
162 KOG1200 consensus              100.0       0       0  373.8  19.9  235   15-251    11-256 (256)
163 PRK07023 short chain dehydroge 100.0       0       0  365.8  25.2  221   18-244     1-241 (243)
164 PRK09291 short chain dehydroge 100.0       0       0  359.6  27.4  215   18-239     2-235 (257)
165 PRK08862 short chain dehydroge 100.0       0       0  359.6  27.1  224   14-246     1-226 (227)
166 COG4221 Short-chain alcohol de 100.0       0       0  359.5  25.5  219   15-236     3-230 (246)
167 PRK06482 short chain dehydroge 100.0       0       0  353.6  26.8  211   19-233     3-233 (276)
168 PRK06940 short chain dehydroge 100.0       0       0  352.2  27.2  228   15-253     2-270 (277)
169 PRK08251 short chain dehydroge 100.0       0       0  351.5  26.7  212   17-232     1-215 (248)
170 PRK07024 short chain dehydroge 100.0       0       0  351.7  25.0  210   19-232     3-212 (256)
171 PRK08264 short chain dehydroge 100.0       0       0  352.7  22.4  209   14-235     1-225 (235)
172 PRK05993 short chain dehydroge 100.0       0       0  351.0  23.6  213   12-234     1-241 (277)
173 PRK05693 short chain dehydroge 100.0       0       0  345.8  25.4  207   19-233     2-231 (274)
174 PRK09009 C factor cell-cell si 100.0       0       0  345.7  22.8  221   20-250     2-233 (235)
175 COG0300 DltE Short-chain dehyd 100.0       0       0  337.2  26.6  226   16-247     4-234 (265)
176 PRK07102 short chain dehydroge 100.0       0       0  337.8  25.7  208   19-232     2-210 (243)
177 PRK08017 short chain dehydroge 100.0       0       0  339.5  22.7  209   19-234     3-222 (256)
178 PRK07578 short chain dehydroge 100.0       0       0  340.2  21.1  196   21-245     3-198 (199)
179 KOG1205 consensus              100.0       0       0  338.2  21.3  233   14-248     8-251 (282)
180 TIGR02632 RhaD_aldol-ADH rhamn 100.0       0       0  340.9  19.2  238   13-251   419-705 (709)
181 PRK05884 short chain dehydroge 100.0       0       0  331.0  25.0  216   20-253     2-222 (223)
182 PRK12428 3-alpha-hydroxysteroi 100.0       0       0  333.2  21.6  214   14-252     1-253 (261)
183 PRK05599 hypothetical protein; 100.0 1.4E-45       0  326.6  25.9  208   20-232     2-211 (246)
184 KOG1201 consensus              100.0 2.8E-45       0  323.3  23.5  214   14-229    34-250 (300)
185 PRK07904 short chain dehydroge 100.0 1.8E-44       0  317.6  25.2  212   16-232     6-220 (253)
186 PRK06101 short chain dehydroge 100.0 2.4E-44       0  317.0  23.9  202   19-232     2-203 (241)
187 COG1028 FabG Dehydrogenases wi 100.0 5.3E-43       0  307.9  27.8  232   14-249     1-250 (251)
188 PRK08177 short chain dehydroge 100.0 1.7E-43       0  311.3  21.3  214   18-246     1-219 (225)
189 PRK06953 short chain dehydroge 100.0 1.2E-41       0  298.7  21.9  213   19-249     2-219 (222)
190 PRK06196 oxidoreductase; Provi 100.0 1.7E-41       0  297.8  21.9  224   13-243    21-272 (316)
191 KOG1207 consensus              100.0   4E-42       0  302.0   8.7  233   12-252     1-245 (245)
192 pfam08659 KR KR domain. This e 100.0 3.7E-39 9.4E-44  282.2  22.5  174   20-202     2-179 (181)
193 pfam00106 adh_short short chai 100.0   1E-38 2.6E-43  279.2  21.8  164   19-187     1-167 (167)
194 PRK06720 hypothetical protein; 100.0 7.1E-39 1.8E-43  280.3  20.5  160   11-174     9-168 (169)
195 PRK05854 short chain dehydroge 100.0 2.9E-38 7.5E-43  276.1  23.5  228   15-245    11-270 (314)
196 PRK06197 short chain dehydroge 100.0 5.1E-38 1.3E-42  274.5  23.7  234   10-247     9-266 (306)
197 KOG4169 consensus              100.0 5.2E-38 1.3E-42  274.4  17.5  224   14-249     1-244 (261)
198 COG3967 DltE Short-chain dehyd 100.0 2.5E-37 6.3E-42  269.9  20.0  207   14-228     1-208 (245)
199 smart00822 PKS_KR This enzymat 100.0 1.1E-36 2.9E-41  265.5  23.1  175   19-202     1-179 (180)
200 TIGR02685 pter_reduc_Leis pter 100.0 4.7E-37 1.2E-41  268.0  15.5  230   20-251     3-280 (283)
201 TIGR01831 fabG_rel 3-oxoacyl-( 100.0 1.8E-36 4.7E-41  264.1  18.0  228   21-249     1-238 (239)
202 PRK07453 protochlorophyllide o 100.0 8.2E-35 2.1E-39  253.1  21.4  228   17-244     5-282 (322)
203 KOG1199 consensus              100.0 5.5E-37 1.4E-41  267.6   9.4  230   15-249     6-256 (260)
204 KOG1014 consensus              100.0 5.5E-35 1.4E-39  254.2  18.2  210   18-231    49-260 (312)
205 KOG1208 consensus              100.0 2.7E-34 6.8E-39  249.6  19.9  227   12-242    29-279 (314)
206 KOG1610 consensus              100.0 1.1E-33 2.9E-38  245.4  20.5  190   14-206    25-216 (322)
207 KOG1210 consensus              100.0 1.1E-31 2.9E-36  232.0  21.6  211   19-230    34-255 (331)
208 COG0623 FabI Enoyl-[acyl-carri 100.0 3.8E-31 9.7E-36  228.5  24.1  239   14-256     2-257 (259)
209 KOG1209 consensus              100.0 3.7E-33 9.3E-38  242.0  12.3  189   17-212     6-196 (289)
210 KOG1611 consensus              100.0 2.3E-31 5.7E-36  230.1  20.0  203   19-228     4-224 (249)
211 KOG1204 consensus              100.0 7.9E-32   2E-36  233.1  11.0  225   17-243     5-246 (253)
212 pfam08643 DUF1776 Fungal famil 100.0 1.2E-28   3E-33  211.9  22.1  184   18-204     3-203 (296)
213 TIGR01500 sepiapter_red sepiap 100.0 2.4E-27   6E-32  203.1  21.1  222   20-241     2-261 (267)
214 TIGR01289 LPOR light-dependent  99.9 1.1E-20 2.8E-25  158.6  14.5  193   18-210     3-236 (321)
215 KOG1478 consensus               99.8 1.7E-19 4.3E-24  150.6  14.1  192   19-210     4-239 (341)
216 PRK07424 bifunctional sterol d  99.8 5.2E-17 1.3E-21  133.9  19.9  197   13-235   175-374 (410)
217 pfam02719 Polysacc_synt_2 Poly  99.7 4.3E-14 1.1E-18  114.4  20.7  212   21-251     1-230 (280)
218 TIGR03589 PseB UDP-N-acetylglu  99.6 1.7E-13 4.4E-18  110.4  21.1  209   16-247     2-228 (324)
219 PRK12367 short chain dehydroge  99.6   5E-14 1.3E-18  114.0  16.6  200   11-235    10-215 (250)
220 COG1086 Predicted nucleoside-d  99.6 2.3E-12 5.7E-17  102.9  23.3  217   14-249   246-480 (588)
221 TIGR03466 HpnA hopanoid-associ  99.6 6.7E-13 1.7E-17  106.4  19.9  203   20-252     2-235 (328)
222 PRK10217 dTDP-glucose 4,6-dehy  99.6 1.8E-12 4.7E-17  103.5  20.4  216   19-251     2-257 (355)
223 pfam01370 Epimerase NAD depend  99.6 7.8E-13   2E-17  106.0  18.1  201   21-245     1-235 (235)
224 pfam01073 3Beta_HSD 3-beta hyd  99.6 2.4E-12 6.1E-17  102.8  19.4  212   22-253     1-257 (280)
225 PRK10084 dTDP-glucose 4,6 dehy  99.6 7.4E-12 1.9E-16   99.5  21.8  213   21-250     3-263 (352)
226 KOG1502 consensus               99.6 5.7E-13 1.4E-17  106.9  15.8  216   17-250     5-259 (327)
227 PRK11908 NAD-dependent epimera  99.5 7.7E-12   2E-16   99.3  20.3  207   19-250     2-257 (347)
228 PRK10675 UDP-galactose-4-epime  99.5 1.4E-11 3.6E-16   97.6  17.4  215   20-250     2-266 (338)
229 pfam04321 RmlD_sub_bind RmlD s  99.4 8.5E-11 2.2E-15   92.4  18.6  190   21-253     1-218 (284)
230 COG0451 WcaG Nucleoside-diphos  99.4 6.6E-11 1.7E-15   93.1  15.3  202   20-249     2-240 (314)
231 CHL00194 ycf39 Ycf39; Provisio  99.4 5.3E-10 1.4E-14   87.0  19.5  197   20-253     2-210 (319)
232 TIGR02813 omega_3_PfaA polyket  99.2 6.2E-10 1.6E-14   86.6  14.8  184   17-207  2158-2396(2773)
233 KOG4022 consensus               99.2 3.7E-09 9.4E-14   81.4  18.3  211   19-245     4-223 (236)
234 pfam07993 NAD_binding_4 Male s  99.2 5.3E-09 1.4E-13   80.3  18.2  157   23-203     1-196 (245)
235 COG1088 RfbB dTDP-D-glucose 4,  99.2 1.9E-09 4.9E-14   83.3  15.5  212   19-250     1-248 (340)
236 pfam05368 NmrA NmrA-like famil  99.2 1.6E-08 4.1E-13   77.2  19.1  192   21-253     1-213 (232)
237 TIGR01181 dTDP_gluc_dehyt dTDP  99.1 8.4E-09 2.1E-13   79.0  15.9  213   21-250     2-257 (340)
238 PRK11150 rfaD ADP-L-glycero-D-  99.1 2.5E-08 6.5E-13   75.8  18.3  205   20-250     1-240 (308)
239 KOG1371 consensus               99.1 5.5E-09 1.4E-13   80.2  14.0  155   18-187     2-172 (343)
240 TIGR01179 galE UDP-glucose 4-e  99.1 1.2E-09   3E-14   84.7  10.3  162   21-196     2-178 (341)
241 TIGR02622 CDP_4_6_dhtase CDP-g  99.1 1.2E-09   3E-14   84.7  10.2  172   16-201     2-198 (361)
242 COG1091 RfbD dTDP-4-dehydrorha  99.1 4.7E-08 1.2E-12   74.0  17.8  192   21-254     3-216 (281)
243 COG4982 3-oxoacyl-[acyl-carrie  99.0 5.9E-08 1.5E-12   73.4  17.0  234   14-249   392-658 (866)
244 COG1087 GalE UDP-glucose 4-epi  99.0 1.1E-08 2.7E-13   78.3  13.0  154   19-196     1-167 (329)
245 TIGR03649 ergot_EASG ergot alk  99.0 1.3E-07 3.3E-12   71.1  16.7  189   20-253     1-202 (285)
246 cd01078 NAD_bind_H4MPT_DH NADP  98.9 3.5E-09   9E-14   81.5   7.0   85   10-103    20-105 (194)
247 PRK09987 dTDP-4-dehydrorhamnos  98.9 1.8E-07 4.6E-12   70.1  13.9  199   20-254     2-224 (299)
248 TIGR01746 Thioester-redct thio  98.8 4.3E-07 1.1E-11   67.6  14.3  216   20-248     1-290 (405)
249 TIGR03443 alpha_am_amid L-amin  98.8 1.8E-06 4.5E-11   63.5  16.3  215   17-250   970-1249(1389)
250 TIGR01214 rmlD dTDP-4-dehydror  98.8   9E-08 2.3E-12   72.1   9.7  209   20-254     1-244 (317)
251 KOG1430 consensus               98.7 3.3E-07 8.3E-12   68.4  11.4  214   17-250     3-253 (361)
252 PRK07201 short chain dehydroge  98.7 3.6E-06 9.3E-11   61.4  15.4  202   21-245     3-249 (663)
253 TIGR01777 yfcH conserved hypot  98.5 6.3E-07 1.6E-11   66.5   8.7  204   21-240     1-233 (307)
254 COG3320 Putative dehydrogenase  98.5 1.5E-05 3.8E-10   57.2  15.3  163   19-201     1-197 (382)
255 KOG1202 consensus               98.4 1.3E-06 3.3E-11   64.4   7.8  174   17-201  1767-1947(2376)
256 COG1090 Predicted nucleoside-d  98.3 8.5E-06 2.2E-10   58.9  10.4  193   21-240     1-216 (297)
257 COG1089 Gmd GDP-D-mannose dehy  98.3 4.7E-06 1.2E-10   60.6   9.1  216   18-245     2-257 (345)
258 PRK08309 short chain dehydroge  98.3 1.6E-05   4E-10   57.1  10.2  171   20-244     2-176 (182)
259 PRK08261 fabG 3-ketoacyl-(acyl  98.2 2.1E-05 5.4E-10   56.3  10.4   98  137-256   102-204 (447)
260 COG1748 LYS9 Saccharopine dehy  98.2 1.7E-05 4.3E-10   56.9   9.0   77   19-106     2-79  (389)
261 COG0702 Predicted nucleoside-d  98.2 0.00028 7.3E-09   48.7  14.9  196   20-250     2-204 (275)
262 KOG1221 consensus               98.1 3.2E-05 8.1E-10   55.1   8.5  178   15-204     9-239 (467)
263 KOG1203 consensus               97.9  0.0003 7.7E-09   48.5  11.7  171   16-203    77-248 (411)
264 TIGR01472 gmd GDP-mannose 4,6-  97.9 0.00056 1.4E-08   46.7  12.0  215   19-245     1-263 (365)
265 pfam03435 Saccharop_dh Sacchar  97.8 0.00027 6.9E-09   48.8   9.6   76   21-106     1-78  (384)
266 TIGR02197 heptose_epim ADP-L-g  97.7 0.00025 6.3E-09   49.1   8.6  209   21-249     1-269 (353)
267 KOG2865 consensus               97.7 0.00038 9.7E-09   47.9   9.2  203   14-248    57-277 (391)
268 KOG2733 consensus               97.7 0.00024 6.1E-09   49.2   8.0   81   20-107     7-95  (423)
269 PRK12320 hypothetical protein;  97.7 0.00039   1E-08   47.8   8.8  104   20-158     2-105 (699)
270 pfam01488 Shikimate_DH Shikima  97.7 0.00043 1.1E-08   47.5   9.0   76   15-105     9-85  (134)
271 TIGR00507 aroE shikimate 5-deh  97.7 0.00027 6.9E-09   48.9   7.9   76   15-104   117-199 (286)
272 cd01065 NAD_bind_Shikimate_DH   97.7 0.00079   2E-08   45.7  10.0   77   13-105    14-91  (155)
273 smart00829 PKS_ER Enoylreducta  97.6 0.00062 1.6E-08   46.4   8.7   79   17-104   104-184 (288)
274 PRK05865 hypothetical protein;  97.5 0.00096 2.4E-08   45.2   8.8  102   20-155     2-103 (854)
275 COG0169 AroE Shikimate 5-dehyd  97.5  0.0011 2.7E-08   44.9   8.5   78   14-105   122-200 (283)
276 PRK10754 quinone oxidoreductas  97.4  0.0018 4.7E-08   43.3   9.5  107   17-161   140-246 (327)
277 PRK13771 putative alcohol dehy  97.4 0.00093 2.4E-08   45.3   7.4  163   17-244   162-330 (332)
278 KOG0747 consensus               97.3  0.0023 5.8E-08   42.6   8.3  210   18-247     6-250 (331)
279 PRK00258 aroE shikimate 5-dehy  97.2  0.0041 1.1E-07   40.9   9.1   75   14-104   118-193 (275)
280 COG0604 Qor NADPH:quinone redu  97.2  0.0082 2.1E-07   38.9  10.4  101   18-158   143-245 (326)
281 PRK12549 shikimate 5-dehydroge  97.1  0.0081 2.1E-07   39.0   9.8   77   15-104   124-201 (284)
282 PRK12548 shikimate 5-dehydroge  97.1  0.0093 2.4E-07   38.6   9.9   83   14-104   122-208 (289)
283 PRK06129 3-hydroxyacyl-CoA deh  97.1   0.024 6.1E-07   35.8  11.9  194   20-233     4-224 (308)
284 PRK00066 ldh L-lactate dehydro  97.0    0.02   5E-07   36.4  10.6  111   17-154     6-122 (315)
285 PRK05396 tdh L-threonine 3-deh  96.9   0.013 3.3E-07   37.6   9.7  106   14-157   160-266 (341)
286 COG1064 AdhP Zn-dependent alco  96.9   0.019 4.9E-07   36.4  10.5   97   17-157   166-262 (339)
287 PRK05579 bifunctional phosphop  96.9  0.0015 3.8E-08   43.9   4.8   83   14-111   182-280 (392)
288 PRK12749 quinate/shikimate deh  96.9   0.013 3.3E-07   37.6   9.5   84   13-104   119-205 (288)
289 TIGR02824 quinone_pig3 putativ  96.9  0.0064 1.6E-07   39.7   7.9  174   17-244   144-332 (334)
290 TIGR02813 omega_3_PfaA polyket  96.9   0.045 1.1E-06   34.0  12.2  180   17-201  1900-2096(2773)
291 cd05213 NAD_bind_Glutamyl_tRNA  96.9   0.015 3.8E-07   37.2   9.5   73   15-105   175-248 (311)
292 COG3268 Uncharacterized conser  96.8  0.0058 1.5E-07   39.9   7.0  142   19-177     7-153 (382)
293 PRK00045 hemA glutamyl-tRNA re  96.8   0.018 4.6E-07   36.6   9.5   47   15-62    179-226 (429)
294 PRK09496 trkA potassium transp  96.8    0.01 2.6E-07   38.3   8.2   69   21-101     3-71  (455)
295 cd05292 LDH_2 A subgroup of L-  96.8   0.028 7.2E-07   35.3  10.4  110   19-155     2-117 (308)
296 TIGR03201 dearomat_had 6-hydro  96.8   0.032 8.2E-07   35.0  10.7   81   17-104   166-250 (349)
297 TIGR03451 mycoS_dep_FDH mycoth  96.8   0.029 7.3E-07   35.3  10.4  102   17-156   176-278 (358)
298 KOG1431 consensus               96.8   0.054 1.4E-06   33.5  12.5  185   19-234     2-227 (315)
299 KOG1198 consensus               96.8  0.0099 2.5E-07   38.4   7.9   79   17-105   157-235 (347)
300 PRK08306 dipicolinate synthase  96.7   0.016   4E-07   37.1   8.6  122   10-200   144-265 (296)
301 PRK06849 hypothetical protein;  96.7  0.0095 2.4E-07   38.5   7.4   83   17-104     3-85  (387)
302 cd00650 LDH_MDH_like NAD-depen  96.7   0.033 8.3E-07   34.9  10.1  115   21-155     1-120 (263)
303 TIGR02114 coaB_strep phosphopa  96.7  0.0026 6.5E-08   42.3   4.4   89   26-128    24-115 (253)
304 PRK07066 3-hydroxybutyryl-CoA   96.6   0.017 4.5E-07   36.7   8.4  192   19-231     8-223 (321)
305 PRK13656 trans-2-enoyl-CoA red  96.6   0.019 4.9E-07   36.5   8.5  181   18-201    41-274 (400)
306 TIGR02823 oxido_YhdH putative   96.6   0.005 1.3E-07   40.4   5.2   60   15-78    146-206 (330)
307 PRK09310 aroDE bifunctional 3-  96.6  0.0084 2.1E-07   38.9   6.3   71   14-103   328-398 (477)
308 TIGR01035 hemA glutamyl-tRNA r  96.5   0.038 9.6E-07   34.5   9.6   79   15-106   182-262 (436)
309 PRK10309 galactitol-1-phosphat  96.5   0.036 9.1E-07   34.7   9.4   79   16-105   159-239 (347)
310 KOG1429 consensus               96.5   0.014 3.5E-07   37.4   7.1  153   14-194    23-193 (350)
311 PRK09260 3-hydroxybutyryl-CoA   96.4   0.092 2.3E-06   31.9  13.0   81   19-102     3-89  (289)
312 cd01075 NAD_bind_Leu_Phe_Val_D  96.4   0.008   2E-07   39.0   5.5   47   14-61     24-70  (200)
313 pfam00056 Ldh_1_N lactate/mala  96.4     0.1 2.5E-06   31.7  11.1  114   21-155     3-119 (142)
314 PRK04308 murD UDP-N-acetylmura  96.3   0.034 8.6E-07   34.8   8.3   77   14-107     1-79  (445)
315 PRK09880 L-idonate 5-dehydroge  96.3   0.071 1.8E-06   32.6  10.0   99   16-155   168-267 (343)
316 PRK07580 Mg-protoporphyrin IX   96.3   0.017 4.4E-07   36.7   6.8  101   15-153    61-163 (230)
317 COG0569 TrkA K+ transport syst  96.3   0.035 8.8E-07   34.7   8.1   71   20-102     2-73  (225)
318 PRK08655 prephenate dehydrogen  96.3   0.012 3.1E-07   37.8   5.8   43   20-62      2-44  (441)
319 PRK07688 thiamine/molybdopteri  96.2   0.088 2.2E-06   32.0  10.0   38   14-52     20-58  (339)
320 PRK09620 hypothetical protein;  96.2   0.015 3.8E-07   37.2   6.0   85   16-110     1-101 (229)
321 PRK13940 glutamyl-tRNA reducta  96.2   0.052 1.3E-06   33.6   8.8   74   15-105   178-252 (414)
322 PRK09422 alcohol dehydrogenase  96.2    0.12   3E-06   31.2  10.9   77   17-104   162-239 (338)
323 PRK09496 trkA potassium transp  96.2   0.063 1.6E-06   33.0   9.0   72   18-101   232-303 (455)
324 TIGR03366 HpnZ_proposed putati  96.1   0.081 2.1E-06   32.3   9.4  102   16-157   119-221 (280)
325 PRK02006 murD UDP-N-acetylmura  96.1   0.061 1.6E-06   33.1   8.7   80   12-106     1-80  (501)
326 pfam00208 ELFV_dehydrog Glutam  96.1   0.019 4.9E-07   36.5   6.0   45   15-60     29-84  (237)
327 pfam04127 DFP DNA / pantothena  96.1  0.0088 2.3E-07   38.7   4.2   82   17-111     1-99  (197)
328 COG0373 HemA Glutamyl-tRNA red  96.1    0.12 3.1E-06   31.1  10.0   48   15-63    175-223 (414)
329 PRK06719 precorrin-2 dehydroge  96.0   0.041   1E-06   34.3   7.2   87   12-104     7-101 (157)
330 pfam02882 THF_DHG_CYH_C Tetrah  96.0   0.072 1.8E-06   32.6   8.5   96   13-122    31-128 (159)
331 PRK07531 bifunctional 3-hydrox  95.9   0.044 1.1E-06   34.1   7.3  203   19-249     4-238 (489)
332 PRK08223 hypothetical protein;  95.9    0.15 3.7E-06   30.6   9.9   79   15-102    24-124 (287)
333 PRK02472 murD UDP-N-acetylmura  95.9   0.026 6.7E-07   35.5   6.1   78   15-106     6-83  (450)
334 PRK06223 malate dehydrogenase;  95.8    0.17 4.3E-06   30.2   9.8  115   19-155     2-119 (312)
335 PRK05808 3-hydroxybutyryl-CoA   95.7    0.19 4.9E-06   29.8  10.1   44   19-63      4-47  (282)
336 KOG1372 consensus               95.7   0.034 8.8E-07   34.8   6.1  218   17-246    27-287 (376)
337 TIGR01915 npdG NADPH-dependent  95.7   0.032 8.1E-07   35.0   5.8   42   21-62      3-51  (233)
338 PRK05690 molybdopterin biosynt  95.7    0.15 3.8E-06   30.5   9.2   37   14-51     28-65  (245)
339 cd00757 ThiF_MoeB_HesA_family   95.6    0.12 3.2E-06   31.0   8.6   38   14-52     17-55  (228)
340 COG1648 CysG Siroheme synthase  95.6    0.21 5.5E-06   29.4  10.2   87   13-104     7-104 (210)
341 COG2910 Putative NADH-flavin r  95.6    0.21 5.5E-06   29.4  11.0  176   21-232     3-197 (211)
342 PRK13982 bifunctional SbtC-lik  95.6   0.013 3.2E-07   37.7   3.3   82   14-111   253-350 (476)
343 PRK07660 consensus              95.5   0.076 1.9E-06   32.5   7.0   44   19-63      4-47  (283)
344 PRK01710 murD UDP-N-acetylmura  95.4     0.2   5E-06   29.7   8.9   77   15-106    11-88  (458)
345 PRK10083 putative dehydrogenas  95.3    0.22 5.5E-06   29.4   9.0   76   17-104   160-237 (339)
346 TIGR02021 BchM-ChlM magnesium   95.3   0.008   2E-07   39.0   1.6   89   15-125    52-143 (224)
347 cd05290 LDH_3 A subgroup of L-  95.3    0.27 6.9E-06   28.8  12.8  115   19-155     1-119 (307)
348 COG3007 Uncharacterized paraqu  95.3    0.17 4.3E-06   30.1   8.3  186   18-203    41-275 (398)
349 PRK05134 3-demethylubiquinone-  95.3   0.097 2.5E-06   31.8   7.0  167   15-248    46-213 (233)
350 pfam02254 TrkA_N TrkA-N domain  95.3   0.068 1.7E-06   32.8   6.2   68   21-102     1-68  (115)
351 cd01080 NAD_bind_m-THF_DH_Cycl  95.2   0.075 1.9E-06   32.5   6.4   45   13-57     39-83  (168)
352 PRK08644 thiamine biosynthesis  95.2    0.29 7.4E-06   28.6   9.4   40   14-54     23-63  (209)
353 PRK08293 3-hydroxybutyryl-CoA   95.2    0.11 2.7E-06   31.5   7.0   44   19-63      4-47  (288)
354 PRK01438 murD UDP-N-acetylmura  95.2   0.081 2.1E-06   32.3   6.4   77   15-106    11-88  (481)
355 cd01076 NAD_bind_1_Glu_DH NAD(  95.2   0.082 2.1E-06   32.3   6.4   80   12-104    25-115 (227)
356 cd05212 NAD_bind_m-THF_DH_Cycl  95.2   0.048 1.2E-06   33.8   5.2   44   13-56     23-66  (140)
357 COG2263 Predicted RNA methylas  95.2    0.16 4.2E-06   30.2   7.9   76   12-103    40-116 (198)
358 cd05313 NAD_bind_2_Glu_DH NAD(  95.1   0.062 1.6E-06   33.1   5.7   49   11-60     31-90  (254)
359 PRK01390 murD UDP-N-acetylmura  95.1   0.074 1.9E-06   32.5   6.0   43   15-58      6-48  (457)
360 cd05191 NAD_bind_amino_acid_DH  95.1   0.065 1.6E-06   32.9   5.7   36   14-50     19-55  (86)
361 PRK07530 3-hydroxybutyryl-CoA   95.1    0.32   8E-06   28.3  12.3   44   19-63      5-48  (292)
362 pfam03446 NAD_binding_2 NAD bi  95.1   0.055 1.4E-06   33.4   5.3   35   26-60      8-42  (163)
363 cd05294 LDH-like_MDH_nadp A la  94.9     0.2   5E-06   29.7   7.7  110   21-154     3-121 (309)
364 cd05293 LDH_1 A subgroup of L-  94.9    0.36 9.1E-06   28.0  10.8  112   18-155     4-121 (312)
365 PRK06732 phosphopantothenate--  94.9    0.11 2.9E-06   31.3   6.4   81   20-113    17-98  (228)
366 COG2227 UbiG 2-polyprenyl-3-me  94.9    0.25 6.5E-06   29.0   8.2   76   15-103    57-132 (243)
367 PRK06035 3-hydroxyacyl-CoA deh  94.8    0.37 9.3E-06   27.9  11.7   45   19-64      4-48  (291)
368 pfam00899 ThiF ThiF family. Th  94.8    0.37 9.5E-06   27.8   9.6   75   19-102     2-98  (134)
369 cd05211 NAD_bind_Glu_Leu_Phe_V  94.8    0.13 3.2E-06   31.0   6.4   40   11-51     16-56  (217)
370 PRK07819 3-hydroxybutyryl-CoA   94.7    0.19 4.8E-06   29.8   7.3   44   19-63      3-46  (284)
371 PRK06718 precorrin-2 dehydroge  94.7    0.14 3.7E-06   30.6   6.7   83   12-104     4-101 (202)
372 pfam02737 3HCDH_N 3-hydroxyacy  94.7    0.17 4.2E-06   30.2   6.9   44   19-64      1-44  (180)
373 KOG0025 consensus               94.7     0.2   5E-06   29.7   7.2  108   17-158   160-267 (354)
374 cd01484 E1-2_like Ubiquitin ac  94.6    0.34 8.8E-06   28.1   8.4   72   21-101     2-74  (234)
375 COG2130 Putative NADP-dependen  94.6     0.2   5E-06   29.7   7.1  108   17-162   150-257 (340)
376 PRK09599 6-phosphogluconate de  94.6     0.2 5.1E-06   29.6   7.1   74   27-102     8-93  (301)
377 pfam12076 Wax2_C WAX2 C-termin  94.6    0.12   3E-06   31.2   5.9   43   21-65      1-43  (164)
378 PRK11036 putative metallothion  94.5    0.29 7.3E-06   28.6   7.8   75   20-107    47-123 (256)
379 PRK13609 diacylglycerol glucos  94.5    0.38 9.7E-06   27.8   8.4   32   18-49      4-41  (388)
380 cd05291 HicDH_like L-2-hydroxy  94.5    0.45 1.1E-05   27.3  13.5  110   20-155     2-118 (306)
381 PRK12550 shikimate 5-dehydroge  94.3    0.17 4.4E-06   30.1   6.4   45   17-62    121-166 (272)
382 PRK05442 malate dehydrogenase;  94.3    0.26 6.6E-06   28.9   7.2  157   20-203     6-190 (325)
383 PRK08762 molybdopterin biosynt  94.3    0.48 1.2E-05   27.1   9.0   77   15-100   135-212 (379)
384 KOG0069 consensus               94.2    0.33 8.4E-06   28.2   7.5  133   14-206   158-291 (336)
385 TIGR02356 adenyl_thiF thiazole  94.2   0.062 1.6E-06   33.1   3.8  113   15-142    18-140 (210)
386 PRK12767 carbamoyl phosphate s  94.2    0.34 8.6E-06   28.1   7.6   73   19-102     2-76  (325)
387 TIGR02853 spore_dpaA dipicolin  94.2    0.18 4.6E-06   30.0   6.1  104   16-172   150-253 (288)
388 cd01337 MDH_glyoxysomal_mitoch  94.1    0.52 1.3E-05   26.9  12.8  111   21-155     3-117 (310)
389 PRK08125 bifunctional UDP-gluc  94.1    0.52 1.3E-05   26.9  14.9  207   16-246   312-566 (660)
390 PRK09414 glutamate dehydrogena  94.1    0.14 3.6E-06   30.7   5.4   49   11-60    222-281 (446)
391 PRK07574 formate dehydrogenase  94.0     0.3 7.5E-06   28.5   7.0  177   13-251   187-375 (385)
392 cd01489 Uba2_SUMO Ubiquitin ac  94.0    0.55 1.4E-05   26.7   9.0   74   21-103     2-76  (312)
393 TIGR02354 thiF_fam2 thiamine b  94.0     0.3 7.7E-06   28.4   7.0  122    5-159     8-149 (200)
394 PRK12475 thiamine/molybdopteri  93.9    0.21 5.4E-06   29.5   6.1   38   14-52     20-58  (337)
395 PRK12490 6-phosphogluconate de  93.9    0.58 1.5E-05   26.6   8.7   74   27-102     8-93  (298)
396 PRK11559 garR tartronate semia  93.9    0.16 4.1E-06   30.3   5.5   83   19-103     3-95  (295)
397 cd01338 MDH_choloroplast_like   93.9    0.58 1.5E-05   26.5   8.4  150   20-196     4-181 (322)
398 KOG1196 consensus               93.8    0.23 5.9E-06   29.2   6.2  164   17-227   153-316 (343)
399 KOG3191 consensus               93.8    0.59 1.5E-05   26.5   9.2   96   16-124    42-137 (209)
400 PRK10792 bifunctional 5,10-met  93.8    0.12   3E-06   31.2   4.6  156   44-208    37-223 (288)
401 PTZ00079 NADP-specific glutama  93.8    0.28 7.2E-06   28.6   6.5   49   11-60    245-304 (469)
402 cd01336 MDH_cytoplasmic_cytoso  93.7    0.62 1.6E-05   26.4   9.2  150   20-196     4-181 (325)
403 pfam02826 2-Hacid_dh_C D-isome  93.7    0.62 1.6E-05   26.3   8.5   41   12-53     30-70  (176)
404 PTZ00117 malate dehydrogenase;  93.7    0.63 1.6E-05   26.3  13.3  111   19-155     3-118 (313)
405 PRK03562 glutathione-regulated  93.6    0.64 1.6E-05   26.3   9.8  159   17-189   399-590 (615)
406 cd01483 E1_enzyme_family Super  93.6    0.65 1.7E-05   26.2  10.3   73   21-102     2-96  (143)
407 PRK06436 glycerate dehydrogena  93.6    0.18 4.7E-06   29.9   5.3   38   14-52    118-155 (303)
408 pfam00107 ADH_zinc_N Zinc-bind  93.6    0.44 1.1E-05   27.4   7.2   91   29-158     1-94  (131)
409 PRK08268 3-hydroxybutyryl-CoA   93.5    0.47 1.2E-05   27.1   7.3   45   19-64      4-48  (503)
410 cd01492 Aos1_SUMO Ubiquitin ac  93.5    0.58 1.5E-05   26.6   7.7   78   14-100    17-95  (197)
411 cd00755 YgdL_like Family of ac  93.5    0.68 1.7E-05   26.1   8.4  161   15-192     8-172 (231)
412 PRK10669 putative cation:proto  93.4    0.69 1.8E-05   26.1  11.3   63   13-83    413-475 (558)
413 PRK06487 glycerate dehydrogena  93.4    0.23 5.8E-06   29.3   5.5  129   14-207   144-273 (317)
414 TIGR02734 crtI_fam phytoene de  93.4    0.24 6.2E-06   29.1   5.7  164   21-187     1-238 (526)
415 cd00300 LDH_like L-lactate deh  93.4    0.69 1.8E-05   26.0  10.5  110   21-155     1-116 (300)
416 PRK00141 murD UDP-N-acetylmura  93.4    0.57 1.4E-05   26.6   7.5   77   13-108    13-89  (476)
417 cd01339 LDH-like_MDH L-lactate  93.4     0.7 1.8E-05   26.0  11.4  109   22-155     2-116 (300)
418 PRK06130 3-hydroxybutyryl-CoA   93.3    0.72 1.8E-05   25.9  14.4  177   19-230     6-217 (310)
419 pfam09445 Methyltransf_15 RNA   93.3    0.65 1.7E-05   26.2   7.7   72   25-103     6-79  (165)
420 PRK03806 murD UDP-N-acetylmura  93.3    0.74 1.9E-05   25.9   8.1   37   15-52      3-39  (438)
421 PRK03369 murD UDP-N-acetylmura  93.2    0.75 1.9E-05   25.8   8.7   77   12-107     6-82  (487)
422 cd01485 E1-1_like Ubiquitin ac  93.2    0.75 1.9E-05   25.8   9.7   76   15-99     16-94  (198)
423 KOG2774 consensus               93.2    0.38 9.6E-06   27.8   6.3  202   18-247    44-283 (366)
424 COG1063 Tdh Threonine dehydrog  93.1    0.76 1.9E-05   25.8  10.5  104   17-159   168-274 (350)
425 COG2264 PrmA Ribosomal protein  93.1    0.54 1.4E-05   26.8   7.0   63  130-198   144-212 (300)
426 PRK09117 consensus              92.8    0.84 2.1E-05   25.5  12.5   44   19-63      3-46  (282)
427 PRK06249 2-dehydropantoate 2-r  92.8    0.53 1.4E-05   26.8   6.7   80   14-103     1-80  (313)
428 PRK11064 wecC UDP-N-acetyl-D-m  92.7    0.32 8.2E-06   28.3   5.4   42   12-58      1-42  (415)
429 COG0190 FolD 5,10-methylene-te  92.6    0.22 5.6E-06   29.4   4.5   34  175-208   186-220 (283)
430 PRK05708 2-dehydropantoate 2-r  92.6    0.33 8.5E-06   28.2   5.4   40   19-60      4-43  (305)
431 PRK05086 malate dehydrogenase;  92.5    0.92 2.3E-05   25.2  11.0  111   21-155     3-119 (312)
432 COG5322 Predicted dehydrogenas  92.5    0.35 8.9E-06   28.0   5.4   48   13-60    162-209 (351)
433 PRK13243 glyoxylate reductase;  92.5    0.54 1.4E-05   26.8   6.3   39   13-52    145-183 (333)
434 PRK11730 fadB multifunctional   92.4    0.63 1.6E-05   26.3   6.6   43   19-63    315-357 (715)
435 PTZ00142 6-phosphogluconate de  92.4    0.97 2.5E-05   25.1   9.2   75   26-102    12-104 (474)
436 cd00704 MDH Malate dehydrogena  92.3    0.98 2.5E-05   25.0  11.3  149   21-196     3-179 (323)
437 TIGR01983 UbiG ubiquinone bios  92.2    0.26 6.6E-06   28.9   4.5  165   17-250    84-264 (275)
438 COG2085 Predicted dinucleotide  92.2    0.46 1.2E-05   27.3   5.7   79   22-103     4-95  (211)
439 COG0039 Mdh Malate/lactate deh  92.2       1 2.6E-05   24.9  10.8  156   20-203     2-177 (313)
440 pfam03807 F420_oxidored NADP o  92.1     0.5 1.3E-05   27.0   5.8   42   19-62      1-43  (93)
441 COG0334 GdhA Glutamate dehydro  92.0    0.28 7.1E-06   28.7   4.4   75   12-87    201-296 (411)
442 PRK08328 hypothetical protein;  91.9    0.24   6E-06   29.2   3.9   57   14-78     23-80  (230)
443 PRK03803 murD UDP-N-acetylmura  91.6     1.2   3E-05   24.5   7.5   40   12-52      1-40  (448)
444 PRK13608 diacylglycerol glucos  91.5     1.2 3.1E-05   24.5   7.3   33   17-49      4-44  (391)
445 pfam03721 UDPG_MGDP_dh_N UDP-g  91.5    0.67 1.7E-05   26.2   5.9  109   19-157     2-121 (185)
446 PRK04690 murD UDP-N-acetylmura  91.5    0.84 2.1E-05   25.5   6.4   76   15-107     5-81  (468)
447 COG0111 SerA Phosphoglycerate   91.5     1.2 3.1E-05   24.4   8.5   36   14-50    138-173 (324)
448 PRK09288 purT phosphoribosylgl  91.2     1.3 3.3E-05   24.3   7.2   64   16-89     10-74  (395)
449 pfam01135 PCMT Protein-L-isoas  91.1     1.3 3.4E-05   24.2   8.7   80   17-106    73-153 (205)
450 COG1250 FadB 3-hydroxyacyl-CoA  91.0    0.59 1.5E-05   26.5   5.3   79   19-102     5-89  (307)
451 pfam01210 NAD_Gly3P_dh_N NAD-d  90.9    0.95 2.4E-05   25.1   6.2   42   19-61      1-42  (159)
452 pfam12242 Eno-Rase_NADH_b NAD(  90.9    0.27 6.9E-06   28.8   3.4   29   19-48     40-70  (78)
453 PTZ00325 malate dehydrogenase;  90.9     1.4 3.5E-05   24.0  12.8  112   19-155     2-118 (313)
454 KOG4039 consensus               90.9     1.2 3.1E-05   24.4   6.8  159   13-205    13-173 (238)
455 cd01079 NAD_bind_m-THF_DH NAD   90.8    0.44 1.1E-05   27.3   4.4   39   13-51     57-95  (197)
456 PRK13942 protein-L-isoaspartat  90.5     1.5 3.8E-05   23.8   8.7   78   18-105    77-155 (214)
457 pfam00670 AdoHcyase_NAD S-aden  90.4    0.64 1.6E-05   26.3   5.0   46   12-58     17-63  (162)
458 PRK05600 thiamine biosynthesis  90.4    0.63 1.6E-05   26.3   4.9   37   15-52     38-75  (370)
459 TIGR03534 RF_mod_HemK protein-  90.2     1.6   4E-05   23.7   9.0   75   18-105    88-164 (251)
460 TIGR00406 prmA ribosomal prote  90.1     1.2   3E-05   24.5   6.1   78   13-102   190-273 (330)
461 KOG0024 consensus               90.0     1.6 4.1E-05   23.6  10.2   82   18-105   170-252 (354)
462 PRK12480 D-lactate dehydrogena  89.9     1.7 4.2E-05   23.5   9.1   41   11-52    139-179 (330)
463 PRK11199 tyrA bifunctional cho  89.7    0.71 1.8E-05   25.9   4.8   37   16-52     96-132 (374)
464 KOG2304 consensus               89.7    0.84 2.1E-05   25.5   5.1   74   19-94     12-85  (298)
465 TIGR03026 NDP-sugDHase nucleot  89.6     1.1 2.8E-05   24.7   5.6   38   19-58      2-39  (411)
466 PRK00257 erythronate-4-phospha  89.6     1.8 4.5E-05   23.3   8.2   87   14-103   112-207 (379)
467 PRK06932 glycerate dehydrogena  89.4    0.96 2.5E-05   25.1   5.2   36   15-51    144-179 (314)
468 TIGR01133 murG undecaprenyldip  89.2    0.55 1.4E-05   26.7   3.9   32   19-50      7-42  (368)
469 PRK09287 6-phosphogluconate de  89.2     1.9 4.7E-05   23.2   8.1   71   30-102     1-88  (459)
470 COG0027 PurT Formate-dependent  89.2    0.86 2.2E-05   25.4   4.8   60   20-89     14-74  (394)
471 cd01487 E1_ThiF_like E1_ThiF_l  89.1     1.9 4.8E-05   23.1  10.0   33   21-54      2-35  (174)
472 KOG2250 consensus               89.1     1.2 3.2E-05   24.3   5.6  121   12-145   245-381 (514)
473 PTZ00082 L-lactate dehydrogena  89.0     1.9 4.9E-05   23.1  13.4  117   17-155     7-130 (322)
474 TIGR00537 hemK_rel_arch methyl  88.8     1.8 4.5E-05   23.3   6.2  120   15-158    18-148 (183)
475 cd01488 Uba3_RUB Ubiquitin act  88.8     1.9 4.8E-05   23.1   6.4   73   21-102     2-75  (291)
476 COG0240 GpsA Glycerol-3-phosph  88.7     1.2   3E-05   24.5   5.3   41   19-61      3-43  (329)
477 PRK00726 murG N-acetylglucosam  88.6       2 5.2E-05   22.9   8.7   53   19-74      3-58  (359)
478 cd01491 Ube1_repeat1 Ubiquitin  88.6       2 5.2E-05   22.9   8.3   55   15-70     16-90  (286)
479 PRK08410 2-hydroxyacid dehydro  88.4     2.1 5.4E-05   22.8   8.0   37   15-52    142-178 (311)
480 PRK07878 molybdopterin biosynt  88.3     1.2 3.2E-05   24.3   5.2   82   14-96     38-159 (392)
481 PRK10637 cysG siroheme synthas  88.3     2.1 5.4E-05   22.8   8.6   87   12-104     6-104 (457)
482 PRK02705 murD UDP-N-acetylmura  87.9     2.3 5.8E-05   22.6   8.8   77   20-107     2-80  (459)
483 TIGR01087 murD UDP-N-acetylmur  87.8       2   5E-05   23.0   5.9  152   19-210     1-154 (476)
484 cd01423 MGS_CPS_I_III Methylgl  87.7     2.1 5.4E-05   22.8   6.0   76   19-104     1-80  (116)
485 COG0499 SAM1 S-adenosylhomocys  87.5     1.6   4E-05   23.7   5.3   46   12-58    203-249 (420)
486 KOG1197 consensus               87.3     2.5 6.2E-05   22.4   7.9   79   17-104   146-224 (336)
487 COG1052 LdhA Lactate dehydroge  87.2     2.5 6.3E-05   22.3   9.9  136   11-206   139-275 (324)
488 PRK05597 molybdopterin biosynt  87.1     2.4 6.1E-05   22.4   6.1   81   15-96     25-145 (355)
489 pfam05185 PRMT5 PRMT5 arginine  87.1     2.5 6.4E-05   22.3   8.6   90   19-122   188-282 (447)
490 PRK03659 glutathione-regulated  87.1     2.5 6.4E-05   22.3   9.9  168   15-189   398-591 (602)
491 PRK13581 D-3-phosphoglycerate   86.9     2.6 6.5E-05   22.2  10.8   91   10-103   130-228 (524)
492 COG2084 MmsB 3-hydroxyisobutyr  86.8     2.6 6.6E-05   22.2   7.2   84   19-104     2-96  (286)
493 cd01490 Ube1_repeat2 Ubiquitin  86.7       2 5.2E-05   22.9   5.5  113   21-146     2-130 (435)
494 pfam03848 TehB Tellurite resis  86.6     2.7 6.8E-05   22.1   6.2   72   17-102    30-101 (192)
495 PRK07411 hypothetical protein;  86.3     2.4 6.1E-05   22.4   5.7   53   15-68     35-107 (390)
496 TIGR02817 adh_fam_1 zinc-bindi  86.1     2.8 7.2E-05   22.0   7.7   41   13-54    146-188 (338)
497 PRK09329 N5-glutamine S-adenos  86.1     2.8 7.2E-05   21.9   8.5   74   19-106   111-185 (285)
498 pfam00389 2-Hacid_dh D-isomer   86.0     2.9 7.3E-05   21.9   7.7   39   12-51    131-169 (313)
499 cd03785 GT1_MurG MurG is an N-  85.9     2.9 7.4E-05   21.9   9.9   82   19-104     1-98  (350)
500 TIGR03590 PseG pseudaminic aci  85.9     2.9 7.4E-05   21.9   8.3   78   19-101     2-87  (280)

No 1  
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284   This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species. This enzyme is involved in type II fatty acid biosynthesis, where the individual metabolic transformations are carried out by different enzymes rather than by a single enzyme as occurs in type I fatty acid biosynthesis .   Structural studies show that the enzyme is a tetramer which forms a typical Rossman fold , . Unlike other members of the short-chain dehydrogenase/reductase superfamily, the enzyme undergoes a marked conformational change upon binding of the NADP(H)cofactor. This conformational change aligns the side chains of the catalytic triad at the active site in an active conformation and increases the affinity of the enzyme for its substrate.; GO: 0004316 3-oxoacyl-[acyl-carrier-protein] reductase activity, 0051287 NAD binding, 0006633 fatty acid biosynthetic process.
Probab=100.00  E-value=0  Score=530.02  Aligned_cols=228  Identities=29%  Similarity=0.397  Sum_probs=218.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             9993899868899999999889989999789-899999999998649928999878999999999999999981898799
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      |||||||||||+|||++||++|++|++++|+ ++.++++.++++++|.++..+.|||+|+++++++++++.++|| ||||
T Consensus         1 AlVTGasRGIG~AIA~~LA~~Ga~V~i~y~~~e~~~~~~~~e~~~~G~~a~~~~~dvs~~~~~~~~~~~~~~~~G-iDiL   79 (238)
T TIGR01830         1 ALVTGASRGIGRAIALKLAKEGAKVIITYRTSEEGAEEVVEEIKELGVKAAGVVLDVSDREDVKALVEEAEEELG-IDIL   79 (238)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHC-CEEE
T ss_conf             967167861679999999867995999659825788899999985697599996038888999999999999829-9089


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             87687588888867659999999999998999999999999998608986999788356478898368898999999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALA  179 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt  179 (257)
                      ||||||+.+ ..+..+++||||.+++|||+|.|++||++++.|.++.+||||||||..|..|.|+++-|+||||||++||
T Consensus        80 VNNAGITrD-~Ll~RMk~edWd~Vi~~NL~g~F~~t~~v~~~M~K~R~GrIINisSVVG~~GN~GQaNYaASKAG~IGft  158 (238)
T TIGR01830        80 VNNAGITRD-NLLMRMKEEDWDAVINVNLKGVFNLTQAVLRPMIKQRSGRIINISSVVGLMGNAGQANYAASKAGVIGFT  158 (238)
T ss_pred             EECCCCCCC-CHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             978741343-0100488556899998612668788899889887506743486100200006874267888875589999


Q ss_pred             HHHHHHHHHHCCEEEEECCCCCCCHHHHH--------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCCCE
Q ss_conf             99999854438699755328837977984--------414443245888899999999961975-626685798768763
Q gi|254780337|r  180 RTWSKETVNTALRVINIDPGPTRTSMRAK--------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNRF  250 (257)
Q Consensus       180 ~~la~E~~~~gIrvn~I~PG~v~T~m~~~--------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG~~  250 (257)
                      |+||+|++.||||||||+||+|+|||.++        .....|.+|+++|||||++|.||+||+ +|+|||+|+||||-+
T Consensus       159 KSlAkElasRnItVNaVAPGFI~TdMT~~L~e~~~~~~l~~IPLgR~G~pEeVA~~v~FLASd~AsYITGqv~~VdGGm~  238 (238)
T TIGR01830       159 KSLAKELASRNITVNAVAPGFIETDMTDKLSEKVKKAMLSQIPLGRFGTPEEVANAVAFLASDEASYITGQVIHVDGGMV  238 (238)
T ss_pred             HHHHHHCCCCCCEEEEECCCCCCCCCCHHCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCCCC
T ss_conf             99998603687058887489989700021698899999852772326776569999997325124742551663068789


No 2  
>PRK06172 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=486.28  Aligned_cols=240  Identities=24%  Similarity=0.327  Sum_probs=228.6

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+|+|+||++|||||++|||+++|+.|+++|++|++++|++++++++.+++++.|.++.++++|++|+++++++++++.+
T Consensus         1 M~~~L~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~   80 (253)
T PRK06172          1 MSMTFSGQVALVTGGAAGIGRATAIAFAREGAKVVVADRDAAGGEETVALIREAGGEALFIACDVTRDAEVKALVEKTIA   80 (253)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             99886999899937576899999999998799899997988999999999996499379998189999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +||++|+||||||+.....|++++++|+|++++++||+|+|+++|+++|+|+++++|+|||++|.+++.+.|+.++|++|
T Consensus        81 ~~G~iDiLVNNAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~g~~~~~~~~~Y~as  160 (253)
T PRK06172         81 AYGRLDYAFNNAGIEIEQGRLAEGSEAEFDAIMGVNVKGVWLCMKYQIPLMLAQGGGAIVNTASVAGLGAAPKMSIYAAS  160 (253)
T ss_pred             HCCCCCEEEECCCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCCCHHHHHH
T ss_conf             82999999989888999999013999999999999739999999999999998599589997666647689997789999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC-----------CCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             9999999999999854438699755328837977984414-----------443245888899999999961975-6266
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP-----------AEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~-----------~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      |+|+.+|||+||.||+++|||||+|+||+|+|||..+...           ..|.+|+++|||||++++||||++ +|+|
T Consensus       161 Kaal~~ltr~lA~e~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~FLaSd~a~~iT  240 (253)
T PRK06172        161 KHAVIGLTKSAAIEYAKKGIRVNAVCPAVIDTDMFRRAYEADPRKAEFAAAMHPVGRIGKVEEIANAVLYLCSDGASFTT  240 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999998633187899997797987577644218999999997379989985999999999999385326825


Q ss_pred             CCEEEECCCCEE
Q ss_conf             857987687631
Q gi|254780337|r  240 GKLFSVPQNRFV  251 (257)
Q Consensus       240 G~~~~vdgG~~~  251 (257)
                      |++|.||||...
T Consensus       241 G~~i~VDGG~tA  252 (253)
T PRK06172        241 GHSLMVDGGATA  252 (253)
T ss_pred             CCEEEECCCHHC
T ss_conf             982873924103


No 3  
>PRK07478 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=475.82  Aligned_cols=239  Identities=26%  Similarity=0.347  Sum_probs=226.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|+.|+++|++|++++|++++++++.+++++.|.++.++++|++|+++++++++++.++|
T Consensus         2 m~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~ei~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~   81 (254)
T PRK07478          2 MLLNGKVAIITGASSGIGRAAAKLFAREGAKVVVGARRQAELDQLVAEIRAEGGEAVALAGDVRDEAYAKALVALAVERF   81 (254)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             88899879995887689999999999879999999798899999999999649908999768999999999999999984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-CCCCCHHHHHHH
Q ss_conf             8987998768758888886765999999999999899999999999999860898699978835647-889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK-CRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~-~~~~~~~Y~asK  172 (257)
                      |++|+||||||+..+..|++++++|+|++++++||+|+|+++|+++|+|+++++|+|||++|..+.. +.|+.++|++||
T Consensus        82 G~iDiLVNNAG~~~~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~g~~~g~~~~~~Y~asK  161 (254)
T PRK07478         82 GGLDIAFNNAGILGEMGPVPELSLEGWRETLATNLTSAFLGAKHQIPAMLARGGGSLIFTSTFVGHTAGFPGMAAYAASK  161 (254)
T ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCCHHHHHHH
T ss_conf             99989998874368998914499999999999986999999999999998869987999843664336889735679889


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC----------CCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             999999999999854438699755328837977984414----------443245888899999999961975-626685
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP----------AEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~----------~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      +||.+|||+||.||+++|||||+|+||+|+|||.....+          ..|.+|+++|||||++++||||++ +|+|||
T Consensus       162 aav~~lTr~lA~E~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~pl~R~g~peeiA~~v~FLaSd~ss~iTG~  241 (254)
T PRK07478        162 AGLIGLTQVLAAEYGARGIRVNALLPGGTDTPMGRAAADTPEALAFVAGLHALKRMAQPEEIAQAALFLASDAASFVTGT  241 (254)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999985703859999977989887576425999999998628998898399999999999958432384497


Q ss_pred             EEEECCCCEEC
Q ss_conf             79876876315
Q gi|254780337|r  242 LFSVPQNRFVN  252 (257)
Q Consensus       242 ~~~vdgG~~~n  252 (257)
                      +|.||||..++
T Consensus       242 ~i~VDGG~sls  252 (254)
T PRK07478        242 ALLADGGVSIT  252 (254)
T ss_pred             EEEECCCEECC
T ss_conf             58878897341


No 4  
>PRK07063 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=473.31  Aligned_cols=240  Identities=22%  Similarity=0.328  Sum_probs=224.6

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             2652488999993899868899999999889989999789899999999998-649928999878999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~-~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      |..+|+||++|||||++|||+++|+.|+++|++|++++|+.++++++.+++. +.|.++.++++|++|+++++++++++.
T Consensus         1 Mm~rL~gKvalVTGa~~GIG~aiA~~~a~~Ga~V~i~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~   80 (259)
T PRK07063          1 MMNRLAGKVALVTGAAQGIGAAIARAFVREGAAVALADLDAALAERAAAAIARQTGARVLALPADVTRAASVRAAVARAE   80 (259)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             97535998899958787899999999998799899997987899999999988509918999836899999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||+||+||||||+. ...++.++++|+|++++++|++|+|+++|+++|+|+++++|+||||+|.+++.+.|+..+|++
T Consensus        81 ~~~G~iDiLVNNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~a  159 (259)
T PRK07063         81 AAFGPLDVLVNNAGIN-VFADPLAMTDEDWRRCFAVDLDGAWNCCRAVLPGMVERGRGSIVNIASTHAFKIIPGCFPYPV  159 (259)
T ss_pred             HHHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
T ss_conf             9819988999899778-999904499999999998752889999999999999869966999877665677999667999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC--------------CCCCCCCCCCHHHHHHHHHHHHCHH-
Q ss_conf             9999999999999985443869975532883797798441--------------4443245888899999999961975-
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM--------------PAEDPNTVPHPQKVAKIISFLCATQ-  235 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~--------------~~~~~~~~~~pediA~~v~fL~s~~-  235 (257)
                      ||+|+.+|||+||.||+++|||||+|+||+|+|||..+.+              ...|.+|+++|||||++++||||++ 
T Consensus       160 sKaav~~lTr~lA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~peeiA~~v~FLaSd~a  239 (259)
T PRK07063        160 AKHGLLGLTRALGIEYAARNVRVNAIAPGYIETQLTEDWWNAQPDPAAARAETLALQPMKRIGRPEEVAMTAVFLASDEA  239 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHH
T ss_conf             99999999999999971419299989767798776898875279989999999827999997789999999999958652


Q ss_pred             HCCCCCEEEECCCCEEC
Q ss_conf             62668579876876315
Q gi|254780337|r  236 KIETGKLFSVPQNRFVN  252 (257)
Q Consensus       236 ~~~tG~~~~vdgG~~~n  252 (257)
                      +|+|||+|.||||+.+=
T Consensus       240 s~iTG~~i~VDGG~ti~  256 (259)
T PRK07063        240 PFINATCITIDGGRSVL  256 (259)
T ss_pred             CCCCCCEEEECCCHHHH
T ss_conf             58248718988196552


No 5  
>PRK06841 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=472.61  Aligned_cols=240  Identities=22%  Similarity=0.302  Sum_probs=222.5

Q ss_pred             CCCCEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             89732652488999993899868899999999889989999789899999999998649928999878999999999999
Q gi|254780337|r    8 NNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKT   87 (257)
Q Consensus         8 ~~~~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~   87 (257)
                      +.-+|+++|+||+||||||++|||+++|+.|+++|++|++++|+++.++...+   ..+.++.++++|++|+++++++++
T Consensus         5 ~~~~m~~~l~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~d~~~~~~~~~~~---~~~~~~~~~~~Dvt~~~~v~~~v~   81 (255)
T PRK06841          5 KQFDLAFDLSGKVAVVTGGASGIGHAIAELFAAKGARVALLDRSEDVAEVAAQ---LLGGNAKGLVCDVSDSQSVEAAVA   81 (255)
T ss_pred             CCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH---HCCCCEEEEEEECCCHHHHHHHHH
T ss_conf             25583758999999997967789999999999879999999698789999998---459966999984699999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHH
Q ss_conf             99998189879987687588888867659999999999998999999999999998608986999788356478898368
Q gi|254780337|r   88 YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA  167 (257)
Q Consensus        88 ~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~  167 (257)
                      ++.++||+||+||||||+. ...|++++++|+|++++++|++|+|+++|+++|+|+++++|+||||+|.+++.+.|+.++
T Consensus        82 ~~~~~~g~iDiLVNNAGi~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~G~IInisS~~~~~~~~~~~~  160 (255)
T PRK06841         82 AAISAFGRIDILVNSAGVA-LLAPAEDVSEADWDKTIDINLKGSFLMAQAVGRHMIAAGGGKIVNLASQAGVVALERHVA  160 (255)
T ss_pred             HHHHHHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHH
T ss_conf             9999819987999899789-999804499999999999855999999999999999829965999946665668998588


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC---------CCCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             8989999999999999985443869975532883797798441---------4443245888899999999961975-62
Q gi|254780337|r  168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM---------PAEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       168 Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~---------~~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      |++||+|+.+|||+||.||+++|||||+|+||+|+|+|..+.+         ...|.+|+++|||||++++||||++ +|
T Consensus       161 Y~asKaav~~ltrslA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fLaSd~ss~  240 (255)
T PRK06841        161 YCASKAGVVGMTKVLALEWGPHGITVNAISPTVVLTELGKKAWAGEKGERAKKLIPAGRFAYPEEIAAAALFLASDAAAM  240 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             99999999999999999970309599998538897703433247488999985599999778999999999996873238


Q ss_pred             CCCCEEEECCCCEE
Q ss_conf             66857987687631
Q gi|254780337|r  238 ETGKLFSVPQNRFV  251 (257)
Q Consensus       238 ~tG~~~~vdgG~~~  251 (257)
                      +|||+|.||||..+
T Consensus       241 iTG~~i~VDGG~ti  254 (255)
T PRK06841        241 ITGENLVIDGGYTI  254 (255)
T ss_pred             CCCCEEEECCCCCC
T ss_conf             55870895868058


No 6  
>PRK06227 consensus
Probab=100.00  E-value=0  Score=471.83  Aligned_cols=239  Identities=28%  Similarity=0.339  Sum_probs=225.6

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|+.|+++|++|++++|+++.+++..+++++.|.++.++++|++|+++++++++++.++|
T Consensus         1 m~L~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~   80 (256)
T PRK06227          1 MNLSGKVAIVTGGGQGIGAAIAQTFAENGAKVVIADIDEEAGLEREEMLRSNGLDALFVKTDVSDEEDVKNMVRKTVERY   80 (256)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             98999889995866889999999999879999999698889999999999559918999816899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ..++++++++|+|++++++||+|+|+++|+++|+|+++++|+||||+|.+++.+.|+..+|++||+
T Consensus        81 G~iDiLVNNAGi~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKa  159 (256)
T PRK06227         81 GGIDILINNAGIF-SGKSIFERTLEEWERVIRVNLTGPYLCSKYAAEEMIKNGGGVIINIASTRAFQSEPNTEPYSASKG  159 (256)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
T ss_conf             9997999899899-998903498999999999982999999999999999849977999622554568998688999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH------------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             999999999998544386997553288379779844------------14443245888899999999961975-62668
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA------------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~------------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
                      ||.+|||+||.||+++|||||+|+||+|+|+|+...            ....|.+|+++|||||++++||||++ +|+||
T Consensus       160 av~~lTr~lA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~P~gR~g~peeiA~~v~FL~Sd~as~iTG  239 (256)
T PRK06227        160 GIIALTHSLAVSLSKYKIRVVSISPGWIETSEWKKPPLRKKPQLTPLDHLQHPAGRVGKPEDVANLCLFLASDEASFITG  239 (256)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             99999999999962029499999618696650005751025777887862688779859999999999996763249258


Q ss_pred             CEEEECCCCEECC
Q ss_conf             5798768763154
Q gi|254780337|r  241 KLFSVPQNRFVNY  253 (257)
Q Consensus       241 ~~~~vdgG~~~n~  253 (257)
                      |+|.||||..+..
T Consensus       240 ~~i~VDGG~t~~~  252 (256)
T PRK06227        240 VNFIVDGGMTVKM  252 (256)
T ss_pred             CEEEECCCEEEEE
T ss_conf             6389678917675


No 7  
>PRK06138 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=471.93  Aligned_cols=236  Identities=27%  Similarity=0.367  Sum_probs=222.9

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|+++.++++.+++.. +.++.++++|++|+++++++++++.++|
T Consensus         1 m~L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~-~~~~~~~~~Dvs~~~~v~~~~~~~~~~~   79 (252)
T PRK06138          1 MRLAGRVAIVTGAGSGIGRATAKLFAREGARVVVADRDAEAAERVAAAIAA-GGRAFARQGDVGSAEAVEALVDFVAARW   79 (252)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             988998899947467999999999998799899996887899999999837-9919999942899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ...+++++++|+|++++++|++|+|+++|+++|+|+++++|+||||+|.+++.+.|+.++|++||+
T Consensus        80 G~iDiLVNNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKa  158 (252)
T PRK06138         80 GRLDVLVNNAGFG-CGGTVVTTDEADWDAVMRVNVGGVFLWAKYAIPIMQRQGGGSIVNTASQLALAGGRGRAAYVASKG  158 (252)
T ss_pred             CCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
T ss_conf             9998999898899-999801099999999999996999999999999999819967999765665778999778999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC--------------CCCCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             9999999999985443869975532883797798441--------------4443245888899999999961975-626
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM--------------PAEDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~--------------~~~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
                      ||.+|||+||.||+++|||||+|+||+|+|||+.+.+              ...|.+|+++|||||++++||||++ +|+
T Consensus       159 av~~lTk~lA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedIA~~v~FL~Sd~as~i  238 (252)
T PRK06138        159 AIASLTRAMALDHATDGIRVNAVAPGTIDTPYFRRIFARHADPEALREALRARHPMNRFGTAEEVAQAALFLASDESSFA  238 (252)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999999862229199999758899735667766138979999999717998997889999999999967632593


Q ss_pred             CCCEEEECCCCEE
Q ss_conf             6857987687631
Q gi|254780337|r  239 TGKLFSVPQNRFV  251 (257)
Q Consensus       239 tG~~~~vdgG~~~  251 (257)
                      |||+|.||||...
T Consensus       239 TG~~i~VDGG~tA  251 (252)
T PRK06138        239 TGTTLVVDGGWLA  251 (252)
T ss_pred             CCCEEECCCCHHC
T ss_conf             6874881853534


No 8  
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=470.36  Aligned_cols=239  Identities=28%  Similarity=0.383  Sum_probs=225.3

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+.+|+||+||||||++|||+++|+.|+++|++|++++|++++++++.+++++.|+++.++++|++++++++++++++.+
T Consensus         1 Mm~~l~gKvalVTGgs~GIG~a~A~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~   80 (262)
T PRK13394          1 MMSNLNGKTAVVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVADEINKAGGKAIGVAMDVTNEDAVNAGIDKVAE   80 (262)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             99788999899958577899999999998799999997988999999999996299399998158999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-HCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             8189879987687588888867659999999999998999999999999998-608986999788356478898368898
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLK-KSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~-~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      +||++|+||||||+. ...|++++++|+|+++++|||+|+|+++|+++|+|+ ++++|+|||++|.+++.+.|+.++|++
T Consensus        81 ~~G~iDiLVnnAG~~-~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~M~k~~~~G~IVnisS~~~~~~~~~~~~Y~a  159 (262)
T PRK13394         81 RFGSVDILVSNAGIQ-IVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVT  159 (262)
T ss_pred             HHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
T ss_conf             819999999899889-9999165999999999999758999999999999998379968999745776767999768999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC--------------------CCCCCCCCCHHHHHHHHHH
Q ss_conf             99999999999999854438699755328837977984414--------------------4432458888999999999
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP--------------------AEDPNTVPHPQKVAKIISF  230 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~--------------------~~~~~~~~~pediA~~v~f  230 (257)
                      ||+|+.+|||+||.||+++|||||+|+||+++|||+.+.++                    ..|.+|+++|||||+++.|
T Consensus       160 sKaal~~ltk~lA~E~a~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~r~g~p~dvA~~v~f  239 (262)
T PRK13394        160 AKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGKTVDGVFTTVEDVAQTVLF  239 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999999852319699999758788702331365578763788589999998617998897299999999999


Q ss_pred             HHCHH-HCCCCCEEEECCCCEE
Q ss_conf             61975-6266857987687631
Q gi|254780337|r  231 LCATQ-KIETGKLFSVPQNRFV  251 (257)
Q Consensus       231 L~s~~-~~~tG~~~~vdgG~~~  251 (257)
                      |||++ +|+|||+|.||||.++
T Consensus       240 LaS~~a~~iTG~~i~VDGG~~m  261 (262)
T PRK13394        240 LSAFPSAALTGQSFVVSHGWFM  261 (262)
T ss_pred             HHCHHHCCCCCCEEEECCCHHH
T ss_conf             9385756916972898927641


No 9  
>PRK07067 sorbitol dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=471.14  Aligned_cols=235  Identities=21%  Similarity=0.334  Sum_probs=219.9

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|+.++++++.+++   +.++.++++|++|+++++++++++.++|
T Consensus         1 MrL~gKvalVTGas~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~---g~~~~~~~~Dvt~~~~v~~~v~~~~~~~   77 (256)
T PRK07067          1 MRLQGKVALLTGAASGIGEAVAQRYLREGARVVLADIKPARAALAALEI---GPAAVAVSLDVTRQDSIDRIVAAAVERF   77 (256)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH---CCCEEEEEEECCCHHHHHHHHHHHHHHC
T ss_conf             9989988999376778999999999987999999979889999999981---9975999984899999999999999981


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608-98699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |++|+||||||+. ...|++++++|+|++++++|++|+|+++|+++|+|++++ +|+||||+|.+++.+.|..++|++||
T Consensus        78 G~iDiLVNNAGi~-~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~~~~~G~IVnisS~~g~~~~~~~~~Y~asK  156 (256)
T PRK07067         78 GGIDILVNNAALF-DMAPILEISRDVYDRLFAVNVKGLFFLMQAVAQHMVEQGRGGKIINMASQAGRRGEALVSHYCATK  156 (256)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHHCCCCCCCHHHHHHH
T ss_conf             9998999899889-998813499999999999851778999999999999808995599984164366898866899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH-------------------CCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             9999999999998544386997553288379779844-------------------144432458888999999999619
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA-------------------MPAEDPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~-------------------~~~~~~~~~~~pediA~~v~fL~s  233 (257)
                      +|+.+|||+||.||+++|||||+|+||+|+|||+...                   ....|.+|+++|||||++++||||
T Consensus       157 aav~~lTr~lA~ela~~gIrVNaV~PG~i~T~m~~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~pedvA~~v~fLaS  236 (256)
T PRK07067        157 AAVISYTQSAALALARHGINVNAIAPGVVDTPMWDQVDALFARYENRPPGEKKRLVGEAVPLGRMGVPDDLTGAALFLAS  236 (256)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             99999999999997042928999954888886144566776553169979999999827998998689999999999958


Q ss_pred             HH-HCCCCCEEEECCCCEEC
Q ss_conf             75-62668579876876315
Q gi|254780337|r  234 TQ-KIETGKLFSVPQNRFVN  252 (257)
Q Consensus       234 ~~-~~~tG~~~~vdgG~~~n  252 (257)
                      ++ +|+|||+|.||||.+|+
T Consensus       237 d~a~~iTG~~l~VDGG~~ms  256 (256)
T PRK07067        237 ADADYIVAQTLNVDGGNWMS  256 (256)
T ss_pred             CHHCCCCCCEEEECCCHHCC
T ss_conf             64328058817879562209


No 10 
>PRK12939 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=469.40  Aligned_cols=239  Identities=29%  Similarity=0.356  Sum_probs=228.1

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+.+|+||+||||||++|||+++|+.|+++|++|++++|++++++++.+++++.|.+++++++|++++++++++++++.+
T Consensus         1 M~~~L~~KvalVTGgs~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~   80 (250)
T PRK12939          1 MASSLAGKRALVTGAARGLGAAFAEALAEAGATVAFNDGLAAEARELAAALEAAGGRAHAIAADLADPASVQRFFDAAAA   80 (250)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             99999998799958366899999999998799999996988999999999995599099999248999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +||++|+||||||+. ...|++++++|+|++++++|++|+|+++|+++|+|++++.|+||||+|.++..+.|++++|++|
T Consensus        81 ~~g~iDiLVNNAG~~-~~~~~~~~~~e~~~~~~~iNl~~~~~~~k~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~as  159 (250)
T PRK12939         81 ALGGLDGLVNNAGIT-NSKSATELDIDTWDAVMNVNVRGTFLMSRAALPHLRDSGRGRIVNLASDTALWGAPKLLAYVAS  159 (250)
T ss_pred             HCCCCCEEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
T ss_conf             749997999887789-9999034999999999999829999999999999998499379998067767689985889999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             99999999999998544386997553288379779844---------14443245888899999999961975-626685
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      |+|+.+|||+||.||+++|||||+|+||+++|+|....         ....|.+|+++|||||+++.||||++ +|+|||
T Consensus       160 Kaal~~ltk~lA~e~a~~~IrvN~V~PG~i~T~~~~~~~~~e~~~~~~~~~Pl~R~g~pedia~~v~fL~S~~s~~itG~  239 (250)
T PRK12939        160 KGAVIGMTRSLARELGGRGITVNAIAPGLTATEATAYVPAEERHAYYLQGRALERLQVPDDVAGAVLFLLSDAARFVTGQ  239 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999999603293999887677987032258988999999857999998099999999999948164690588


Q ss_pred             EEEECCCCEE
Q ss_conf             7987687631
Q gi|254780337|r  242 LFSVPQNRFV  251 (257)
Q Consensus       242 ~~~vdgG~~~  251 (257)
                      +|.||||.++
T Consensus       240 ~i~VDGG~~m  249 (250)
T PRK12939        240 LLPVNGGFVM  249 (250)
T ss_pred             EEEECCCHHC
T ss_conf             2897958421


No 11 
>PRK12935 acetoacetyl-CoA reductase; Provisional
Probab=100.00  E-value=0  Score=469.61  Aligned_cols=237  Identities=26%  Similarity=0.354  Sum_probs=224.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999-78989999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      |+|+||++|||||++|||+++|+.|+++|++|+++ +++++.++++.++++..|.++.++++|++|+++++++++++.++
T Consensus         2 ~~L~gKvalVTG~s~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~v~~~~~~   81 (247)
T PRK12935          2 VQLNGKVAIVTGGAKGIGKAITVALAQEGAKVVINYNSSKEAAENLVNELGKEGHDVYAVQADVSKVEDANRLVEEAVNH   81 (247)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             98896989991727689999999999879989997699989999999999843995899985799999999999999998


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      ||++|+||||||+.. ..+|+++++|+|++++++||+|+|+++|+++|+|+++++|+||||+|.+++.+.++.++|++||
T Consensus        82 ~G~iDiLVNNAGi~~-~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IVnisS~~g~~g~~~~~~Y~asK  160 (247)
T PRK12935         82 FGKVDILVNNAGITR-DRTFKKLNREDWERVIDVNLSSVFNTTSAVLPYITEAEEGRIISISSIIGQAGGFGQTNYSAAK  160 (247)
T ss_pred             CCCCCEEEECCCCCC-CCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
T ss_conf             399989998998899-9990449999999999997699999999976874227995289955546456899858999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHHHCCCCCEEE
Q ss_conf             9999999999998544386997553288379779844--------14443245888899999999961975626685798
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFS  244 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~~~~tG~~~~  244 (257)
                      +||.+|||+||.||+++|||||+|+||+|+|+|..+.        ....|.+|+++|||||++++||||+++|+|||+|.
T Consensus       161 aal~~ltk~lA~Ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~iPl~R~g~pediA~~v~fLasd~ayiTG~~i~  240 (247)
T PRK12935        161 AGMLGFTKSLALELAKTNVTVNAICPGFIDTEMVAEVPEEVRQKIVAKIPKKRFGQADEIAKGVVYLCRDGAYITGQQLN  240 (247)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             99999999999997140969999962778873223068999999985699989859999999999995797655478588


Q ss_pred             ECCCCEE
Q ss_conf             7687631
Q gi|254780337|r  245 VPQNRFV  251 (257)
Q Consensus       245 vdgG~~~  251 (257)
                      ||||.+|
T Consensus       241 VDGG~~m  247 (247)
T PRK12935        241 INGGLYM  247 (247)
T ss_pred             ECCCCCC
T ss_conf             5889899


No 12 
>PRK12829 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=468.21  Aligned_cols=238  Identities=29%  Similarity=0.355  Sum_probs=220.9

Q ss_pred             CCEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             73265248899999389986889999999988998999978989999999999864992899987899999999999999
Q gi|254780337|r   10 SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        10 ~~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      .+|..+|+||+||||||++|||+++|++|+++|++|++++|++++++++..++.  +.++..++||++|+++++++++++
T Consensus         3 m~~m~~L~GKvalVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~~~~--~~~~~~~~~Dvt~~~~v~~~v~~~   80 (264)
T PRK12829          3 IDLLKPLDGLRVLVTGGASGIGRAIAEAFAEAGARVHVCDVSEAALAATAARLP--GAKVTATVADVADPAQVERVFDTA   80 (264)
T ss_pred             HHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC--CCCEEEEEEECCCHHHHHHHHHHH
T ss_conf             225768999979994737689999999999879989999799899999999747--997599996289999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-EEEEECCHHHCCCCCCCHHH
Q ss_conf             99818987998768758888886765999999999999899999999999999860898-69997883564788983688
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG-RAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G-~IInisS~~g~~~~~~~~~Y  168 (257)
                      .++||+||+||||||+..+..+++++++|+|++++++||+|+|+++|+++|+|+++++| .|||+||.+++.+.|+.++|
T Consensus        81 ~~~~G~iDiLVNNAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~~IinisS~~~~~~~~~~~~Y  160 (264)
T PRK12829         81 VERFGGLDVLVNNAGIAGPTGGIDEITPEQWEQTLAVNLNGQFYFARAAVPLLRASGHGGVIIALSSVAGRLGYPGRTPY  160 (264)
T ss_pred             HHHCCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCCCHHH
T ss_conf             99739998999899899999980239999999999998487899999999999873998089998026547799886789


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-------------------CCCCCCCCCCHHHHHHHHH
Q ss_conf             989999999999999985443869975532883797798441-------------------4443245888899999999
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-------------------PAEDPNTVPHPQKVAKIIS  229 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-------------------~~~~~~~~~~pediA~~v~  229 (257)
                      ++||+|+.+|||+||.||+++|||||+|+||+|+|||..+..                   ...|.+|+++|||||++++
T Consensus       161 ~asKaal~~ltr~lA~E~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~peeiA~~v~  240 (264)
T PRK12829        161 AASKWAVVGLVKSLAIELGPLGIRVNAILPGIVRGPRMRRVIEARAQQLGIGLDEMEQEYLEKISLGRMVEPEDIAATAL  240 (264)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             99999999999999999854094999886288888025445465676537887999999980799999788999999999


Q ss_pred             HHHCHH-HCCCCCEEEECCCC
Q ss_conf             961975-62668579876876
Q gi|254780337|r  230 FLCATQ-KIETGKLFSVPQNR  249 (257)
Q Consensus       230 fL~s~~-~~~tG~~~~vdgG~  249 (257)
                      ||||++ +|+|||+|.||||-
T Consensus       241 FLaSd~ss~iTG~~i~VDGGl  261 (264)
T PRK12829        241 FLASPAARYITGQAISVDGNV  261 (264)
T ss_pred             HHHCCHHCCCCCCEEEECCCC
T ss_conf             995816458058777978780


No 13 
>PRK06346 consensus
Probab=100.00  E-value=0  Score=465.49  Aligned_cols=237  Identities=20%  Similarity=0.320  Sum_probs=224.4

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++++.++++.++++|++++++++++++++.++|
T Consensus         1 m~l~gKv~lITGgs~GIG~a~a~~la~~Ga~V~i~~r~~e~~~~~~~~l~~~~~~~~~~~~Dv~~~~~v~~~i~~~~~~f   80 (251)
T PRK06346          1 MKLKGKVAIVTGAASGMGKSIAELFAKEGAKVVVADLNLERAQKVVEEITSNGGTAIAVVANVTKQEDIENMVDTAVDTY   80 (251)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             98899889994757889999999999879989999798999999999999639908999778898999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |+||+||||||+.....|+.++++|+|++++++||+|+|+++|.++|+|+++++|+||||+|.+++.+.|..++|++||+
T Consensus        81 g~iDiLVnNAgi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~asK~  160 (251)
T PRK06346         81 GTLDILVNNAGIMDNFVPVGELTDELWDKVFAVNTTGVMRATRKALPIFEEKGSGVIVNIASVGGLNGSRAGAAYTASKH  160 (251)
T ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHHH
T ss_conf             99979998998899998711289999999999970999999999999999859954999945654788988758999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC-----------CC-CCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             999999999998544386997553288379779844144-----------43-245888899999999961975-62668
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA-----------ED-PNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~-----------~~-~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
                      ||.+|||+||.||+++|||||+|+||+|+|+|.......           .+ ..|+++|||||++++||||++ +|+||
T Consensus       161 al~~ltr~lA~e~a~~gIrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~R~g~pediA~~v~fL~Sd~s~~iTG  240 (251)
T PRK06346        161 AVIGLTKNTGFMYANKGIRCNAIAPGAVNTNIGTTITAPDEFGQERAMAGMGTNPRAGQAEEIAQVALFLASDDASFVNG  240 (251)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             99999999999862419599998768897723331247897799988624888898768999999999995715359368


Q ss_pred             CEEEECCCCE
Q ss_conf             5798768763
Q gi|254780337|r  241 KLFSVPQNRF  250 (257)
Q Consensus       241 ~~~~vdgG~~  250 (257)
                      |+|.||||..
T Consensus       241 ~~i~VDGG~t  250 (251)
T PRK06346        241 TVITADGGWT  250 (251)
T ss_pred             CEEECCCCCC
T ss_conf             6288085827


No 14 
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=465.87  Aligned_cols=242  Identities=25%  Similarity=0.348  Sum_probs=229.3

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      +..++|+||+||||||++|||+++|+.|+++|++|++++|+.++++++.++++..+.++.++++|++|+++++++++++.
T Consensus         7 ~~~~~L~gK~alITGgs~GIG~~ia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~   86 (259)
T PRK06124          7 LQRFSLAGQVALVTGSARGLGLEIARALAEAGAHVLVNGRNAARVEAAVAALRAAGGAAEALVFDISDEEAVAAAFARID   86 (259)
T ss_pred             HHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             36409999989992867489999999999879999999698899999999999659958999951799999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||++|+||||||+. ...++.++++|+|++++++|++|+|+++|++.|+|+++++|+||||+|.++..+.|+.++|++
T Consensus        87 ~~~g~iDiLVnnAG~~-~~~~~~~~~~e~~~~~~~~Nl~g~~~~~q~~~~~M~~~~~G~IInisS~~~~~~~~~~~~Y~a  165 (259)
T PRK06124         87 AEHGRLDILVNNVGAR-NRRPLAELDDAEIRALLETDLVAPILLSRLAAQRMVRQGYGRIIAITSIAGEVARAGDAVYPA  165 (259)
T ss_pred             HHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHH
T ss_conf             9759997999898889-999906699999999999984999999999999987769936999723300467998378999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC----------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             9999999999999985443869975532883797798441----------4443245888899999999961975-6266
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM----------PAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~----------~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      ||+|+.+|||++|.||+++|||||+|+||++.|++.....          ...|.+|+++|||||+++.||||++ +|+|
T Consensus       166 sKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~Sd~ssyiT  245 (259)
T PRK06124        166 AKQGLTGLMRALAAEFGPHGITSNAIAPGYFATETNAAMAADPEVGEWLRARTPLGRWGRPEEIAGAAVFLASPAASYVN  245 (259)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999965139799999758897732211127999999998579989985999999999999584435863


Q ss_pred             CCEEEECCCCEECC
Q ss_conf             85798768763154
Q gi|254780337|r  240 GKLFSVPQNRFVNY  253 (257)
Q Consensus       240 G~~~~vdgG~~~n~  253 (257)
                      ||+|.||||..++|
T Consensus       246 G~~i~VDGG~sv~~  259 (259)
T PRK06124        246 GHVLAVDGGYSVHF  259 (259)
T ss_pred             CCEEEECCCCCCCC
T ss_conf             85388698831889


No 15 
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=100.00  E-value=0  Score=463.87  Aligned_cols=235  Identities=23%  Similarity=0.345  Sum_probs=224.1

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             48899999389986889999999988998999978989999999999864992899987899999999999999998189
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      |+||++|||||++|||+++|++|+++|++|++++|++++++++.+++++.|.++.++++|++|+++++++++++.++||+
T Consensus         1 L~gKvalITG~s~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~v~~~~~~~G~   80 (250)
T TIGR03206         1 LKDKTAIVTGGGGGIGGATCRRFAEEGAKVAVFDLNREAAEKVAADIRAKGGNAQAFACDITDRDSVDTAVAAAEQALGP   80 (250)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             95199999685768999999999987999999979889999999999953992899994489999999999999997599


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             87998768758888886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      ||+||||||+. ..+|++++++++|++++++|++|+|+++|+++|+|+++++|+|||++|.+++.+.|+.++|++||+|+
T Consensus        81 iDilvnnAg~~-~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaav  159 (250)
T TIGR03206        81 VDVLVNNAGWD-KFGPFTKTEPPLWERLIAINLTGALHMHHAVLPGMVERGAGRIVNIASDAARVGSSGEAVYAACKGGL  159 (250)
T ss_pred             CCEEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             97999898889-99890349999999999998299999999999999974991799965577576899858899999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             9999999998544386997553288379779844--------------14443245888899999999961975-62668
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
                      .+|||+||.||+++|||||+|+||+++|+|.++.              ....|.+|+++|||||+++.||||++ +|+||
T Consensus       160 ~~ltk~lA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~e~~~~~~~~~~Pl~R~g~pediA~~v~fL~Sd~s~~itG  239 (250)
T TIGR03206       160 VAFSKTMAREHARHGITVNVVCPGPTDTALLDDICGGAENPEKLREAFTRAIPLGRLGQPDDLPGAILFFSSDDASFITG  239 (250)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             99999999996532918999976888867789876443886999999984799899839999999999995834338458


Q ss_pred             CEEEECCCCEE
Q ss_conf             57987687631
Q gi|254780337|r  241 KLFSVPQNRFV  251 (257)
Q Consensus       241 ~~~~vdgG~~~  251 (257)
                      |+|.||||..|
T Consensus       240 ~~i~VDGG~t~  250 (250)
T TIGR03206       240 QVLSVSGGLTM  250 (250)
T ss_pred             CEEEECCCEEC
T ss_conf             83886869049


No 16 
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=466.64  Aligned_cols=239  Identities=22%  Similarity=0.406  Sum_probs=222.7

Q ss_pred             CEE-ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             326-5248899999389986889999999988998999978989999999999864992899987899999999999999
Q gi|254780337|r   11 EIH-VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        11 ~m~-~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      .|+ ++|+||+||||||++|||+++|+.|+++|++|++++|+. +++++++.+++.|.++.++++|++|+++++++++++
T Consensus         7 ~m~~f~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~-~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~v~~~   85 (258)
T PRK06935          7 SMDFFSLKGKVAIVTGGNTGLGQGYAVALAKAGADIIITTHGT-NWDETRRLIEKEGRKVTFVQLDLTKKESAEAVVAEA   85 (258)
T ss_pred             CHHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCC-CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHH
T ss_conf             2543199999899948575899999999998799999972997-899999999966993799990489999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             99818987998768758888886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      .++||++|+||||||+. ...|++|+++|+|++++++||+|+|+++|+++|+|+++++|+||||+|.++..+.++.++|+
T Consensus        86 ~~~~G~iDiLVNNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IInisS~~~~~g~~~~~~Y~  164 (258)
T PRK06935         86 LEKFGKIDILVNNAGTI-RRAPLLEYKDEDWQAVIDINLNSVYHLSQAVAKVMAKQGSGKIINIASMLSFQGGKFVPPYT  164 (258)
T ss_pred             HHHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCCCCCCHHHH
T ss_conf             99749999999899999-99980239999999999986478999999999999983898189995320167888876699


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH----------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             899999999999999854438699755328837977984----------414443245888899999999961975-626
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK----------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~----------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
                      +||+|+.+|||+||.||+++|||||+|+||+|+|+|...          .....|.+|+++|||||++++||||++ +|+
T Consensus       165 asKaav~~lTr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~iPlgR~g~peeiA~~v~FLaSd~s~~i  244 (258)
T PRK06935        165 ASKHGVAGLTKAFANELAAYNIQVNAIAPGYIKTANTAPIRADKARNAEILKRIPAGRWGEPDDLMGAAVFLASRASDYV  244 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999999999997226989999854889786501124799999999955999997789999999999838432691


Q ss_pred             CCCEEEECCCCEE
Q ss_conf             6857987687631
Q gi|254780337|r  239 TGKLFSVPQNRFV  251 (257)
Q Consensus       239 tG~~~~vdgG~~~  251 (257)
                      |||+|.||||.++
T Consensus       245 TG~~i~VDGG~~~  257 (258)
T PRK06935        245 NGHILAVDGGWLV  257 (258)
T ss_pred             CCCEEEECCCCCC
T ss_conf             2872897858037


No 17 
>PRK08085 gluconate 5-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=465.18  Aligned_cols=238  Identities=28%  Similarity=0.371  Sum_probs=226.9

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ++|+||+|||||+++|||+++|+.|+++|++|++++|++++++++.+++++.|.++.++++|++|+++++++++++.++|
T Consensus         5 ~~L~gK~alVTG~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~   84 (254)
T PRK08085          5 FSLAGKNILITGSAQGIGFLLATGLAEYGAEIIINDITAERAEKAVAKLRQEGIKAHAAAFNVTHKQEIEAAIEHIEKDI   84 (254)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             28999989996856789999999999869999999698899999999998449818999826899999999999999983


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ...||+++++|+|++++++||+|+|+++|+++|+|+++++|+|||++|.++..+.|+..+|++||+
T Consensus        85 G~iDilVnNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~q~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKa  163 (254)
T PRK08085         85 GPIDVLINNAGIQ-RRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVARYMVKRQAGKIINICSMQSELGRDTITPYAASKG  163 (254)
T ss_pred             CCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHHHHH
T ss_conf             9986999898678-887701098999999999984999999999859988739972999977301447898567899999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCE
Q ss_conf             999999999998544386997553288379779844----------14443245888899999999961975-6266857
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKL  242 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~  242 (257)
                      |+.+|||++|.||+++|||||+|+||+++|+|.+..          ....|.+|+++|||||++++||||++ +|+|||+
T Consensus       164 ai~~ltr~lA~e~a~~~IrvN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~~~fLaS~~ss~iTG~~  243 (254)
T PRK08085        164 AVKMLTRGMCVELARHNIQVNGIAPGYFKTEMTKALVEDEAFTAWLCKRTPAARWGDPQELIGAAVFLSSKASDFVNGHL  243 (254)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             99999999999967279699999768898710210037999999998579988988999999999999575224865874


Q ss_pred             EEECCCCEEC
Q ss_conf             9876876315
Q gi|254780337|r  243 FSVPQNRFVN  252 (257)
Q Consensus       243 ~~vdgG~~~n  252 (257)
                      |.||||.++.
T Consensus       244 i~VDGG~~~~  253 (254)
T PRK08085        244 LFVDGGMLVA  253 (254)
T ss_pred             EEECCCEEEE
T ss_conf             9988988865


No 18 
>PRK07523 gluconate 5-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=465.68  Aligned_cols=237  Identities=24%  Similarity=0.373  Sum_probs=220.8

Q ss_pred             EE-ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             26-52488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   12 IH-VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        12 m~-~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      |+ ++|+||++|||||++|||+++|+.|+++|++|++++|++++++++.+++   +.++..+++|++|+++++++++++.
T Consensus         2 m~~f~L~gK~alVTG~s~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~~l---~~~~~~~~~Dvtd~~~v~~~v~~~~   78 (251)
T PRK07523          2 FNLFDLTGRRALITGSSQGIGYALAKGLAQAGAEVILNGRDAAKLAAAAESL---KGSAHTLAFDVTDHDAVRAAIDAFE   78 (251)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC---CCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             8862689998999583669999999999987999999969989999999981---8872799995799999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||+||+||||||+. ...|++++++|+|++++++|++|+|+++|+++|+|+++++|+||||+|.++..+.|+.++|++
T Consensus        79 ~~~G~iDiLVNNAG~~-~~~~~~~~~~e~~~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~a  157 (251)
T PRK07523         79 AEIGPIDILVNNAGMQ-HRTPLEDFPADAFERLLQTNISSVFYVGQAVARHMIARGAGKIINIASVQSALARPGIAPYTA  157 (251)
T ss_pred             HHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHH
T ss_conf             9759986999898879-999905599999999999973999999999989988639967999941576076899478999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC----------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             9999999999999985443869975532883797798441----------4443245888899999999961975-6266
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM----------PAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~----------~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      ||+|+.+|||+||.||+++|||||+|+||+++|||.+...          ...|.+|+++|||||++++||||++ +|+|
T Consensus       158 sKaav~~lTr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~PlgR~g~peeia~~v~fLaSd~s~~iT  237 (251)
T PRK07523        158 TKGAVGNLTKGMATDWAKHGLQCNAIAPGYFDTPLNAALVADPEFSAWLEKRTPAGRWGKVEELVGACIFLASDASSFVN  237 (251)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999970209499999737898732432138999999998579999978999999999999487424826


Q ss_pred             CCEEEECCCCEEC
Q ss_conf             8579876876315
Q gi|254780337|r  240 GKLFSVPQNRFVN  252 (257)
Q Consensus       240 G~~~~vdgG~~~n  252 (257)
                      ||+|.||||...+
T Consensus       238 G~~i~VDGG~tAs  250 (251)
T PRK07523        238 GHVLYVDGGITAS  250 (251)
T ss_pred             CCEEEECCCCCCC
T ss_conf             8748809381137


No 19 
>PRK08226 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=464.26  Aligned_cols=235  Identities=26%  Similarity=0.376  Sum_probs=220.2

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +|+||+||||||++|||+++|+.|+++|++|++++|++ +++++.+++...|.++.++++|++|+++++++++++.++||
T Consensus         3 ~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~d~~~-~~~~~~~~~~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G   81 (263)
T PRK08226          3 KLTGKTALITGALQGIGEGIARVFARHGANLILLDISP-EIEKLADELCGRGHRCTAVVADVRDPASVAAAIKRAKEKEG   81 (263)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHC
T ss_conf             98998899947377999999999998799899996987-99999999983699179999417999999999999999839


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH-CCCCCCCHHHHHHHH
Q ss_conf             9879987687588888867659999999999998999999999999998608986999788356-478898368898999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA-YKCRPLWGAYSASKA  173 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g-~~~~~~~~~Y~asKa  173 (257)
                      ++|+||||||+. ...++.|+++|+|++++++||+|+|+++|+++|+|+++++|+|||++|.+| ..+.|+.++|++||+
T Consensus        82 ~iDiLVNNAGi~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~g~~~~~~~~~~Y~asKa  160 (263)
T PRK08226         82 RIDILVNNAGVC-RLGNFLDMSDEDRDFHIDINIKGVWNVTKAVLPEMIARKDGRIVMMSSVTGDMVADPGETAYALTKA  160 (263)
T ss_pred             CCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCCCCCCCHHHHHHHH
T ss_conf             986999899778-9999012999999999999729999999999999998389989999765330448997388999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC----------------CCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             9999999999985443869975532883797798441----------------4443245888899999999961975-6
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM----------------PAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~----------------~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      |+.+|||+||.||+++|||||+|+||+|+|||.++..                ...|.+|+++|||||++++||||++ +
T Consensus       161 av~~lTr~lA~Ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~FLaSd~a~  240 (263)
T PRK08226        161 AIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPEDPESVLTEMAKAIPLRRLADPLEVGELAAFLASDESS  240 (263)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999999962429599999758898768999986327546899999998479999977899999999999583634


Q ss_pred             CCCCCEEEECCCCEE
Q ss_conf             266857987687631
Q gi|254780337|r  237 IETGKLFSVPQNRFV  251 (257)
Q Consensus       237 ~~tG~~~~vdgG~~~  251 (257)
                      |+|||+|.||||..+
T Consensus       241 yiTG~~i~VDGG~tl  255 (263)
T PRK08226        241 YLTGTQNVIDGGSTL  255 (263)
T ss_pred             CCCCCEEEECCCCCC
T ss_conf             804882885888307


No 20 
>PRK12828 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=464.46  Aligned_cols=237  Identities=27%  Similarity=0.359  Sum_probs=225.2

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+++|+||++|||||++|||+++|+.|+++|++|++++|+.++++++.+++...  ...++.+|++++++++++++++.+
T Consensus         1 M~~~L~gKvalITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~--~~~~~~~Dvt~~~~~~~~v~~~~~   78 (239)
T PRK12828          1 MEHSLQGKVVAITGGFGGLGRATAAWLAARGARVALIGRGAAPLSQTLPGVPAD--ALRIGGIDLVDPQAARRAVDEVNR   78 (239)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCC--CCEEEEECCCCHHHHHHHHHHHHH
T ss_conf             999969898999472548999999999987998999979877899999875178--856999607999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +||++|+||||||+. ...+++++++|+|++++++||+|+|+++|+++|+|+++++|+||||+|.+++++.|++++|++|
T Consensus        79 ~~G~iDilVnNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~as  157 (239)
T PRK12828         79 QFGRLDALVNIAGAF-VWGTIADGDADTWDRMYGVNVKTTLNASKAALPALTASGGGRIVNIGAGAALKAGPGMGAYAAA  157 (239)
T ss_pred             HCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHH
T ss_conf             839997999897789-9999044999999999999969999999999999987699869999777867779996899999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCCCE
Q ss_conf             9999999999999854438699755328837977984414443245888899999999961975-626685798768763
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNRF  250 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG~~  250 (257)
                      |+|+.+|||+||.||+++|||||+|+||+|+|+|.++..+....+|+++|||||++++||||++ +|+|||+|.||||..
T Consensus       158 Kaal~~ltk~lA~e~~~~gIrVN~V~PG~v~T~~~~~~~~~~~~~r~~~p~diA~~v~fL~Sd~s~~iTG~~i~VdGG~~  237 (239)
T PRK12828        158 KAGVARLTEALAAELLDRGITVNAVLPSIIDTPPNRADMPDADFSRWVTPEQIAAVIAFLLSDEAQAITGASIPVDGGVA  237 (239)
T ss_pred             HHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHCCCCHHHCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCC
T ss_conf             99999999999998613090899997387888200241856461798999999999999958442285587489797867


Q ss_pred             E
Q ss_conf             1
Q gi|254780337|r  251 V  251 (257)
Q Consensus       251 ~  251 (257)
                      |
T Consensus       238 l  238 (239)
T PRK12828        238 L  238 (239)
T ss_pred             C
T ss_conf             8


No 21 
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=464.67  Aligned_cols=236  Identities=25%  Similarity=0.316  Sum_probs=221.6

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ++|+||++|||||++|||+++|+.|+++|++|++++|++++++++.+++++.|.++.++++|++|+++++++++++.++|
T Consensus         8 f~L~gKvalVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~   87 (259)
T PRK08213          8 FDLTGKTALVTGGSRGLGLQIAEALGEAGARVVLSARKAEELEEAAAHLEALGIDALWLAADVADEADIERLAEETLERF   87 (259)
T ss_pred             HCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             39999989994877689999999999869999999798899999999999549958999826899999999999999983


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-HHHCCCCEEEEECCHHHCCCCC----CCHHH
Q ss_conf             898799876875888888676599999999999989999999999999-9860898699978835647889----83688
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW-LKKSHCGRAIILSSGAAYKCRP----LWGAY  168 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~-m~~~~~G~IInisS~~g~~~~~----~~~~Y  168 (257)
                      |+||+||||||+. ...|++++++|+|++++++||+|+|+++|+++|+ |+++++|+||||+|.+|+.+.|    +..+|
T Consensus        88 G~iDiLVNNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~~m~~~~~G~IVnisS~ag~~g~~~~~~~~~aY  166 (259)
T PRK08213         88 GHIDILVNNAGAT-WGAPAEDHPVEAWDKVMNLNVRGTFLLSQAVAKRSMIPRGYGRIINVASIAGLGGNPPGSMDTIAY  166 (259)
T ss_pred             CCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCCCCHHHH
T ss_conf             9998999899778-898645699999999998844119999999999999857994599993521166788654134999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             98999999999999998544386997553288379779844--------14443245888899999999961975-6266
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      ++||+|+.+|||+||.||+++|||||+|+||+++|+|.+..        ....|.+|+++|||||++++||||++ +|+|
T Consensus       167 ~asKaav~~ltr~lA~e~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~Pl~R~g~peeia~~v~fLaSd~as~iT  246 (259)
T PRK08213        167 NTSKGAVINFTRALAAEWGPHGIRVNAIAPGFFPTKMTRGTLERLGEELLAHTPLGRLGDDEDLKGAALLLASDASKHIT  246 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999999610391999997798988552101499999998579999991999999999999682535854


Q ss_pred             CCEEEECCCCE
Q ss_conf             85798768763
Q gi|254780337|r  240 GKLFSVPQNRF  250 (257)
Q Consensus       240 G~~~~vdgG~~  250 (257)
                      ||+|.||||..
T Consensus       247 G~~i~VDGG~t  257 (259)
T PRK08213        247 GQILAVDGGVS  257 (259)
T ss_pred             CCEEEECCCHH
T ss_conf             87177583632


No 22 
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=100.00  E-value=0  Score=461.81  Aligned_cols=239  Identities=24%  Similarity=0.292  Sum_probs=222.6

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             65248899999389986889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .++|+||+||||||++|||+++|+.|+++|++|++++|++++++++.+++++.|.++.++++|++|+++++++++++.++
T Consensus         5 lf~L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~~~~~~~~   84 (278)
T PRK08277          5 LFSLKGKVAVITGGGGVLGGAMAKELARAGAKVAILDRNQEKAEAVVEEIKANGGEAIALKADVLDKESLEQARQQILKD   84 (278)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             63889998999586748999999999987998999979889999999999845990999982489999999999999998


Q ss_pred             HCCCCEEEECCCCCC--------------CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH
Q ss_conf             189879987687588--------------888867659999999999998999999999999998608986999788356
Q gi|254780337|r   93 WGKLDILIANAGILG--------------SISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA  158 (257)
Q Consensus        93 ~g~iDilVNNAGi~~--------------~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g  158 (257)
                      ||++|+||||||+..              ...+|+|++.|+|++++++|++|+|+++|++.|+|+++++|+||||+|.++
T Consensus        85 ~G~iDiLVNnAG~~~p~~~~~~~~~~~~~~~~~~~d~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IInisS~~~  164 (278)
T PRK08277         85 FGRCDILINGAGGNHPGATTDNEFHELPPETKTFFDLDEDGFEFVFDLNLLGTLLPTQVFAKDMIEQKGGNIINISSMNA  164 (278)
T ss_pred             HCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH
T ss_conf             49988899889876766632332122454557631199999999999975999999999999998769965999813664


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC---------------CCCCCCCCCCHHH
Q ss_conf             4788983688989999999999999985443869975532883797798441---------------4443245888899
Q gi|254780337|r  159 YKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM---------------PAEDPNTVPHPQK  223 (257)
Q Consensus       159 ~~~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~---------------~~~~~~~~~~ped  223 (257)
                      +.+.++.++|++||+||.+|||+||.||+++|||||+|+||+++|+|....+               ...|.+|+++|||
T Consensus       165 ~~~~~~~~~Y~asKaav~~lTk~lA~e~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~ped  244 (278)
T PRK08277        165 FTPLTKVPAYSAAKAAISNFTQWLAVEFAKVGIRVNAIAPGFFLTEQNRALLLNEDGSPTERANKILAHTPMGRFGKPEE  244 (278)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHCCCCCCHHHHHHHHHHCCCCCCCCCHHH
T ss_conf             77889865579999999999999999965359499998528887726677641866787999999984799889849999


Q ss_pred             HHHHHHHHHCH-H-HCCCCCEEEECCCCEE
Q ss_conf             99999996197-5-6266857987687631
Q gi|254780337|r  224 VAKIISFLCAT-Q-KIETGKLFSVPQNRFV  251 (257)
Q Consensus       224 iA~~v~fL~s~-~-~~~tG~~~~vdgG~~~  251 (257)
                      ||++++||||+ . +|+|||+|.||||...
T Consensus       245 ia~~v~fLaS~~as~yiTG~~i~VDGG~tA  274 (278)
T PRK08277        245 LLGTLLWLADEDASSFVTGVVLPVDGGFSA  274 (278)
T ss_pred             HHHHHHHHHCCCHHCCCCCCEEEECCCHHH
T ss_conf             999999990980527733872886925452


No 23 
>PRK07097 gluconate 5-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=461.41  Aligned_cols=237  Identities=23%  Similarity=0.356  Sum_probs=224.4

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ++|+||+||||||++|||+++|++|+++|++|++++|++++++++.+++++.+.+++++++|++|+++++++++++.++|
T Consensus         6 f~l~gK~alVTG~s~GIG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~   85 (265)
T PRK07097          6 FSLKGKIALITGASYGIGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELGIEAHGYVCDVTDEDGIQAMVAQIEKEV   85 (265)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             19899989995857689999999999869999999599899999999999549917999932899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |+||+||||||+. ...|++++++|+|++++++|++|+|+++|+++|+|+++++|+||||+|.+++.+.|+.++|++||+
T Consensus        86 g~iDiLVnNAG~~-~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKa  164 (265)
T PRK07097         86 GVIDILVNNAGII-RRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPSMIKKGHGKIINICSMMSELGRETVSAYAAAKG  164 (265)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCCCCCCCHHHHHHHH
T ss_conf             9998999899899-998826599999999999860728999999999899808975999905211567888668999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------------CCCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             999999999998544386997553288379779844----------------14443245888899999999961975-6
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------------MPAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------------~~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      |+.+|||+||.||+++|||||+|+||+++|||....                ....|.+|+++|||||++++||||++ +
T Consensus       165 av~~ltr~lA~e~a~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~P~~R~g~p~dia~~v~FL~Sd~s~  244 (265)
T PRK07097        165 GLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAKTPAARWGTPEDLAGPAVFLASDASN  244 (265)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999999970249599999658898863045665310111215999998479988978899999999999484424


Q ss_pred             CCCCCEEEECCCCEE
Q ss_conf             266857987687631
Q gi|254780337|r  237 IETGKLFSVPQNRFV  251 (257)
Q Consensus       237 ~~tG~~~~vdgG~~~  251 (257)
                      |+|||+|.||||...
T Consensus       245 ~iTGq~i~VDGG~~A  259 (265)
T PRK07097        245 FVNGHILYVDGGILA  259 (265)
T ss_pred             CCCCCEEEECCCCCC
T ss_conf             835875997908232


No 24 
>PRK08589 short chain dehydrogenase; Validated
Probab=100.00  E-value=0  Score=461.23  Aligned_cols=235  Identities=23%  Similarity=0.387  Sum_probs=219.1

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      .+|+||+||||||++|||+++|+.|+++|++|++++++ ++++++.+++.+.|.++.++++|++|+++++++++++.++|
T Consensus         2 ~rL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~d~~-~~~~~~~~~i~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~   80 (272)
T PRK08589          2 KRLENKVAVITGASTGIGQASAIALAQEGAYVLAVDIA-EAVSETVDKIKSNGGKAKAYHVDISDEQQVKDFASDIKEQF   80 (272)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             99997989997825699999999999869999998382-78999999999559948999960799999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+....+++++++.|+|++++++||+|+|+++|+++|+|++++ |+||||+|.+|+.+.|+.++|++||+
T Consensus        81 G~iDiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m~~~g-G~IVnisS~~g~~~~~~~~~Y~asKa  159 (272)
T PRK08589         81 GHIDVLFNNAGVDNAAGRIHEYPVDVFDKIMAVDMRGTFLMTKMLLPLMMEQG-GSIINTSSFSGQAADLYRSGYNAAKG  159 (272)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEECHHHCCCCCCCHHHHHHHH
T ss_conf             99878998986678888710099999999999982999999999999999759-90799912343677898668999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC----------------CCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             99999999999854438699755328837977984414----------------443245888899999999961975-6
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP----------------AEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~----------------~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      ||.+|||+||.||+++|||||+|+||+|+|||..+...                ..|.+|+++|||||++++||||++ +
T Consensus       160 al~~lTr~lA~E~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~FLaSd~as  239 (272)
T PRK08589        160 AVINFTKSIAIEYGRDGIRANAIAPGTIETPLVDKLTGTSEDEAGKTFRENQKWMTPLGRLGKPEEVAKLVVFLASDDSS  239 (272)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999999972259399999648898645766534774788999998754478978977899999999998185217


Q ss_pred             CCCCCEEEECCCCE
Q ss_conf             26685798768763
Q gi|254780337|r  237 IETGKLFSVPQNRF  250 (257)
Q Consensus       237 ~~tG~~~~vdgG~~  250 (257)
                      |+|||+|.||||..
T Consensus       240 yiTG~~i~VDGG~~  253 (272)
T PRK08589        240 FITGETIRIDGGVM  253 (272)
T ss_pred             CCCCCEEEECCCHH
T ss_conf             83685489890854


No 25 
>PRK07062 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=459.90  Aligned_cols=239  Identities=23%  Similarity=0.318  Sum_probs=224.3

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             3265248899999389986889999999988998999978989999999999864--99289998789999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTY   88 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~   88 (257)
                      +|+|+|+||+||||||++|||+++|++|+++|++|++++|++++++++.+++.+.  +.++.+++||++|++++++++++
T Consensus         1 mm~~~L~gK~alITG~s~GIG~a~a~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~~~~~~~~~Dvt~~~~v~~~v~~   80 (265)
T PRK07062          1 MMQIQLEGRVAVVTGGSSGIGLATVELLLEAGASVAICGRDEERLASAEARLREKFPGARLLAARCDVLDEADVAAFAAA   80 (265)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             99778899989995757799999999999879999999798899999999998736996599997579999999999999


Q ss_pred             HHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             99981898799876875888888676599999999999989999999999999986089869997883564788983688
Q gi|254780337|r   89 IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        89 ~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      +.++||++|+||||||.. ..++|+++++|+|++++++|++|+|+++|+++|+|+++++|+||||+|.+++.|.|+.++|
T Consensus        81 ~~~~~G~iDiLVnNAg~~-~~~~~~~~~~e~w~~~~~~nl~~~~~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y  159 (265)
T PRK07062         81 VEARFGGVDMLVNNAGQG-RVSTFADTTDDAWRDELELKYFSVIRPTRAFLPLLRASAAPSITCVNSLLALQPEPHMVAT  159 (265)
T ss_pred             HHHHHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHH
T ss_conf             999839988899778888-9888487999999999987214589999999999996299629999344235789996899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC--------------------CCCCCCCCCHHHHHHHH
Q ss_conf             9899999999999999854438699755328837977984414--------------------44324588889999999
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP--------------------AEDPNTVPHPQKVAKII  228 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~--------------------~~~~~~~~~pediA~~v  228 (257)
                      ++||+|+.+|||++|.||+++|||||+|+||+|+|+++.+.++                    ..|.+|+++|||||+++
T Consensus       160 ~asKaal~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iPl~R~g~peevA~~v  239 (265)
T PRK07062        160 SAARAGLLNLVKSLATELAPEGVRVNSILLGLVESGQWRRRYEARADPGLSWEAWTAALARKKGIPLGRFGRPDEAARAL  239 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
T ss_conf             99999999999999999766493999896085877245433132025455789999998874699988976899999999


Q ss_pred             HHHHCHH-HCCCCCEEEECCCCE
Q ss_conf             9961975-626685798768763
Q gi|254780337|r  229 SFLCATQ-KIETGKLFSVPQNRF  250 (257)
Q Consensus       229 ~fL~s~~-~~~tG~~~~vdgG~~  250 (257)
                      +||||++ +|+|||+|.||||..
T Consensus       240 ~fLaS~~s~~iTG~~i~VDGG~s  262 (265)
T PRK07062        240 FFLASPLSSYTTGSHIDVSGGFA  262 (265)
T ss_pred             HHHHCCHHCCCCCCEEEECCCCC
T ss_conf             99968732573584279897803


No 26 
>PRK06114 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=458.79  Aligned_cols=239  Identities=21%  Similarity=0.275  Sum_probs=220.6

Q ss_pred             CCEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             732652488999993899868899999999889989999789-8999999999986499289998789999999999999
Q gi|254780337|r   10 SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTY   88 (257)
Q Consensus        10 ~~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~   88 (257)
                      .+| ++|+||++|||||++|||+++|+.|+++|++|++++|+ ++.++++.+++++.|.++.++++|++|++++++++++
T Consensus         9 ~~l-f~L~gKvalVTGa~~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~v~~   87 (262)
T PRK06114          9 PKL-FDLDGQVAFVTGAGSGIGQRIAIGLAQAGADVALFDLRTDDGLAETAEHIEAAGRRAIQIAADVTSKSDLAAAVAR   87 (262)
T ss_pred             CCC-CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             212-4989998999684789999999999987998999958974699999999996599589998168999999999999


Q ss_pred             HHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCC--CH
Q ss_conf             9998189879987687588888867659999999999998999999999999998608986999788356478898--36
Q gi|254780337|r   89 IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL--WG  166 (257)
Q Consensus        89 ~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~--~~  166 (257)
                      +.++||++|+||||||+.. ..|++++++|+|++++++|++|+|+++|++.|+|+++++|+||||+|.+|..+.++  .+
T Consensus        88 ~~~~~G~iDiLVNnAGi~~-~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~G~IVnisS~~g~~~~~g~~~~  166 (262)
T PRK06114         88 TEAELGALTLAVNAAGIAN-ANPAEEMEEEQWQTVMDINLTGVFLSCQAEARAMLENGGGSIVNIASMSGVIVNRGLLQA  166 (262)
T ss_pred             HHHHCCCCCEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHCCCCCCCCHH
T ss_conf             9998199989998998999-988155999999999999736699999999999997289789997862230478885318


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             8898999999999999998544386997553288379779844---------14443245888899999999961975-6
Q gi|254780337|r  167 AYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       167 ~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      +|++||+|+.+|||+||.||+++|||||+|+||+++|||..+.         ....|.+|+++|||||++++||+|++ +
T Consensus       167 ~Y~asKaav~~lTr~lA~e~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~FLaSd~as  246 (262)
T PRK06114        167 HYNASKAGVIHMSKSLAMEWVGRGIRVNTISPGYTATPMNTRPEMVHQTKLFEEQTPMQRMADVDEMVGPAVFLLSDAAS  246 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             89999999999999999996705939999975889887666746489999998579989986899999999999576324


Q ss_pred             CCCCCEEEECCCCE
Q ss_conf             26685798768763
Q gi|254780337|r  237 IETGKLFSVPQNRF  250 (257)
Q Consensus       237 ~~tG~~~~vdgG~~  250 (257)
                      |+|||+|.||||..
T Consensus       247 ~iTG~~i~VDGG~t  260 (262)
T PRK06114        247 FVTGVDLLVDGGFC  260 (262)
T ss_pred             CCCCCEEEECCCHH
T ss_conf             75586289795321


No 27 
>PRK06057 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=460.89  Aligned_cols=240  Identities=23%  Similarity=0.295  Sum_probs=222.1

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+.+|+||++|||||++|||+++|++|+++|++|++++|+++.++++.++++     ..++++|++|+++++++++++.+
T Consensus         1 M~~rL~gKvalVTGas~GIG~aia~~la~~Ga~Vvi~d~~~~~~~~~~~~~~-----~~~~~~Dv~~~~~v~~~v~~~~~   75 (255)
T PRK06057          1 LSQRLAGRVAVITGGASGIGLATARRMRAEGATVVVGDIDPEAGKAAADELG-----GLFVQVDVTDEDAVNALFDTAAE   75 (255)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC-----CEEEEEECCCHHHHHHHHHHHHH
T ss_conf             9988899989996848889999999999869989999698899999998649-----97999816999999999999999


Q ss_pred             HHCCCCEEEECCCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC-CCHHHH
Q ss_conf             81898799876875888-8886765999999999999899999999999999860898699978835647889-836889
Q gi|254780337|r   92 RWGKLDILIANAGILGS-ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRP-LWGAYS  169 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~-~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~-~~~~Y~  169 (257)
                      +||++|+||||||+..+ ..+++++++|+|++++++|++|+|+++|+++|+|+++++|+|||++|..+..+.+ ...+|+
T Consensus        76 ~~G~iDiLVNnAGi~~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~g~~~~~~~Y~  155 (255)
T PRK06057         76 TYGSVDIAFNNAGISPPEDDSILNTGLDAWQRVQDVNLKSVYLCCKAALPHMVEAGKGSIINTASFVAVMGSATSQISYT  155 (255)
T ss_pred             HHCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCHHHH
T ss_conf             81998789988855788998620099999999999982999999999999999839958999737656358886525599


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC-----------CCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             899999999999999854438699755328837977984414-----------443245888899999999961975-62
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP-----------AEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~-----------~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      +||+||.+|||+||.||+++|||||+|+||+|+|||..+.+.           ..|.+|+++|||||++++||+|++ +|
T Consensus       156 asKaav~~lTr~lA~e~a~~gIrVN~IaPG~i~T~~~~~~~~~~~e~~~~~~~~~PlgR~g~peeiA~~v~fLaSd~ss~  235 (255)
T PRK06057        156 ASKGGVLAMSRELGVQFARQGIRVNALCPGPVNTPLLQELFAKDPERAARRLVHVPLGRFAEPEEIAAAVAFLASDDASF  235 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             99999999999999986031939999973879965777663059999999983699889788999999999996764248


Q ss_pred             CCCCEEEECCCCEECCCCC
Q ss_conf             6685798768763154379
Q gi|254780337|r  238 ETGKLFSVPQNRFVNYLTP  256 (257)
Q Consensus       238 ~tG~~~~vdgG~~~n~~~p  256 (257)
                      +|||+|.||||...-|.+|
T Consensus       236 iTG~~i~VDGG~taa~~~p  254 (255)
T PRK06057        236 ITASTFLVDGGISGAYVTP  254 (255)
T ss_pred             CCCCEEEECCCHHHCCCCC
T ss_conf             2687388693832165478


No 28 
>PRK05875 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=458.97  Aligned_cols=241  Identities=24%  Similarity=0.330  Sum_probs=226.3

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC---CCEEEEECCCCCHHHHHHHHHH
Q ss_conf             2652488999993899868899999999889989999789899999999998649---9289998789999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN---KKIDIFAFDLRDSNALELTKTY   88 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g---~~~~~~~~Dv~d~~~v~~~~~~   88 (257)
                      |+|+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++.+.+   .++.++++|+++++++++++++
T Consensus         1 M~l~L~gK~alVTGas~GIG~aiA~~la~~Ga~Vii~~r~~~~l~~~~~~l~~~~~~~~~v~~~~~Dvs~~~~v~~~v~~   80 (277)
T PRK05875          1 MQLSLQDRTYLVTGGGSGIGKGVAAALVAAGAAVMIVGRNPDKLAAAAEEIEALAGGAGAVRYEPADVTNEDEVARAVDA   80 (277)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             90468999899948874999999999998799899997988999999999996127886289995789999999999999


Q ss_pred             HHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             99981898799876875888888676599999999999989999999999999986089869997883564788983688
Q gi|254780337|r   89 IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        89 ~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      +.++||++|+||||||.....+|+.+++.|+|++++++|++|+|+++|++.|.|+++++|+|||++|.++..+.+++++|
T Consensus        81 ~~~~~g~iD~LVnnAg~~~~~~~~~~~~~e~w~~~~~iNl~g~~~~~~~~~~~m~~~~~GsIVnisS~~~~~~~~~~~~Y  160 (277)
T PRK05875         81 ATAWHGRLHGVVHCAGGSETIGPITQIDSEAWRRTVDLNVNGTMYVLKHAARELVRGGGGSFVGISSIASSNTHRWFGAY  160 (277)
T ss_pred             HHHHHCCCEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHH
T ss_conf             99984995399987813678797255999999999999738899999999999987489724147530433678751667


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC----------CCCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             989999999999999985443869975532883797798441----------4443245888899999999961975-62
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM----------PAEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~----------~~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      ++||+|+.+|||+||.||+++|||||+|+||+++|+|.....          ...|.+|+++|||||++++||||++ +|
T Consensus       161 ~asKaal~~ltk~lA~Ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~FL~Sd~s~~  240 (277)
T PRK05875        161 GVSKAAVDHLMKLAADELGPSWVRVNSIRPGLIRTDLVAPITESPEVSADYAACTPLPRVGEVEDIANLAMFLLSDAASW  240 (277)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             99999999999999999710696999986388986535421479999999995799999868999999999995883168


Q ss_pred             CCCCEEEECCCCEEC
Q ss_conf             668579876876315
Q gi|254780337|r  238 ETGKLFSVPQNRFVN  252 (257)
Q Consensus       238 ~tG~~~~vdgG~~~n  252 (257)
                      +|||+|.||||.++.
T Consensus       241 iTGq~i~VDGG~~l~  255 (277)
T PRK05875        241 ITGQVINVDGGHMLR  255 (277)
T ss_pred             CCCCEEEECCCHHHC
T ss_conf             658817998056643


No 29 
>PRK07890 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=457.49  Aligned_cols=236  Identities=24%  Similarity=0.395  Sum_probs=223.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |.|+||+||||||++|||+++|++|+++|++|++++|++++++++.+++++.|.++.++++|++|+++++++++++.++|
T Consensus         1 M~L~gK~alVTG~s~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~f   80 (258)
T PRK07890          1 MLLKDKVVVVSGVGPGLGTTLAVRAAREGADVVLAARTAERLDEVAKQIDDLGRRALAVVTDITDEAQVANLVDAALERF   80 (258)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             96899889996856589999999999879989999798999999999999649958999816999999999999999984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |+||+||||||......|++++++|+|++++++|++++|+++|+++|+|++++ |+||||+|.+++.+.|++++|++||+
T Consensus        81 G~iDiLVnnAg~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~k~~~p~m~~~~-G~IVnisS~~~~~~~~~~~~Y~~sKa  159 (258)
T PRK07890         81 GRVDVLVNNAFRVPSMKPLAGADFDHWRDVIETNVLGTLRLTQAFTPALAESG-GSVVMINSMVLRHSQPKYGAYKMAKG  159 (258)
T ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEECHHHCCCCCCCHHHHHHHH
T ss_conf             99989998686678999800299999999999875999999998899999769-85999825654888999778999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH-------------------CCCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999999998544386997553288379779844-------------------1444324588889999999996197
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA-------------------MPAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~-------------------~~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      |+.+|||+||.||+++|||||+|+||+|.|++.+..                   ....|.+|+++|||||+++.||||+
T Consensus       160 al~~ltk~lA~ela~~gIrVN~V~PG~i~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~R~g~p~diA~~v~fL~Sd  239 (258)
T PRK07890        160 ALLAASQSLATELGPQGIRVNSVAPGYIWGDPLQGYFDHQAGKYGTTVEEIYAATAANSDLKRLPTDDEVASAVLFLASD  239 (258)
T ss_pred             HHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             99999999999971409599999518788752566887666542999899999997079999997999999999999585


Q ss_pred             H-HCCCCCEEEECCCCE
Q ss_conf             5-626685798768763
Q gi|254780337|r  235 Q-KIETGKLFSVPQNRF  250 (257)
Q Consensus       235 ~-~~~tG~~~~vdgG~~  250 (257)
                      + +|+|||+|.||||+|
T Consensus       240 ~a~~iTG~~i~VDGG~~  256 (258)
T PRK07890        240 LASAITGQTLDVNCGEF  256 (258)
T ss_pred             HHCCCCCCEEEECCCCC
T ss_conf             32394387478668906


No 30 
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR011294   This entry represents a subfamily of the short chain dehydrogenases. Characterised members so far as 3-hydroxybutyrate dehydrogenases and are found in species that accumulate ester polymers called polyhydroxyalkanoic acids (PHAs) under certain conditions. Several members of the family are from species not known to accumulate PHAs, including Oceanobacillus iheyensis and Bacillus subtilis. However, polymer formation is not required for there be a role for 3-hydroxybutyrate dehydrogenase; it may be members of this family have the same function in those species.; GO: 0003858 3-hydroxybutyrate dehydrogenase activity.
Probab=100.00  E-value=0  Score=469.63  Aligned_cols=233  Identities=24%  Similarity=0.332  Sum_probs=222.0

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC--HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             8999993899868899999999889989999789--89999999999864992899987899999999999999998189
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRS--ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~--~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      +||||||||+||||++||++||+.|++|++.|++  .+.++++...++..|.++.++.+|+|++++|+.+++.+.++||.
T Consensus         1 ~ktalVTGaaSGIG~~iA~~LA~aGa~v~~~d~~~~~~~~~~~~~~~~~~G~~v~~~~~D~T~~~e~~~~~~~~~~~fG~   80 (258)
T TIGR01963         1 GKTALVTGAASGIGLAIAKALAAAGANVVVNDLGEADEGAEAAAKVATDAGGSVIYLVADVTKEEEIADMIQAVAAEFGG   80 (258)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             94899965871678999999987298899846788789999999999961883577514788889999999999998568


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-EEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             87998768758888886765999999999999899999999999999860898-69997883564788983688989999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG-RAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G-~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      +||||||||+. ...|+||++.|+|++++.|||.++|+++|+++|+|++++|| |||||+|..|++++|+=++|.++|||
T Consensus        81 ~DiLVNNAG~Q-hVaPiEeFP~~~w~~iiav~LtsaF~t~raAlP~Mk~~gwGGRIiNIAS~HGLvASp~KSAYVAAKHG  159 (258)
T TIGR01963        81 LDILVNNAGIQ-HVAPIEEFPPEKWDRIIAVMLTSAFHTIRAALPHMKKQGWGGRIINIASVHGLVASPFKSAYVAAKHG  159 (258)
T ss_pred             CCEEEECCCEE-ECCCCCCCCHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHH
T ss_conf             87488446401-41765477866787373021688899997506432137855379971010000035321345677430


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC--------------------CCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999999985443869975532883797798441--------------------444324588889999999996197
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM--------------------PAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~--------------------~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      |.||||++|.|.+++|||+|+||||+|+||+-++.+                    +..|.+++.+|||||+.++||+|+
T Consensus       160 ~~GLTKv~ALE~A~~giT~NaiCPGYV~TPLV~~Qi~DqAk~rGi~eE~V~~~VmL~~~P~k~F~~~~e~A~~a~fLaS~  239 (258)
T TIGR01963       160 LIGLTKVLALEVAAHGITANAICPGYVRTPLVEKQIADQAKTRGIPEEQVIREVMLKKQPTKRFVTVDEVAETALFLASD  239 (258)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCH
T ss_conf             21211555542047887586672875675546765899986518899888898607888984113799999999984173


Q ss_pred             H-HCCCCCEEEECCCCEE
Q ss_conf             5-6266857987687631
Q gi|254780337|r  235 Q-KIETGKLFSVPQNRFV  251 (257)
Q Consensus       235 ~-~~~tG~~~~vdgG~~~  251 (257)
                      . +.+|||.+.+|||-++
T Consensus       240 ~A~~~TG~~~~~DGGWtA  257 (258)
T TIGR01963       240 AAAGITGQAIVLDGGWTA  257 (258)
T ss_pred             HHHCCCCEEEEECCCEEC
T ss_conf             442366207886484332


No 31 
>PRK06949 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=457.50  Aligned_cols=238  Identities=22%  Similarity=0.344  Sum_probs=223.8

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      .+.|+|+||++|||||++|||+++|+.|+++|++|++++|+.++++++.+++++.+.++.++++|++|+++++++++++.
T Consensus         2 ~~~~~L~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~   81 (258)
T PRK06949          2 GRSINLEGKVALVTGASSGLGQRFAQVLSQAGAKVVLASRRVERLKELRAEIEAEGGAAHVVSLDVTDYQSIKAAVAHAE   81 (258)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             98887899989995857799999999999879999999698899999999999659928999826899999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--------CCEEEEECCHHHCCCC
Q ss_conf             98189879987687588888867659999999999998999999999999998608--------9869997883564788
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH--------CGRAIILSSGAAYKCR  162 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~--------~G~IInisS~~g~~~~  162 (257)
                      ++||+||+||||||+. ...+++++++++|++++++|++|+|+++|++.|+|+++.        .|+||||+|+++.++.
T Consensus        82 ~~~G~iDiLVnnAG~~-~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~~~mi~~~~~~~~~~~~G~IVni~S~~~~~~~  160 (258)
T PRK06949         82 TEAGTIDILVNNSGVS-TTQKLVDVTPADFEFVFDTNTRGAFFVAQEVAKRMIARAKGAGNAKPQCRIINIASVAGLRVL  160 (258)
T ss_pred             HHHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCHHHCCCC
T ss_conf             9849998999899889-998926599999999999870999999999999999845799888898399998355547689


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC---------CCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             983688989999999999999985443869975532883797798441---------44432458888999999999619
Q gi|254780337|r  163 PLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM---------PAEDPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       163 ~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~---------~~~~~~~~~~pediA~~v~fL~s  233 (257)
                      |+.++|++||+|+.+|||+||.||+++|||||+|+||+|+|+|....+         ...|.+|+++|||||.++.||||
T Consensus       161 ~~~~~Y~asKaav~~ltr~lA~ela~~gIrVN~IaPG~i~T~~~~~~~~~e~~~~~~~~~P~~R~g~pedia~~v~fL~S  240 (258)
T PRK06949        161 PQIGLYCMSKAAVVHMTRAMALEWGRHGINVNAICPGYIDTEINHHHWETEQGQKLVSMLPRKRVGKPEDLDGLLLLLAA  240 (258)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             98389999999999999999999622197999996578887000100575999999964999998299999999999838


Q ss_pred             HH-HCCCCCEEEECCCC
Q ss_conf             75-62668579876876
Q gi|254780337|r  234 TQ-KIETGKLFSVPQNR  249 (257)
Q Consensus       234 ~~-~~~tG~~~~vdgG~  249 (257)
                      ++ +|+|||+|.||||+
T Consensus       241 ~~s~~iTGq~i~VDGG~  257 (258)
T PRK06949        241 DESQFINGAIISADDGF  257 (258)
T ss_pred             CHHCCCCCCEEEECCCC
T ss_conf             73167368747847998


No 32 
>PRK12827 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=457.29  Aligned_cols=236  Identities=28%  Similarity=0.378  Sum_probs=219.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC----HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789----89999999999864992899987899999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS----ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~----~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      .+|+||++|||||++|||+++|+.|+++|++|++++|+    .+.++++.++++..|.++.++++|++|+++++++++++
T Consensus         2 ~~L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~   81 (251)
T PRK12827          2 ASLDSRRVLITGGSGGLGRAIAVRLAADGADVIVLDIHPMRGRAEAEAVAALIEAAGGKALGLAFDVRDFAATRAALDAG   81 (251)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHH
T ss_conf             89899889996825589999999999879989998488853289999999999964984999990389999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             9981898799876875888888676599999999999989999999999999986-089869997883564788983688
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKK-SHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~-~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      .++||+||+||||||+. ...|++++++|+|++++++||+|+|+++|+++|+|.+ +++|+||||+|.++..+.|+..+|
T Consensus        82 ~~~~G~iDiLVNnAG~~-~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~Y  160 (251)
T PRK12827         82 VEEFGRLDILVNNAGIA-TDAAFAELSIEEWDDVIDVNLDGFFNVTQAALPPMIRARRGGRIVNIASVAGVRGNRGQVNY  160 (251)
T ss_pred             HHHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHH
T ss_conf             99839997999899889-99990349999999999998599999999999999983899469998253335578986889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             98999999999999998544386997553288379779844--------14443245888899999999961975-6266
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      ++||+||.+|||+||.||+++|||||+|+||+|+|+|..+.        ....|.+|+++|||||++++||+|++ +|+|
T Consensus       161 ~asKaav~~lTr~lA~e~a~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fLaSd~s~~iT  240 (251)
T PRK12827        161 AASKAGLIGLTKTLANELAPRGITVNAVAPGAINTPMADNAAMTGGEHALNPVPVQRLGEPDEVAALVAFLVSDAASYVT  240 (251)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999999650496999996488987201103876999998479988977899999999999583324965


Q ss_pred             CCEEEECCCCE
Q ss_conf             85798768763
Q gi|254780337|r  240 GKLFSVPQNRF  250 (257)
Q Consensus       240 G~~~~vdgG~~  250 (257)
                      ||+|.||||.+
T Consensus       241 G~~i~VDGG~c  251 (251)
T PRK12827        241 GQVIPVDGGFC  251 (251)
T ss_pred             CCEEEECCCCC
T ss_conf             86487536849


No 33 
>PRK05867 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=458.63  Aligned_cols=240  Identities=23%  Similarity=0.316  Sum_probs=221.8

Q ss_pred             CEEE-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             3265-248899999389986889999999988998999978989999999999864992899987899999999999999
Q gi|254780337|r   11 EIHV-NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        11 ~m~~-~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      .|+| +|+||++|||||++|||+++|+.|+++|++|++++|+.++++++.+++++.+.++.++++|++|+++++++++++
T Consensus         1 ~~~~f~L~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~ei~~~g~~~~~~~~Dvt~~~~v~~~v~~~   80 (253)
T PRK05867          1 VLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSGGKVVPVCCDVSQHQQVTSMLDQV   80 (253)
T ss_pred             CCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             97563889998999795659999999999986999999979889999999999845991999983699999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCC--CCCH
Q ss_conf             998189879987687588888867659999999999998999999999999998608-9869997883564788--9836
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCR--PLWG  166 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~--~~~~  166 (257)
                      .++||++|+||||||+. ...|+.|+++|+|++++++|++|+|+++|++.|+|++++ +|+|||++|.+|+...  +..+
T Consensus        81 ~~~~G~iDiLVnNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~gg~IvnisS~~g~~~~~~~~~~  159 (253)
T PRK05867         81 TAELGGIDIAVCNAGII-TVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVS  159 (253)
T ss_pred             HHHHCCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCHH
T ss_conf             99959985999899778-88750109999999999997599999999999999981899803887551112657774027


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH-------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             8898999999999999998544386997553288379779844-------14443245888899999999961975-626
Q gi|254780337|r  167 AYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA-------MPAEDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       167 ~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~-------~~~~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
                      +|++||+|+.+|||+||.||+++|||||+|+||+|+|+|.+..       .+..|.+|+++|||||++++||||++ +|+
T Consensus       160 ~Y~asKaav~~ltr~lA~ela~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~iPlgR~g~pediA~~v~fLaSd~s~~i  239 (253)
T PRK05867        160 HYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYM  239 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             78999999999999999997000929999965889987642117899999847998898299999999999938721485


Q ss_pred             CCCEEEECCCCEE
Q ss_conf             6857987687631
Q gi|254780337|r  239 TGKLFSVPQNRFV  251 (257)
Q Consensus       239 tG~~~~vdgG~~~  251 (257)
                      |||+|.||||...
T Consensus       240 TG~~i~VDGG~T~  252 (253)
T PRK05867        240 TGSDIVIDGGYTC  252 (253)
T ss_pred             CCCEEEECCCCCC
T ss_conf             4871885889439


No 34 
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated
Probab=100.00  E-value=0  Score=457.81  Aligned_cols=239  Identities=23%  Similarity=0.354  Sum_probs=225.5

Q ss_pred             CCEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             73265248899999389986889999999988998999978989999999999864992899987899999999999999
Q gi|254780337|r   10 SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        10 ~~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      +.++|+|+||+||||||++|||+++|+.|+++|++|++++|++++++++.+++++.++++..++||++|+++++++++++
T Consensus         3 ~~~~~~L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~v~~~   82 (255)
T PRK06113          3 NSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFA   82 (255)
T ss_pred             CCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             88876799998999588778999999999987999999969889999999999965990899983689999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             99818987998768758888886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      .++||++|+||||||.. ...|+ |++.|+|+++|++|++++|+++|++.|+|+++++|+|||++|.++..+.+..++|+
T Consensus        83 ~~~~G~iDilVnNAG~~-~~~~~-d~~~~~~~~~~~~Nl~~~~~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~  160 (255)
T PRK06113         83 VSKLGKVDILVNNAGGG-GPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYA  160 (255)
T ss_pred             HHHHCCCCEEEECCCCC-CCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHH
T ss_conf             99819988999878878-99877-59999999999996499999999999988871896799984465468899852089


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             8999999999999998544386997553288379779844---------14443245888899999999961975-6266
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      +||+|+.+|||+||.||+++|||||+|+||+++|++....         ....|.+|+++|||||+++.||||++ +|+|
T Consensus       161 asKaav~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fL~S~~a~~it  240 (255)
T PRK06113        161 SSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVS  240 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999998264949999864889870222017999999998579988982999999999999481427966


Q ss_pred             CCEEEECCCCE
Q ss_conf             85798768763
Q gi|254780337|r  240 GKLFSVPQNRF  250 (257)
Q Consensus       240 G~~~~vdgG~~  250 (257)
                      ||+|.||||+.
T Consensus       241 G~~i~VDGG~v  251 (255)
T PRK06113        241 GQILTVSGGGV  251 (255)
T ss_pred             CCEEEECCCCC
T ss_conf             88699578964


No 35 
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=100.00  E-value=0  Score=456.05  Aligned_cols=237  Identities=28%  Similarity=0.423  Sum_probs=226.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||+||||||++|||+++|+.|+++|++|++++|++++++++.+++...+.++.++++|++++++++++++++.++|
T Consensus         1 m~L~~Kv~lITGgs~GIG~a~a~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~   80 (246)
T PRK05653          1 MSLQGKTALVTGASRGIGRAIALRLAADGARVVIYDSNEEAAEALAEELRAAGGEAALLVFDVTDEAAVRALIEAAVERF   80 (246)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHC
T ss_conf             99899889993897589999999999879999999799999999999999659948999972899999999999999974


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ..+++++++.++|++++++|++|+|+++|+++|+|++++.|+|||++|.+++.+.++.++|++||+
T Consensus        81 g~iDilvnnAg~~-~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~~~~~~~Y~asKa  159 (246)
T PRK05653         81 GGLDVLVNNAGIT-RDALLPRMSEEDWDRVIDTNLTGTFNVCRAALPPMRKARYGRIVNISSVSGVAGNPGQTNYAAAKA  159 (246)
T ss_pred             CCCCEEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHCCCCCCCHHHHHHHH
T ss_conf             9986999899999-998801399999999999860889999999999999846997899836554678999666899999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEE
Q ss_conf             999999999998544386997553288379779844--------14443245888899999999961975-626685798
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFS  244 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~  244 (257)
                      |+.+|||+||.|++++|||||+|+||+++|+|.+..        ....|.+|+++|+|||+++.||||++ +|+|||+|.
T Consensus       160 al~~lt~~la~e~~~~~IrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~Pl~R~~~p~dia~~v~fL~S~~s~~itG~~i~  239 (246)
T PRK05653        160 GVIGLTKALALELASRGITVNAVAPGFIDTDMTRALPEEVKEALLKQIPLGRLGTPEEVANAVAFLASDAASYITGQVIP  239 (246)
T ss_pred             HHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             99999999999950439399999638887723111689999999847998998399999999999968711283587488


Q ss_pred             ECCCCEE
Q ss_conf             7687631
Q gi|254780337|r  245 VPQNRFV  251 (257)
Q Consensus       245 vdgG~~~  251 (257)
                      ||||.||
T Consensus       240 vDGG~~~  246 (246)
T PRK05653        240 VNGGMYM  246 (246)
T ss_pred             ECCCCCC
T ss_conf             7989789


No 36 
>PRK06198 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=454.65  Aligned_cols=235  Identities=25%  Similarity=0.383  Sum_probs=221.3

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             248899999389986889999999988998-9999789899999999998649928999878999999999999999981
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAY-VIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      +|+||+||||||++|||+++|+.|+++|++ |++++|++++++++.+++++.|.++.++++|++++++++++++++.++|
T Consensus         3 ~L~gK~alVTGas~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~f   82 (268)
T PRK06198          3 RLDGKIALVTGGTQGLGAAIARLFAERGAAGLVICGRSAEKGEAKAAELEALGAKAVFVQADLAKVEDCRAVVAAADEAF   82 (268)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             88998899958577899999999998799389996298889999999999549967999826899999999999999983


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             898799876875888888676599999999999989999999999999986089-8699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHC-GRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~-G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |++|+||||||+. ...+++|+++|+|++++++||+++|+++|+++|+|++++. |+||||+|.+++.+.|+.++|++||
T Consensus        83 G~iDiLVNnAG~~-~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IVnisS~~~~~~~~~~~~Y~asK  161 (268)
T PRK06198         83 GRLDALVNAAGLT-DRGTILDTSPELFDRMFAVNVRAPFFLMQEAIKLMRRRRAEGTIVNIGSMSAHGGQPFIAAYCASK  161 (268)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCCCHHHHHHH
T ss_conf             9998999899789-999826599999999999872699999999999999759992799991545456899856899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------------CCCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             9999999999998544386997553288379779844---------------14443245888899999999961975-6
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------------MPAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------------~~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      +||.+|||+||.||+++|||||+|+||+|+|+|....               ....|.+|+++|||||+++.||||++ +
T Consensus       162 aal~~ltkslA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~FL~S~~s~  241 (268)
T PRK06198        162 GALATLTRNVAYALLRNRIRVNGLNIGWMASEGEDRIQREFHGAPDDWLEKAAATQPFGRLVDPDEVARAVAFLLSDESG  241 (268)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999999997056949998875778884267898873248799999998369988976999999999999674322


Q ss_pred             CCCCCEEEECCCCE
Q ss_conf             26685798768763
Q gi|254780337|r  237 IETGKLFSVPQNRF  250 (257)
Q Consensus       237 ~~tG~~~~vdgG~~  250 (257)
                      |+|||+|.||||-+
T Consensus       242 ~iTG~~i~VDGGi~  255 (268)
T PRK06198        242 LMTGSVIDFDQSVW  255 (268)
T ss_pred             CCCCCEEEECCCCC
T ss_conf             86583789487700


No 37 
>PRK07479 consensus
Probab=100.00  E-value=0  Score=453.89  Aligned_cols=238  Identities=25%  Similarity=0.352  Sum_probs=226.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++++.++++.++++|++|+++++++++++.++|
T Consensus         1 m~L~gK~alITGgs~GIG~a~a~~la~~G~~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~   80 (252)
T PRK07479          1 MRLSGKVAIVTGAGSGFGEGIAKRFAREGAKVVVADLNAAAAERVASEIADAGGNAIAVAADVSRGADVEALVEAALEAF   80 (252)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             98799889993887689999999999879999999798999999999998539978999925899999999999999981


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+.....|+++++.++|++++++|++++|+++|+++|+|+++++|+|||++|.++..+.|+.++|++||+
T Consensus        81 G~iD~lVnnAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~Iv~isS~~~~~~~~~~~~Y~asKa  160 (252)
T PRK07479         81 GRVDIVVNNAGTTHRNKPMLDVTEAEFDRVYAVNVKSIYLSTRHFVPHFRAQGGGVIINIASTAGVRPRPGLTWYNASKG  160 (252)
T ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCCHHHHHHH
T ss_conf             99859998997668998827699999999999986310565444049898679972999804876689999717999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-------------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             9999999999985443869975532883797798441-------------4443245888899999999961975-6266
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-------------PAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-------------~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      |+.+|||+||.|++++|||||+|+||+++|+|..+..             ...|.+|+++|||||+++.||||++ +|+|
T Consensus       161 al~~ltr~lA~el~~~gIrVN~I~Pg~~~T~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~S~~s~~iT  240 (252)
T PRK07479        161 AVITATKAMAAELAPDNIRVNCLNPVAGETGLLTEFMGVEDTPENRAKFLATIPLGRFSTPQDVANAALYLASDEASFIT  240 (252)
T ss_pred             HHHHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999951409699999669787657887613799899999997079989980999999999999684432946


Q ss_pred             CCEEEECCCCEE
Q ss_conf             857987687631
Q gi|254780337|r  240 GKLFSVPQNRFV  251 (257)
Q Consensus       240 G~~~~vdgG~~~  251 (257)
                      ||+|.||||+.+
T Consensus       241 Gq~i~VDGG~si  252 (252)
T PRK07479        241 GVCLEVDGGRCI  252 (252)
T ss_pred             CCEEEECCCCCC
T ss_conf             881885989609


No 38 
>PRK06484 short chain dehydrogenase; Validated
Probab=100.00  E-value=0  Score=455.19  Aligned_cols=237  Identities=25%  Similarity=0.279  Sum_probs=213.2

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             65248899999389986889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .+.++|||||||||++|||+++|++|+++|++|++++|+.+.++++.+++   +.++..+++|++|+++++++++++.++
T Consensus       269 ~~~~kGKvalVTGaa~GIG~aiA~~la~~GA~Vvi~d~~~~~~~~~~~~~---g~~~~~~~~Dv~~~~~v~~~v~~~~~~  345 (530)
T PRK06484        269 VPVRAGRVVCVTGGASGIGAAIADRFAALGDRVAIIDSDGEEAVKLREIL---GGEHLSWQVDITDEASVESAFAGIQGR  345 (530)
T ss_pred             CCCCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC---CCCCEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             76778989999287678999999999988798999958889999999973---997369995389999999999999998


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      ||+||+||||||+.....|++|+++|+|++++++|++|+|+++|+++|+|+++ +|+||||+|.+++.+.++..+|++||
T Consensus       346 fG~iDiLVNNAGi~~~~~~~~e~t~e~w~~v~~vNl~g~f~~~~~~~~~m~~~-gG~IVnisS~~~~~~~~~~~~Y~asK  424 (530)
T PRK06484        346 LGPLDVLVNNAGIAEPFAPSAEQSLEDFRRTIDVNLKGAFHCSREAARQMGAG-GGVIVNLGSITSLLALPPRHAYGASK  424 (530)
T ss_pred             CCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHH
T ss_conf             29988999897789899980009999999999997199999999999973148-97699971644365889957999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-----------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             99999999999985443869975532883797798441-----------4443245888899999999961975-62668
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-----------PAEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-----------~~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
                      +|+.+|||+||.||+++|||||+|+||+|+|||.....           ...|.+|+++|||||++++||+|++ +|+||
T Consensus       425 aav~~lTr~lA~E~a~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fLaSd~a~~iTG  504 (530)
T PRK06484        425 AAITMLTRCLAAELAPHGIRVNTVAPGYILTPAVQALLASGRRDMNSIRRRIPLGRLGQPEEVAEAAYFLASPAASYING  504 (530)
T ss_pred             HHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHHHCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             99999999999996043919998987778870454433135788999985599899778999999999982850068668


Q ss_pred             CEEEECCCCEECC
Q ss_conf             5798768763154
Q gi|254780337|r  241 KLFSVPQNRFVNY  253 (257)
Q Consensus       241 ~~~~vdgG~~~n~  253 (257)
                      |+|.||||.....
T Consensus       505 ~~i~VDGG~tA~g  517 (530)
T PRK06484        505 ATLQVDGGWTASG  517 (530)
T ss_pred             CEEEECCCCCCCC
T ss_conf             8798596898899


No 39 
>PRK08936 glucose-1-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=454.42  Aligned_cols=239  Identities=22%  Similarity=0.313  Sum_probs=223.7

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             2652488999993899868899999999889989999789-899999999998649928999878999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      |..+|+||++|||||++|||+++|+.|+++|++|++++|+ ++.++++.+++++.|.++.++++|++|+++++++++++.
T Consensus         1 M~~~L~gKvalVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~   80 (261)
T PRK08936          1 MYSDLEGKVVVITGGSTGLGRAMAVRFGKEKAKVVINYRSDESEANDVAEEIKKVGGEAIAVKGDVTVESDVVNLIQSAV   80 (261)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99889999899968477899999999998799999972898789999999999659938999827999999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608-98699978835647889836889
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      ++||++|+||||||+.. ..++.+++.|+|++++++||+|+|+++|+++|+|++++ .|+|||++|.++..+.|..++|+
T Consensus        81 ~~~G~iDiLVNNAg~~~-~~~~~~~~~e~w~~~~~iNl~~~f~~~k~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~Y~  159 (261)
T PRK08936         81 KEFGTLDVMINNAGIEN-AVPSHEMPLEDWNKVINTNLTGAFLGSREAIKYFVEHDIKGSIINMSSVHEQIPWPLFVHYA  159 (261)
T ss_pred             HHHCCCCEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEHHCCCCCCCCCHHH
T ss_conf             98299889998997899-98813399999999999971649999999999999818861478873310057899860079


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             8999999999999998544386997553288379779844----------14443245888899999999961975-626
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
                      +||+|+.+|||+||.||+++|||||+|+||+++|||..+.          ....|.+|+++|+|||+++.||||++ +|+
T Consensus       160 asKaav~~ltk~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~p~dIa~~v~FL~S~~asyi  239 (261)
T PRK08936        160 ASKGGVKLMTETLAMEYAPKGIRVNNIGPGAINTPINAEKFADPKQRADVESMIPMGYIGKPEEIAAVAAWLASSEASYV  239 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999999999997353959999978989870121114899999999857998998399999999999827432683


Q ss_pred             CCCEEEECCCCEE
Q ss_conf             6857987687631
Q gi|254780337|r  239 TGKLFSVPQNRFV  251 (257)
Q Consensus       239 tG~~~~vdgG~~~  251 (257)
                      |||+|.||||..+
T Consensus       240 TG~~i~VDGG~t~  252 (261)
T PRK08936        240 TGITLFADGGMTL  252 (261)
T ss_pred             CCCEEEECCCCCC
T ss_conf             3873887958107


No 40 
>PRK09242 tropinone reductase; Provisional
Probab=100.00  E-value=0  Score=453.88  Aligned_cols=241  Identities=23%  Similarity=0.350  Sum_probs=225.4

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             65248899999389986889999999988998999978989999999999864--9928999878999999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      .++|+||++|||||++|||+++|++|+++|++|++++|+.++++++..++.+.  +.+++++++|++|+++++++++++.
T Consensus         5 ~f~L~gK~alITGgs~GIG~a~a~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~   84 (258)
T PRK09242          5 RWRLDGQTALITGASKGIGLAIARELLGLGADVLIVARDADALAQARDELAEEFPERELHGLAADVSDDEDRRAILDWVE   84 (258)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHH
T ss_conf             76379999999484868999999999987998999969889999999999864479729999930799999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||++|+||||||+. ...++.++++|+|++++++|++|+|+++|++.|.|+++++|+|||++|.++..+.++.++|++
T Consensus        85 ~~~g~iDiLVnnAG~~-~~~~~~~~s~~~w~~~~~vNl~~~~~l~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~a  163 (258)
T PRK09242         85 DHWDGLHILVNNAGGN-ITKAAIDYTEDEWRGIFETNLFSAFELSRYAYPLLKRHAASSIVNIGSVSGLTHVRSGAPYGM  163 (258)
T ss_pred             HHCCCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHH
T ss_conf             9749997999899889-999800199999999999981999999999999999759927999930421168987556799


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC----------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             9999999999999985443869975532883797798441----------4443245888899999999961975-6266
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM----------PAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~----------~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      ||+||.+|||++|.||+++|||||+|+||+++|+|.+..+          ...|.+|+++|||||+++.||||++ +|+|
T Consensus       164 sKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fLaSd~s~~iT  243 (258)
T PRK09242        164 TKAALQQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLSDPDYYEQVIERTPMRRIGEPEEVAAAVAFLCLPAASYIT  243 (258)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999980279899998358898721202237999999998579989987999999999999585324754


Q ss_pred             CCEEEECCCCEECCC
Q ss_conf             857987687631543
Q gi|254780337|r  240 GKLFSVPQNRFVNYL  254 (257)
Q Consensus       240 G~~~~vdgG~~~n~~  254 (257)
                      ||+|.||||.....|
T Consensus       244 Gq~i~VDGG~~~~g~  258 (258)
T PRK09242        244 GECIAVDGGFLRYGF  258 (258)
T ss_pred             CCEEEECCCHHCCCC
T ss_conf             853898907322469


No 41 
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=452.37  Aligned_cols=237  Identities=25%  Similarity=0.359  Sum_probs=222.7

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             65248899999389986889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .|+|+||+||||||++|||+++|++|+++|++|++++|++++++++.++++  +.++.++++|++|+++++++++++.++
T Consensus         1 ~m~l~gK~alITGgs~GIG~aia~~la~~G~~V~i~~r~~~~~~~~~~~~~--~~~~~~~~~Dv~~~~~~~~~~~~~~~~   78 (250)
T PRK07231          1 SMRLEGKVAIVTGAGSGFGEGIARRFAAEGARVVVTDRNQEAAERVAAEIR--GGRAIAVAADVSDEADVRAAVEAALER   78 (250)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC--CCCEEEEEEECCCHHHHHHHHHHHHHH
T ss_conf             907699889993888689999999999879999999798899999999844--996799993079999999999999998


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      ||++|+||||||+....+|+++++.++|++++++|++|+|+++|+++|+|+++++|+|||++|.+++.+.|++++|++||
T Consensus        79 ~g~iD~lInnAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IinisS~~~~~~~~~~~~Y~asK  158 (250)
T PRK07231         79 FGSVDILVNNAGTTHRNGPLLDVDEAEFDRVYAVNVKSIYLWAQAAVPAWRGEGGGAIVNVASTAGIRPRPGLGWYNASK  158 (250)
T ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHH
T ss_conf             19971999888337899892769999999999999899999999999999983996499994477658899962799999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC------------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             99999999999985443869975532883797798441------------4443245888899999999961975-6266
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM------------PAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~------------~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      +|+.+|||++|.|++++|||||+|+||+++|+|.....            ...|.+|+++|||||+++.||||++ +|+|
T Consensus       159 aal~~lt~~lA~el~~~gIrVN~I~PG~v~T~~~~~~~~~~~~~~~~~~~~~~Pl~R~~~p~dia~~v~fL~S~~s~~it  238 (250)
T PRK07231        159 GAVITATKSLAVELAPDNIRVNAVNPVVGETGLLEAFMGEPTPENRAKFLATIPLGRLGTPEDIANAAAFLASDEASFIT  238 (250)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999995340959999963879863777752389899999998379999981999999999999685332946


Q ss_pred             CCEEEECCCCEE
Q ss_conf             857987687631
Q gi|254780337|r  240 GKLFSVPQNRFV  251 (257)
Q Consensus       240 G~~~~vdgG~~~  251 (257)
                      ||+|.||||+.+
T Consensus       239 G~~i~VDGG~sv  250 (250)
T PRK07231        239 GVALEVDGGRCV  250 (250)
T ss_pred             CCEEEECCCCCC
T ss_conf             871884888779


No 42 
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed
Probab=100.00  E-value=0  Score=451.67  Aligned_cols=234  Identities=26%  Similarity=0.361  Sum_probs=220.4

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||+||||||++|||+++|++|+++|++|.+++|+.++++++.+++   +.++.++++|++|+++++.+++++.++|
T Consensus         2 ~~l~gK~alITG~s~GIG~aia~~~a~~Ga~V~i~~~~~~~~~~~~~~~---~~~~~~~~~Dv~~~~~v~~~~~~~~~~~   78 (245)
T PRK12936          2 FDLTGRKALVTGASGGIGEEIARLLHAQGAIVGLHGTRVEKLEALAAEL---GERVKIFPANLSDRDEVKALGQKAEADL   78 (245)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH---CCCEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             3889998999274768999999999986999999829999999999983---8966999913799999999999999975


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+.. ..+++++++|+|++++++||+|+|+++|+++|.|+++++|+|||++|.+|..+.|+.++|++||+
T Consensus        79 g~iDiLINnAG~~~-~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~m~k~~~G~IInisS~a~~~~~~~~~~Y~asKa  157 (245)
T PRK12936         79 EGVDILVNNAGITK-DGLFVRMSDEDWDAVLEVNLTAVFRLTRELTHPMMRRRYGRIINITSVVGVTGNPGQANYCASKA  157 (245)
T ss_pred             CCCCEEEECCCCCC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
T ss_conf             99969998998899-99812099999999999981999999999999998748855999734553568998589999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEE
Q ss_conf             999999999998544386997553288379779844--------14443245888899999999961975-626685798
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFS  244 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~  244 (257)
                      |+.+|||+||.||+++|||||+|+||+++|+|..+.        ....|.+|+++|||||+++.||||++ +|+|||+|.
T Consensus       158 ai~~ltrslA~ela~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~Pl~R~g~p~dia~~v~fL~S~~a~~iTGq~i~  237 (245)
T PRK12936        158 GMIGFSKSLAQEIATRNVTVNCVAPGFIESAMTGKLNDKQKEAIMGAIPMKRMGTGAEVASAVAYLASDEAAYVTGQTLH  237 (245)
T ss_pred             HHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             99999999999970529299999757688631000399999999856998898299999999999968343484687179


Q ss_pred             ECCCCEE
Q ss_conf             7687631
Q gi|254780337|r  245 VPQNRFV  251 (257)
Q Consensus       245 vdgG~~~  251 (257)
                      ||||..+
T Consensus       238 VdGG~s~  244 (245)
T PRK12936        238 VNGGMAM  244 (245)
T ss_pred             ECCCHHH
T ss_conf             7878554


No 43 
>PRK08643 acetoin reductase; Validated
Probab=100.00  E-value=0  Score=450.42  Aligned_cols=234  Identities=23%  Similarity=0.320  Sum_probs=220.9

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             89999938998688999999998899899997898999999999986499289998789999999999999999818987
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      +||||||||++|||+++|++|+++|++|++++|+.++++++.+++++.+.++..+++|++|+++++++++++.++||++|
T Consensus         2 nKvalVTGg~~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iD   81 (256)
T PRK08643          2 SKVALVTGAGQGIGFAIAKRLVEDGFKVAIVDYNEETAKAAADKLSSDGGKAIAVKADVSNRDQVFDAVQQVVDTFGDLN   81 (256)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             84999957578899999999998799999996988999999999985399099998058999999999999999829987


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             9987687588888867659999999999998999999999999998608-986999788356478898368898999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      +||||||+. ...|++++++++|++++++|++|+|+++|+++|+|++++ +|+|||++|.+++.+.|+.++|++||+|+.
T Consensus        82 iLVNnAG~~-~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~~~m~~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaav~  160 (256)
T PRK08643         82 VVVNNAGLA-PTTPIDTITEEQFKKVYGINVGGVIWGIQAAQEQFKKLGHGGKIINATSQAGVEGNPGLSVYGSTKFAVR  160 (256)
T ss_pred             EEEECCCCC-CCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHCCCCCCCHHHHHHHHHHH
T ss_conf             999899889-9988255999999999999763689999999999998289927999832101358998489999999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-------------------CCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             9999999985443869975532883797798441-------------------4443245888899999999961975-6
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-------------------PAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-------------------~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      +|||++|.||+++|||||+|+||+|+|||+.+..                   ...|.+|+++|||||+++.||||++ +
T Consensus       161 ~ltkslA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~ipl~R~g~pedia~~v~fL~S~~s~  240 (256)
T PRK08643        161 GLTQTAARDLASEGITVNAYAPGIVKTPMMFDIAHEVGENAGKPDEWGMEQFAKDITLKRLSEPEDVANVVSFLAGPDSD  240 (256)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999987759189999606688704566778878762897589999998359999986899999999999593536


Q ss_pred             CCCCCEEEECCCCEEC
Q ss_conf             2668579876876315
Q gi|254780337|r  237 IETGKLFSVPQNRFVN  252 (257)
Q Consensus       237 ~~tG~~~~vdgG~~~n  252 (257)
                      |+|||+|.||||..++
T Consensus       241 ~iTG~~i~VDGGl~~~  256 (256)
T PRK08643        241 YITGQTIIVDGGMVFH  256 (256)
T ss_pred             CCCCCEEEECCCEEEC
T ss_conf             9358759966388409


No 44 
>PRK07454 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=451.92  Aligned_cols=237  Identities=27%  Similarity=0.401  Sum_probs=221.4

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+|+ +.|||||||||+|||+++|++|+++|++|++++|++++++++.+++++.|.++.++++|++|+++++++++++.+
T Consensus         1 m~~~-~mKvalITGas~GIG~a~A~~la~~G~~V~l~~R~~~~l~~~~~e~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~   79 (241)
T PRK07454          1 MSLN-SMPTALITGASRGIGKATALAFAKAGWDLALVARSQDALEALAEELRSTGVKVAAYSIDLSNPEAIAPGIAELLE   79 (241)
T ss_pred             CCCC-CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             9989-998899917587899999999998799899998999999999999996599289999518999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +||++|+||||||+. ..+++++++.|+|++++++|++|+|+++|+++|+|+++++|+||||+|.+|+++.|++++|++|
T Consensus        80 ~~G~iDiLVnNAG~~-~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IinisS~ag~~~~~~~~~Y~aS  158 (241)
T PRK07454         80 QFGCPSVLINNAGAA-YTGPLLEMPLSDWQWVIQLNLTSVFQCCSAVLPGMRARGGGLIINVSSHAARNAFPQWGAYCVS  158 (241)
T ss_pred             HCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHH
T ss_conf             759988999889889-9999266999999999999869999999999999997399899998356544778997579999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC--CCCCCCCCCCHHHHHHHHHHHHCH-H-HCCCCCEEEECC
Q ss_conf             999999999999985443869975532883797798441--444324588889999999996197-5-626685798768
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM--PAEDPNTVPHPQKVAKIISFLCAT-Q-KIETGKLFSVPQ  247 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~--~~~~~~~~~~pediA~~v~fL~s~-~-~~~tG~~~~vdg  247 (257)
                      |+|+.+||++|+.|++++|||||+|+||+|+|||+....  +..+..++.+|||||++|+||+|. + .+++|++|.+||
T Consensus       159 K~al~~lt~~la~E~~~~gIrVn~V~PG~v~T~m~~~~~~~~~~~~~~~l~PedVA~~v~flas~p~~~~i~~~~i~p~g  238 (241)
T PRK07454        159 KAALAAFTKCLAEEERSHGIRVCTLTLGAVNTPLWDSETVQADFDRSAMLSPEQVAQTILYLAQLPPSAVIEDLTLMPSA  238 (241)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEEECC
T ss_conf             99999999999998384593899997388988988863333554556899999999999999769985628888999548


Q ss_pred             CCE
Q ss_conf             763
Q gi|254780337|r  248 NRF  250 (257)
Q Consensus       248 G~~  250 (257)
                      |.|
T Consensus       239 G~f  241 (241)
T PRK07454        239 GAF  241 (241)
T ss_pred             CCC
T ss_conf             879


No 45 
>PRK06128 oxidoreductase; Provisional
Probab=100.00  E-value=0  Score=453.09  Aligned_cols=238  Identities=24%  Similarity=0.319  Sum_probs=219.6

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC--HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             652488999993899868899999999889989999789--899999999998649928999878999999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS--ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~--~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      .-+|+||+||||||++|||+++|++||++|++|++++++  +..++++.++++..|.++..+++|++|+++++++++++.
T Consensus        50 ~grL~GKvAlVTGgssGIG~AiA~~lA~eGA~Vvi~~~~~~~~~a~~~~~~i~~~G~~a~~v~~Dvsd~~~~~~~v~~~~  129 (300)
T PRK06128         50 FGRLQGRKALITGADSGIGRATAIAFAREGADIVLNYLPEEEQDAAEVVQLIQAEGRKAVAVPGDLKDEAFCRQLVERAV  129 (300)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             88789995899173669999999999986999999429955678999999999659818999747899999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||+|||||||||+.....++++++.|+|+++|++||+|+|+++|+++|+|++  +|+|||++|.+++.+.++..+|++
T Consensus       130 ~~~G~iDiLVNNAG~~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~aa~p~m~~--gGsIInisSi~~~~~~~~~~~Y~a  207 (300)
T PRK06128        130 KELGGLDILVNIAGKQTARKDIADITTEQFDATFKTNVYAMFWLCKAAIPHLPP--GASIINTGSIQSYQPSPTLLDYAS  207 (300)
T ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHC--CCCEEEEEEEEEECCCCCCHHHHH
T ss_conf             980999989989999778999177999999999866115899999999998753--871478742124057886177899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             999999999999998544386997553288379779844----------14443245888899999999961975-6266
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      ||+|+.+|||+||.||+++|||||+|+||+|.|+|....          ....|.+|+++|+|||++++||+|++ +|+|
T Consensus       208 sKaav~~lTrslA~ela~~gIRVNaVaPG~i~T~l~~~~~~~~e~~~~~~~~~PlgR~g~PeEIA~~v~FLaSd~asyiT  287 (300)
T PRK06128        208 TKAAIVNFTKGLAQQVAEKGIRVNAVAPGPVWTPLQPSGGQPPEKIPDFGSETPMKRAGQPVEMAPLYVLLASQESSYVT  287 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999974169799999618898712001699999999998369989983999999999999582425855


Q ss_pred             CCEEEECCCCEEC
Q ss_conf             8579876876315
Q gi|254780337|r  240 GKLFSVPQNRFVN  252 (257)
Q Consensus       240 G~~~~vdgG~~~n  252 (257)
                      ||+|.||||.+++
T Consensus       288 Gq~i~VDGG~~lS  300 (300)
T PRK06128        288 GEVFGATGGLLLS  300 (300)
T ss_pred             CCEEEECCCHHCC
T ss_conf             8548968683019


No 46 
>PRK07814 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=448.58  Aligned_cols=242  Identities=26%  Similarity=0.361  Sum_probs=224.5

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ++|+||+||||||++|||+++|+.|+++|++|++++|++++++++.+++++.+.++.++.+|++|+++++++++++.++|
T Consensus         6 ~~L~gKvalITGgs~GIG~aia~~la~~Ga~V~i~~~~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~   85 (263)
T PRK07814          6 FRLDGQVAVVTGAGRGLGAAIALAFAEAGADVLIAARTESQLDEVAEQIRAAGRRAHVVAADLAHPEATAGLAGQAVEAF   85 (263)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             08999989995896689999999999879989999698999999999998529928999815899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             8987998768758888886765999999999999899999999999999860-898699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS-HCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~-~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |++|+||||||... ..|+.+++.|+|++++++|++++|+++|+++|+|+++ ++|+|||++|.+++.+.|+.++|++||
T Consensus        86 G~iDiLVnNAg~~~-~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~Y~asK  164 (263)
T PRK07814         86 GRLDIVVNNVGGTM-PNPLLSTSTKDLADAFTFNVATAHALTRAAVPLMLEHSGGGSIINITSTMGRLAGRGFAAYGTAK  164 (263)
T ss_pred             CCCCEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHH
T ss_conf             99889998986678-88445488999999999971999999999999999847994699981265477899848899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             9999999999998544386997553288379779844----------14443245888899999999961975-626685
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      +|+.+|||++|.||+++ ||||+|+||+|.|++.+..          ....|.+|+++|||+|++++||||++ +|+|||
T Consensus       165 aal~~ltk~lA~e~a~~-IrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~FL~Sd~s~~iTG~  243 (263)
T PRK07814        165 AALAHYTRLAALDLCPR-IRVNAIAPGSILTSALEVVAANDELRAPMEKATPLRRLGDPEDIAAAAVYLASPAGSYLTGK  243 (263)
T ss_pred             HHHHHHHHHHHHHHCCC-CEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999997799-78999977988860454325999999999857998898099999999999948432594488


Q ss_pred             EEEECCCCEE---CCCCCC
Q ss_conf             7987687631---543799
Q gi|254780337|r  242 LFSVPQNRFV---NYLTPN  257 (257)
Q Consensus       242 ~~~vdgG~~~---n~~~p~  257 (257)
                      +|.||||..+   +|=.||
T Consensus       244 ~i~VDGG~t~~~~~~~~~~  262 (263)
T PRK07814        244 TLEVDGGLTFPNLDLPIPD  262 (263)
T ss_pred             EEEECCCEECCCCCCCCCC
T ss_conf             2886879828999999999


No 47 
>PRK08339 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=449.82  Aligned_cols=242  Identities=23%  Similarity=0.323  Sum_probs=224.5

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             3265248899999389986889999999988998999978989999999999864-992899987899999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      +|+|+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++.+. +.++.++++|++++++++++++++
T Consensus         1 mm~l~L~gK~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~v~~~~~~~   80 (263)
T PRK08339          1 MLKIDLSGKLAFTTASSKGIGFGVARVLARAGADVIILSRNEENLKRAKEKIKSESDVEVHYIVADLTKREDLERTVKEL   80 (263)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             97417899989991626099999999999869999999798899999999998504985799984899999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             99818987998768758888886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                       +++|++|+||||||.. ..+++.++++|+|++++++|++++|+++|+++|+|+++++|+|||++|.++..+.|+.++|+
T Consensus        81 -~~~g~~dilv~nag~~-~~~~~~~~~~e~w~~~~~vnl~~~~~~~~~~~p~m~~~~~G~II~isS~a~~~~~~~~~~y~  158 (263)
T PRK08339         81 -KNIGDPDIFFFSTGGP-KPGYFMEMSMEDWEEAVKLLLYPAVYLTRALVPGMERKGFGRIIYSTSVAIKEPIPNIALSN  158 (263)
T ss_pred             -HHHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCHHHHH
T ss_conf             -9569998999899999-99891559999999999998699999999998765243896399955424347898617789


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-------------------CCCCCCCCCCHHHHHHHHHH
Q ss_conf             89999999999999985443869975532883797798441-------------------44432458888999999999
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-------------------PAEDPNTVPHPQKVAKIISF  230 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-------------------~~~~~~~~~~pediA~~v~f  230 (257)
                      ++|+|+.+|||+||.|++++|||||+|+||+|+|+|..+..                   ...|.+|+++|||||+++.|
T Consensus       159 asKaal~~ltk~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~f  238 (263)
T PRK08339        159 VVRIAMAGLVRTLAKELGPKGITVNGIMPGIIRTDRVIQLAQDRARREGKSVEEALQEYAKPIPLGRLGEPEEIGYLVAF  238 (263)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999999999999997111979999952879872366675657765289889999999707999998599999999999


Q ss_pred             HHCHH-HCCCCCEEEECCCCEECCC
Q ss_conf             61975-6266857987687631543
Q gi|254780337|r  231 LCATQ-KIETGKLFSVPQNRFVNYL  254 (257)
Q Consensus       231 L~s~~-~~~tG~~~~vdgG~~~n~~  254 (257)
                      |||++ +|+|||+|.||||+.-+.|
T Consensus       239 L~Sd~a~~itG~~i~VDGG~~~s~~  263 (263)
T PRK08339        239 LASDLGSYINGAMIPVDGGRLNSVF  263 (263)
T ss_pred             HHCCHHCCCCCCEEEECCCCCCCCC
T ss_conf             8294426814862898898134589


No 48 
>PRK07576 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=449.91  Aligned_cols=241  Identities=24%  Similarity=0.320  Sum_probs=226.5

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||+||||||++|||+++|+.|+++|++|++++|++++++++.+++++.+.++.++++|++|+++++++++++.++|
T Consensus         4 ~~L~gK~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~   83 (260)
T PRK07576          4 FRLAGKNVFVVGGTSGINLGIAQAFARAGANVAVASRSQEKVDAAVAQLQQAGPEALGVSADVRDYAAVEAAFAAIADEF   83 (260)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             42389989995896199999999999879999999798899999999999539948999931899999999999999984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||.. ...|+.++++|+|++++++|++|+|+++|+++|+|++++ |+|||++|.++..+.|+..+|++||+
T Consensus        84 G~iDiLVnnAg~~-~~~~~~~~~~~~~~~~~~vnl~~~~~~~~~~~p~m~~~~-G~IInisS~~~~~~~~~~~~y~asKa  161 (260)
T PRK07576         84 GPIDVLVSGAAGN-FPAPAAGMSANGFKTVVDIDLLGTFNVLKAAYPLLRRPG-ASIIQISAPQAVVAMPMQAHVCAAKA  161 (260)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEEECHHCCCCCCHHHHHHHHH
T ss_conf             9998999898678-998915599999999999864638999999999987179-77999988211367887189999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCC-CHHHHH----------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             99999999999854438699755328837-977984----------414443245888899999999961975-626685
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTR-TSMRAK----------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~-T~m~~~----------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      |+.+|||+||.||+++|||||+|+||+|. |++..+          .....|.+|+++|||||+++.||||++ +|+|||
T Consensus       162 av~~ltk~lA~e~a~~gIrVN~IaPG~i~~t~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~FL~Sd~s~~iTG~  241 (260)
T PRK07576        162 GVDMLTRTLALEWGPEGVRVNSISPGPIAGTEGMARLAPTPELQAAVAQSVPLKRNGTGQDIANAALFLASDMASYITGV  241 (260)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999971339299998347757836666327999999999847999998699999999999958742482586


Q ss_pred             EEEECCCCEECCCCC
Q ss_conf             798768763154379
Q gi|254780337|r  242 LFSVPQNRFVNYLTP  256 (257)
Q Consensus       242 ~~~vdgG~~~n~~~p  256 (257)
                      +|.||||+.+..++|
T Consensus       242 ~i~VDGG~sl~g~~~  256 (260)
T PRK07576        242 VLPVDGGWSLGGASI  256 (260)
T ss_pred             EEEECCCCCCCCCHH
T ss_conf             188793911588133


No 49 
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed
Probab=100.00  E-value=0  Score=449.32  Aligned_cols=237  Identities=29%  Similarity=0.419  Sum_probs=223.9

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      .+|+||+||||||++|||+++|++|+++|++|++++|++++++++.+++++.+.++.++.||++++++++++++++.++|
T Consensus         2 ~~L~gK~alITGgs~GIG~aia~~la~~G~~V~~~~r~~~~~~~~~~~l~~~g~~~~~~~~Dl~~~~~~~~~~~~~~~~~   81 (253)
T PRK12826          2 RDLMGRVALVTGAARGIGRAIAVRFAADGADVIVVDICGQAAAATAELVAAAGGKARAYQVDVRDRAALKALVAAGVERF   81 (253)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             98899889994897789999999999879989999898899999999998509958999951799999999999999983


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH-CCCCCCCHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356-47889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA-YKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g-~~~~~~~~~Y~asK  172 (257)
                      |++|+||||||+. ...+++++++|+|++++++|++++|+++|+++|+|+++++|+||||+|.+| ..+.|+..+|++||
T Consensus        82 g~iD~lvnnAg~~-~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~g~~~~~~~~~~Y~asK  160 (253)
T PRK12826         82 GRLDILVANAGIF-PLTPFAELDDEDWDRVIDVNLTGTFLLTQAALPALKRAGGGRIVLTSSVAGPRVGYPGLAHYAASK  160 (253)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCCCCCCCHHHHHHH
T ss_conf             9987899899889-999815599999999999875666433787469999769976999952564156899738899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-----------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             99999999999985443869975532883797798441-----------4443245888899999999961975-62668
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-----------PAEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-----------~~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
                      +|+.+|||++|.|++++|||||+|+||+++|+|.++..           ...|.+|+++|+|||+++.||||++ +|+||
T Consensus       161 aal~~ltk~lA~e~~~~gIrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~pl~R~~~p~eiA~~v~fL~S~~s~~itG  240 (253)
T PRK12826        161 AGVVGFTRALALELARRNITVNSVHPGMVDTPMAGNVFLGDASVAEAAAAAIPLGRLGEPEDIAAAVLFLASDAARYITG  240 (253)
T ss_pred             HHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             99999999999985320959999962879672121446687899999983799999859999999999996863229568


Q ss_pred             CEEEECCCCEE
Q ss_conf             57987687631
Q gi|254780337|r  241 KLFSVPQNRFV  251 (257)
Q Consensus       241 ~~~~vdgG~~~  251 (257)
                      |+|.||||.+|
T Consensus       241 ~~i~vDGG~tl  251 (253)
T PRK12826        241 QTLPVDGGATL  251 (253)
T ss_pred             CEEEECCCCCC
T ss_conf             73887899608


No 50 
>PRK07776 consensus
Probab=100.00  E-value=0  Score=451.04  Aligned_cols=239  Identities=26%  Similarity=0.323  Sum_probs=224.6

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      +|+++|+||++|||||++|||+++|++|+++|++|++++|+++.++++.+++.  +.++..+++|++|+++++++++++.
T Consensus         1 ~m~~~L~gKv~lITG~~~GIG~aiA~~la~~Ga~V~i~~~~~~~l~~~~~~l~--~~~~~~~~~Dv~~~~~~~~~~~~~~   78 (252)
T PRK07776          1 MTSLDLTGRTAIVTGASRGIGLAIAQALAAAGANVVITARKQEALDEAAAQLG--AERALGVAGHAVDEEHAREAVDLTL   78 (252)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC--CCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             99889999989994778799999999999879989999798899999999847--9957999974289999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||+||+||||||+.....||.|++.|+|++++++|++++|+++|++.|.|+++++|+|||++|.+++++.|+.++|++
T Consensus        79 ~~~g~iDilVnNAg~~~~~~~~~e~~~e~w~~~~~~Nl~~~~~~~~~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~a  158 (252)
T PRK07776         79 ERFGSVDILVNNAGTNPAYGPLIDQDLARFRKIFEVNVWAALGWTQLAWKAWMGEHGGAVVNVASIGGLHPSPGIGAYGA  158 (252)
T ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHH
T ss_conf             98499869998786688899813499999999999980789999999999986627964998077441157998479999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC--------CCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             99999999999999854438699755328837977984414--------443245888899999999961975-626685
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP--------AEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~--------~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      ||+|+.+|||+||.||++ +||||+|+||+++|+|.+..++        ..|.+|+++|+|||+++.||||++ +|+|||
T Consensus       159 sKaav~~ltk~lA~e~a~-~IrVN~V~PG~i~T~~~~~~~~~~~~~~~~~iPl~R~g~p~dia~~v~fL~S~~ss~iTGq  237 (252)
T PRK07776        159 SKAALIHLTKQLALELAP-RVRVNAVAPGVVRTKFAEALWEGREDEVAASYPLGRLGEPEDIASAVAFLVSDAASWITGE  237 (252)
T ss_pred             HHHHHHHHHHHHHHHHCC-CCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             999999999999999869-9889999645798854112205589999857999998099999999999958742480587


Q ss_pred             EEEECCCCEEC
Q ss_conf             79876876315
Q gi|254780337|r  242 LFSVPQNRFVN  252 (257)
Q Consensus       242 ~~~vdgG~~~n  252 (257)
                      +|.||||.++-
T Consensus       238 ~i~VDGG~~lg  248 (252)
T PRK07776        238 TLVVDGGLLLG  248 (252)
T ss_pred             EEEECCCCCCC
T ss_conf             29989571317


No 51 
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR011283   This entry represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of 1.1.1.36 from EC is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. ; GO: 0018454 acetoacetyl-CoA reductase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=462.36  Aligned_cols=232  Identities=23%  Similarity=0.300  Sum_probs=221.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEEC--CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             99999389986889999999988998999978--9899999999998649928999878999999999999999981898
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGR--SISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r--~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      |+|||||+.+|||.+|+++|++.||+|+...+  +.++.++=.++-+-.+.++..+..||++.|++++++++++++.|+|
T Consensus         1 rvALVTGg~GGIGtAIC~rL~~dG~~V~An~~p~N~~~a~~W~~~~~~~g~~~~~~~~DV~~~e~c~~~v~~v~a~lGpv   80 (244)
T TIGR01829         1 RVALVTGGTGGIGTAICTRLAKDGYRVAANYVPSNEERAEAWLQEQGAQGFDFAVVEGDVSSFEDCKAAVAKVEAELGPV   80 (244)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             94788578774468999999875988988178982589999998626985147898727677789999999999711953


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      |||||||||+++ .-|.+++.|+|+.++++||.+.|++||.+++.|.++++||||||||.=|++|..+++-|+++|||++
T Consensus        81 DvLVNNAGITRD-~~F~KM~~~qW~~VI~TNL~SvFNVT~pV~~gM~eRGwGRIiNISSvNG~KGQfGQtNYSAAKAG~i  159 (244)
T TIGR01829        81 DVLVNNAGITRD-KTFKKMTYEQWSEVIDTNLNSVFNVTRPVIEGMRERGWGRIINISSVNGQKGQFGQTNYSAAKAGMI  159 (244)
T ss_pred             EEEEECCCCCCC-HHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             689868864403-0312499846888986313244155400147662168841688412147756543045898862156


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHH--------HHH-HCCCCCCCCCCCHHHHHHHHHHHHCHHH-CCCCCEEEEC
Q ss_conf             99999999854438699755328837977--------984-4144432458888999999999619756-2668579876
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSM--------RAK-AMPAEDPNTVPHPQKVAKIISFLCATQK-IETGKLFSVP  246 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m--------~~~-~~~~~~~~~~~~pediA~~v~fL~s~~~-~~tG~~~~vd  246 (257)
                      +||++||+|.+.+||+||+||||.|.|||        +++ ..+..|.+|+++|||||.+|.||+||++ |+||.+|+|+
T Consensus       160 GFTkALA~E~A~kGvTVN~i~PGYi~T~MV~A~redVl~~rIva~IP~~RLg~PeEIA~aV~fLase~agy~TG~tL~~N  239 (244)
T TIGR01829       160 GFTKALAQEGARKGVTVNVIAPGYIATDMVMAVREDVLQSRIVAQIPVKRLGRPEEIAAAVAFLASEEAGYVTGATLSIN  239 (244)
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEECCCCCCCC
T ss_conf             77799997211038567545588988667786368887405778898321578157888998865410330016657768


Q ss_pred             CCCEE
Q ss_conf             87631
Q gi|254780337|r  247 QNRFV  251 (257)
Q Consensus       247 gG~~~  251 (257)
                      ||.|+
T Consensus       240 GGlyM  244 (244)
T TIGR01829       240 GGLYM  244 (244)
T ss_pred             CCCCC
T ss_conf             87679


No 52 
>PRK07774 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=448.91  Aligned_cols=236  Identities=23%  Similarity=0.339  Sum_probs=220.4

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||+||||||++|||+++|+.|+++|++|++++|+.++++++.++++..|.++.++++|++|+++++++++++.++|
T Consensus         2 ~~L~gK~alVTGgs~GiG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~f   81 (250)
T PRK07774          2 FDFDDKVAIVTGAAGGIGQAYAEALAREGASVVVADINAEGAERVAKQIVADGGTAIAVQVDVSDPDSAKAMADRTVSAF   81 (250)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             07799889997976889999999999869999999798899999999998559849999825899999999999999983


Q ss_pred             CCCCEEEECCCCCC--CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             89879987687588--8888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   94 GKLDILIANAGILG--SISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        94 g~iDilVNNAGi~~--~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      |++|+||||||+..  +..++.++++++|++++++|++|+|+++|++.|+|+++++|+|||++|.++.   +...+|++|
T Consensus        82 G~iDilVNnAg~~~~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IIn~sS~~~~---~~~~~Y~as  158 (250)
T PRK07774         82 GGIDYLVNNAAIYGGMKLDLLITVPWDYYKKFMSVNLDGALVCTRAVYKHMAKRGGGAIVNQSSTAAW---LYSNFYGLA  158 (250)
T ss_pred             CCCCEEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC---CCCHHHHHH
T ss_conf             99989998884357899974212999999999999889999999999999998299589997750045---785389999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             99999999999998544386997553288379779844---------14443245888899999999961975-626685
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      |+|+++|||+||.||+++|||||+|+||+++|+|....         ....|.+|+++|||||+++.||||++ +|+|||
T Consensus       159 Kaal~~ltk~lA~el~~~gIrVN~V~PG~i~t~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~S~~s~~iTGq  238 (250)
T PRK07774        159 KVGINGLTQQLARELGGMNIRVNAIAPGPIDTEATRTVTPKEFVADMVKGIPLSRMGTPEDLVGMCLFLLSDAASWITGQ  238 (250)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999999706494899997387877220014979999999857998898599999999999948242686498


Q ss_pred             EEEECCCCEEC
Q ss_conf             79876876315
Q gi|254780337|r  242 LFSVPQNRFVN  252 (257)
Q Consensus       242 ~~~vdgG~~~n  252 (257)
                      +|.||||+++.
T Consensus       239 ~i~VDGG~~~r  249 (250)
T PRK07774        239 IFNVDGGQIIR  249 (250)
T ss_pred             EEEECCCCCCC
T ss_conf             39978881214


No 53 
>PRK06484 short chain dehydrogenase; Validated
Probab=100.00  E-value=0  Score=449.37  Aligned_cols=232  Identities=25%  Similarity=0.371  Sum_probs=214.6

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      +||++|||||++|||+++|+.|+++|++|++++|+.+.++++.++   .+.+...+++|++|+++++++++++.++||++
T Consensus         4 eGKvalVTGas~GIG~aiA~~la~~Ga~V~~~dr~~~~~~~~~~~---~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~i   80 (530)
T PRK06484          4 QARVVLVTGAAGGIGRACCQRFARAGDRVVMADRDLAACTEEAER---LGSRHVALQLDVSDEAQVEHAMDGLLQQFGRI   80 (530)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH---CCCCCEEEEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             998999978366899999999998799999996888999999997---09971799984899999999999999972999


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      |+||||||+.....++.|++.|+|++++++||+|+|+++|+++|+|+++ +|+||||+|.+++.+.|+.++|++||+||.
T Consensus        81 DiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m~~~-gg~IInisS~~g~~~~~~~~~Y~asKaal~  159 (530)
T PRK06484         81 DVLVNNAGIGPTMRATLDTPLEDFDRAIAVNLEGPYLVAREALRLMGRH-GAAIVNVASLAGLVANPKRAAYSASKAGVI  159 (530)
T ss_pred             CEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCEEEEEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             8999899899889861009999999999987299999999999987762-573899983310457999688999999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH-----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEE
Q ss_conf             999999998544386997553288379779844-----------14443245888899999999961975-626685798
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKA-----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFS  244 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~-----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~  244 (257)
                      +|||+||.||+++|||||+|+||+|+|||..+.           ....|.+|+++|||||+++.||+|++ +|+|||+|.
T Consensus       160 ~lTkslA~Ela~~gIRVNaVaPG~I~T~m~~~~~~~~~~~~~~~~~~iPlgR~g~PeeiA~~v~FLaSd~asyITG~~i~  239 (530)
T PRK06484        160 SLTRSLACELAPKGIRVNAVAPGYVRTEMVAELERAGKLDRSAVRGRIPMGRLARPDEIAEAVHFLASAQASYITGSTLV  239 (530)
T ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHCCCCCCEEE
T ss_conf             99999999863409499999637888711433310564479999717998887899999999999768332588898799


Q ss_pred             ECCCCEECC
Q ss_conf             768763154
Q gi|254780337|r  245 VPQNRFVNY  253 (257)
Q Consensus       245 vdgG~~~n~  253 (257)
                      ||||.. .|
T Consensus       240 VDGG~~-~~  247 (530)
T PRK06484        240 VDGGWD-AY  247 (530)
T ss_pred             EECCCC-CC
T ss_conf             838931-53


No 54 
>PRK06701 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=448.74  Aligned_cols=239  Identities=23%  Similarity=0.305  Sum_probs=222.8

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH-HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             652488999993899868899999999889989999789899-9999999986499289998789999999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQ-LEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~-l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      .-+|+||+||||||++|||+++|+.|+++|++|++++|+.++ ++++.+++++.|.++.+++||++|+++++++++++.+
T Consensus        40 ~grL~GKvalVTGgs~GIG~aiA~~la~~GA~V~i~~~~~~~~a~~~~~~~~~~G~~~~~~~~Dv~d~~~v~~~v~~~~~  119 (289)
T PRK06701         40 SGKLKGKVALITGGDSGIGRAVAVAFAKEGADIAIVYLDEHEDANETKQRVEKEGVKCLLIPGDVSDEQFCKDAVEETVR  119 (289)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             88779998999682579999999999987998999828946789999999996399089998478999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +||+||+||||||+.....++.++++++|+++|++|++++|+++|+++|+|++  +|+|||++|.+++.+.+...+|++|
T Consensus       120 ~fG~iDiLVNNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~f~~~~~~~p~m~~--gg~IInisS~~~~~g~~~~~~Y~as  197 (289)
T PRK06701        120 ELGRLDILVNNAAQQYPQQSLEDITAEQLDKTFRTNIYSYFHMTKAALPHLKP--GSAIINTGSITGYEGNETLIDYSAT  197 (289)
T ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCEEEEECCCEECCCCCCHHHHHHH
T ss_conf             85999899988834678887244999999999745217899999999999734--9779995012152578840778999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH---------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             9999999999999854438699755328837977984---------414443245888899999999961975-626685
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK---------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~---------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      |+|+.+|||+||.||+++|||||+|+||+|+|+|...         .....|.+|+++|+|||++++||||++ +|+|||
T Consensus       198 Kaav~~ltk~LA~Ela~~gIrVNaIaPG~v~T~~~~~~~~~~~~~~~~~~~PlgR~g~peDIA~~v~fLaSd~ss~iTGq  277 (289)
T PRK06701        198 KGAIHAFTRSLSQSLVQKGIRVNAVAPGPIWTPLIPSDFDEEKVSQFGSDTPMKRPGQPEELAPAYVYLASPDSSYITGQ  277 (289)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999999703391898996578878876565999999999856998998099999999999957411485486


Q ss_pred             EEEECCCCEECC
Q ss_conf             798768763154
Q gi|254780337|r  242 LFSVPQNRFVNY  253 (257)
Q Consensus       242 ~~~vdgG~~~n~  253 (257)
                      +|.||||.++|.
T Consensus       278 ~i~VDGG~~v~g  289 (289)
T PRK06701        278 MLHVNGGVIVNG  289 (289)
T ss_pred             EEEECCCEECCC
T ss_conf             899688888119


No 55 
>PRK12824 acetoacetyl-CoA reductase; Provisional
Probab=100.00  E-value=0  Score=447.44  Aligned_cols=234  Identities=26%  Similarity=0.329  Sum_probs=217.8

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHH-HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             89999938998688999999998899899997898999-99999998649928999878999999999999999981898
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQL-EKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l-~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      +||||||||++|||+++|+.|+++|++|++++|+.+++ +++.++.+..+.++.++++|++|+++++++++++.++||+|
T Consensus         2 ~KvalITGas~GIG~a~a~~la~~G~~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~d~~~~~~~v~~~~~~~g~i   81 (245)
T PRK12824          2 KKIALVTGAKRGIGSAIARELLADGYRVIATYFGNYDAAKDWFEEYGFTEDQVRLKSLDVTDTEECQEALARIEEEEGPV   81 (245)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             85999947888899999999998799899995880778999999874049938999913899999999999999974999


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      |+||||||+. ..+++.++++|+|++++++||+++|+++|+++|.|+++++|+|||++|.+++.+.++.++|++||+||.
T Consensus        82 DiLVnnAG~~-~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaal~  160 (245)
T PRK12824         82 DILVNNAGIT-RDSGFKRMSHQEWNDVINTNLNSVFNVTQPLFPAMCEQGYGRIINISSVNGLKGQFGQTNYSAAKAGMI  160 (245)
T ss_pred             CEEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
T ss_conf             8999898889-999902399999999999973415999999999999839955999746775778899689999999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECC
Q ss_conf             999999998544386997553288379779844--------14443245888899999999961975-626685798768
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQ  247 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdg  247 (257)
                      +|||+||.|++++|||||+|+||+|+|||.++.        ....|.+|+++|||||+++.||||++ +|+|||+|.|||
T Consensus       161 ~ltk~lA~E~a~~gIrvN~I~PG~i~T~~~~~~~~e~~~~~~~~~Pl~R~g~peevA~~v~FL~Sd~a~~iTG~~i~VDG  240 (245)
T PRK12824        161 GFTKALASEGARYGITVNCIAPGYIATPMVEQAGPEVLQSIKNQIPMKRLGTPEEIAAAVAFLVSEAAGFITGETISING  240 (245)
T ss_pred             HHHHHHHHHHHHHCEEEEEEEECCCCCCCCHHCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECC
T ss_conf             99999999972549199999744687821000599999999856998898789999999999958632584185379786


Q ss_pred             CCEEC
Q ss_conf             76315
Q gi|254780337|r  248 NRFVN  252 (257)
Q Consensus       248 G~~~n  252 (257)
                      |.++|
T Consensus       241 G~~m~  245 (245)
T PRK12824        241 GLYMH  245 (245)
T ss_pred             CHHCC
T ss_conf             70019


No 56 
>PRK12938 acetyacetyl-CoA reductase; Provisional
Probab=100.00  E-value=0  Score=447.37  Aligned_cols=235  Identities=21%  Similarity=0.290  Sum_probs=220.5

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             488999993899868899999999889989999-7898999999999986499289998789999999999999999818
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      |+||+|||||+++|||+++|++|+++|++|++. .|+.++.+++.++.+..|.++.++++|++|+++++.+++++.++||
T Consensus         1 L~~KvalVTGgs~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~g   80 (246)
T PRK12938          1 MSQRIAYVTGGMGGIGTSICQRLHKDGFKVVAGCGPNSPRRVKWLEDQKALGFDFIASEGNVGDWDSTKAAFDKVKAEVG   80 (246)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             95098999185869999999999987998999479981789999999984599789996787999999999999999759


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      ++|+||||||+.. ..+|.++++++|++++++|++++|+++|+++|+|+++++|+||||+|.+++.+.++.++|++||+|
T Consensus        81 ~idiLVNNAG~~~-~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaa  159 (246)
T PRK12938         81 EIDVLVNNAGITR-DVVFRKMTREDWTAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAG  159 (246)
T ss_pred             CCCEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEHHHCCCCCCCHHHHHHHHH
T ss_conf             9989998988899-988034999999999999856399999999986103288189998336646688886377999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEE
Q ss_conf             99999999998544386997553288379779844--------14443245888899999999961975-6266857987
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSV  245 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~v  245 (257)
                      +.+|||+||.||+++|||||+|+||+++|+|.+..        ....|.+|+++|+|||+++.||||++ +|+|||+|.|
T Consensus       160 l~~ltk~lA~Ela~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~~~Pl~R~g~p~diA~~v~fL~S~~a~yiTG~~i~V  239 (246)
T PRK12938        160 IHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPEEIGSIVAWLASEESGFSTGADFSL  239 (246)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEE
T ss_conf             99999999999604398999996687987030112999999998469988984999999999999481435964872887


Q ss_pred             CCCCEE
Q ss_conf             687631
Q gi|254780337|r  246 PQNRFV  251 (257)
Q Consensus       246 dgG~~~  251 (257)
                      |||..+
T Consensus       240 dGG~~~  245 (246)
T PRK12938        240 NGGLHM  245 (246)
T ss_pred             CCCCCC
T ss_conf             878134


No 57 
>PRK07831 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=446.11  Aligned_cols=234  Identities=22%  Similarity=0.340  Sum_probs=217.9

Q ss_pred             CCCCCEEEEECCC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-C-CCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             2488999993899-86889999999988998999978989999999999864-9-9289998789999999999999999
Q gi|254780337|r   15 NLDNRLALVTGSS-RGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-N-KKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        15 ~l~~K~alVTGas-~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g-~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      .|+||++||||++ +|||+++|+.|+++|++|++++|+.++++++.+++.+. + .++..+.||++|+++++++++++.+
T Consensus        13 ~L~gKvalVTGgsg~GIG~a~a~~la~~Ga~V~i~d~~~~~~~e~~~~~~~~~g~~~v~~~~~Dvt~~~~v~~~v~~~~~   92 (261)
T PRK07831         13 LLAGKVVVVTAAAGTGIGSATARRALEEGADVVISDIHERRLGETADELAAELGLGRVEGVVCDVTSEAQVDALIDAAVE   92 (261)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             46998499949996478999999999879989998087777899999999843877289997568999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             8189879987687588888867659999999999998999999999999998608-986999788356478898368898
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      +||+||+||||||+. ...++.|+++|+|+++++|||+|+|+++|+++|+|++++ +|+|||++|.++.++.++.++|++
T Consensus        93 ~~G~iDiLVNNAG~~-~~~~~~e~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~gG~IinisS~~~~~~~~~~~~Y~a  171 (261)
T PRK07831         93 RLGRLDVLVNNAGLG-GQTPVVDMTDDEWSRVLDVTLTGTFRATRAALRYMRAAPHGGVIVNNASVLGWRAQHSQAHYAA  171 (261)
T ss_pred             HHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCHHHHH
T ss_conf             829986999888668-9988144999999998613215199999999999997699978984544030567887436899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             999999999999998544386997553288379779844---------14443245888899999999961975-62668
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
                      ||+|+.+|||+||.||+++|||||+|+||++.|+|.++.         ....+.+|+++|||||++++||||++ +|+||
T Consensus       172 sKaav~~lTk~lA~e~a~~gIrVNaI~PG~i~t~~~~~~~~~~~~~~~~~~~p~gR~g~pediA~~v~fLaSd~s~~iTG  251 (261)
T PRK07831        172 AKAGVMALTRCSAIEAAEYGVRINAVAPSIARHKFLKKVTSAELLDRLASGEAFGRAAEPWEVAAVIAFLASDYSSYLTG  251 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCHHHCCCCC
T ss_conf             99999999999999984529089999558767702221399999999870799789759999999999995815469757


Q ss_pred             CEEEECCCC
Q ss_conf             579876876
Q gi|254780337|r  241 KLFSVPQNR  249 (257)
Q Consensus       241 ~~~~vdgG~  249 (257)
                      |+|.|||||
T Consensus       252 q~i~V~gg~  260 (261)
T PRK07831        252 EVVSVSSQH  260 (261)
T ss_pred             EEEEECCCC
T ss_conf             388988997


No 58 
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=446.68  Aligned_cols=235  Identities=24%  Similarity=0.351  Sum_probs=222.2

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             488999993899868899999999889989999-7898999999999986499289998789999999999999999818
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      |+||++|||||++|||+++|++|+++|++|+++ .|++++++++.+++++.|.++.++++|++|+++++++++++.++||
T Consensus         2 L~gKvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~G   81 (250)
T PRK08063          2 FSGKVALVTGSSRGIGKAIALRLAKEGYDIAINYARSRKAAEETANEIEQLGRKALVVKANVGDVEKIKEMFSQIDEHFG   81 (250)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             89498999587669999999999988998999759998999999999995499589998479999999999999999809


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      +||+||||||.. ...|++++++++|++++++|++++|+++|++.|+|+++++|+||||+|.++..+.|+..+|++||+|
T Consensus        82 ~iDiLVnnAg~~-~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaa  160 (250)
T PRK08063         82 RLDVFVNNAASG-VLRPAMELEESHWDWTMNINAKALLFCAQEAAKLMEKNGGGKIISLSSLGSIRYLENYTTVGVSKAA  160 (250)
T ss_pred             CCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCHHHHHHHH
T ss_conf             988999878567-8899266999999999987403799999999999986389861588733105678996045878999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEE
Q ss_conf             99999999998544386997553288379779844----------14443245888899999999961975-62668579
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF  243 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~  243 (257)
                      +.+|||+||.||+++|||||+|+||+|+|+|.+..          ....|.+|+++|||||+++.||||++ +|+|||+|
T Consensus       161 l~~ltk~lA~ela~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~P~~R~g~pedia~~v~fL~S~~s~~iTG~~i  240 (250)
T PRK08063        161 LEALTRYLAVELAPKGIAVNAVSGGAVDTDALKHFPNREELLEDAQANTPAGRMVEPEDLVNAVLFLCSPKADMIRGQTI  240 (250)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEE
T ss_conf             99999999999725392899986087987677617984999999986799999869999999999993745348228708


Q ss_pred             EECCCCEE
Q ss_conf             87687631
Q gi|254780337|r  244 SVPQNRFV  251 (257)
Q Consensus       244 ~vdgG~~~  251 (257)
                      .||||+.+
T Consensus       241 ~VDGG~sl  248 (250)
T PRK08063        241 IVDGGRSL  248 (250)
T ss_pred             EECCCHHH
T ss_conf             85948786


No 59 
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=445.65  Aligned_cols=240  Identities=23%  Similarity=0.327  Sum_probs=221.6

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789-89999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      |++++|+||||||++|||+++|++|+++|++|++++|+ ++.++++++++++.+.++.+++||++|+++++++++++.++
T Consensus         1 M~~~~KValVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~   80 (259)
T PRK12745          1 MKSTRPVALVTGGRRGIGLGIALALAAGGFDLAINDRPDAEKLAATQQELRALGVEVIFFPADVADLSAHEATLDAAQDA   80 (259)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             99999999996867899999999999879989999798667899999999844994899984689999999999999998


Q ss_pred             HCCCCEEEECCCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC------CEEEEECCHHHCCCCCCC
Q ss_conf             1898799876875888-888676599999999999989999999999999986089------869997883564788983
Q gi|254780337|r   93 WGKLDILIANAGILGS-ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHC------GRAIILSSGAAYKCRPLW  165 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~-~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~------G~IInisS~~g~~~~~~~  165 (257)
                      ||++|+||||||+... ..+++++++|+|+++|++|++|+|+++|+++|+|++++.      |+|||++|.++..+.|+.
T Consensus        81 fg~iDiLVNNAG~~~~~~~~~~~~~~e~~~~~~~vNl~~~f~~~q~~~~~m~~~~~~~~~~~gsIInisS~~a~~~~~~~  160 (259)
T PRK12745         81 WGRIDCLVNNAGVGVKKRGDLLDLTPESFDRCLAVNLRGTFFLTQAVAKRMLAQPKPEAELPRSIVTVSSVNAIMLSPNR  160 (259)
T ss_pred             HCCCCEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCCCCCCC
T ss_conf             29988999847536688998101999999999999738999999999999996526888997089997787655778884


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-------C--CCCCCCCCCHHHHHHHHHHHHCHH-
Q ss_conf             688989999999999999985443869975532883797798441-------4--443245888899999999961975-
Q gi|254780337|r  166 GAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-------P--AEDPNTVPHPQKVAKIISFLCATQ-  235 (257)
Q Consensus       166 ~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-------~--~~~~~~~~~pediA~~v~fL~s~~-  235 (257)
                      ++|++||+||.+|||+||.||+++|||||+|+||+|+|+|.....       .  ..|.+|+++|+|||+++.||||++ 
T Consensus       161 ~~Y~asKaal~~ltr~lA~ela~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~P~~R~g~p~dia~~v~fL~S~~a  240 (259)
T PRK12745        161 GEYCISKAGLSMAAQLFALRLAEEGIGVYEVRPGLIKTDMTAPVTAKYDELIAKGLVPMGRWGEPEDVAATVAALAEGKL  240 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             78899999999999999999855493999998615888763200354799998679998997799999999999967800


Q ss_pred             HCCCCCEEEECCCCEECC
Q ss_conf             626685798768763154
Q gi|254780337|r  236 KIETGKLFSVPQNRFVNY  253 (257)
Q Consensus       236 ~~~tG~~~~vdgG~~~n~  253 (257)
                      +|+|||+|.||||..|+-
T Consensus       241 ~yiTGq~i~VDGG~sl~r  258 (259)
T PRK12745        241 IYTTGQAIAIDGGLSIPR  258 (259)
T ss_pred             CCCCCCEEEECCCCCCCC
T ss_conf             487588388896715879


No 60 
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=446.64  Aligned_cols=235  Identities=26%  Similarity=0.341  Sum_probs=222.5

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             48899999389986889999999988998999978989999999999864992899987899999999999999998189
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      |+||+||||||++|||+++|++|+++|++|++++|++++++++.++++..+.++.++++|++++++++++++++.++||+
T Consensus         2 L~gK~alITGas~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~~~~~~~D~~~~~~v~~~~~~~~~~~g~   81 (258)
T PRK12429          2 LKGKTALVTGAASGIGLEIALALAKEGAKVVIADLNDEAAAKAAEAIKKAGGKAIGVAMDVTDEEAINAGIDKVVETFGG   81 (258)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             89598999488758999999999987999999979889999999999844991899983589999999999999998299


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             87998768758888886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      ||+||||||+. ...|+++++.++|++++++|++|+|+++|+++|+|+++++|+||||+|.++..+.|+.++|++||+|+
T Consensus        82 iDiLVnnAG~~-~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~Iv~isS~~~~~~~~~~~~Y~asKaal  160 (258)
T PRK12429         82 VDILVNNAGIQ-HVAPIEDFPTEKWKKMIAIMLDGAFLTTKAALPHMKAQKWGRIINMASVHGLVGSAGKAAYVSAKHGL  160 (258)
T ss_pred             CCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHEEEHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             70999899888-99881559999999999976232122006777766435992899987755466899975899999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC--------------------CCCCCCCCCCHHHHHHHHHHHHCHH
Q ss_conf             99999999985443869975532883797798441--------------------4443245888899999999961975
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKAM--------------------PAEDPNTVPHPQKVAKIISFLCATQ  235 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~--------------------~~~~~~~~~~pediA~~v~fL~s~~  235 (257)
                      .+|||+||.||+++|||||+|+||+|+|||.+..+                    ...|.+|+++|||||+++.||||++
T Consensus       161 ~~lt~~lA~e~~~~gIrvN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~R~g~p~dia~~v~fL~S~~  240 (258)
T PRK12429        161 IGLTKVVALEGATHGVTVNAICPGYVDTPLVRKQIPDLAKERGISEEEVLEDVLLPLVPQKRFTTVEEIADLALFLASFA  240 (258)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCH
T ss_conf             99999999985320979999974879871022133678977399979999999972799899849999999999994807


Q ss_pred             -HCCCCCEEEECCCCEE
Q ss_conf             -6266857987687631
Q gi|254780337|r  236 -KIETGKLFSVPQNRFV  251 (257)
Q Consensus       236 -~~~tG~~~~vdgG~~~  251 (257)
                       +|+|||+|.||||...
T Consensus       241 s~~itGq~i~VDGG~tA  257 (258)
T PRK12429        241 AKGVTGQAWVVDGGWTA  257 (258)
T ss_pred             HCCCCCCEEEECCCHHC
T ss_conf             54901763896946307


No 61 
>PRK09135 pteridine reductase; Provisional
Probab=100.00  E-value=0  Score=446.18  Aligned_cols=237  Identities=24%  Similarity=0.346  Sum_probs=218.4

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             652488999993899868899999999889989999789-89999999999864-9928999878999999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKI-NKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~-g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      +|+++||+||||||++|||+++|++|+++|++|++++|+ .+.++++.+++.+. +.++.++++|++|+++++++++++.
T Consensus         1 ~M~~sgKvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~l~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~   80 (249)
T PRK09135          1 TMTDSSKVALITGGARRIGAAIARTLHAAGYRVAVHYHRSAAEADALAAELNRLRPGSAAALQADLLDPDALEQLVAAAV   80 (249)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             97899988999688758999999999987998999818987999999999985059818999816999999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||++|+||||||+.. ..|+.++++|+|++++++||+|+|+++|+++|+|++++ |+||||+|.++..+.++.++|++
T Consensus        81 ~~~G~iDiLVNNAg~~~-~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~-G~IInisS~~~~~~~~~~~~Y~a  158 (249)
T PRK09135         81 AAFGRLDALVNNASSFY-PTPLGEITEAQWDDLFASNAKAPFFLSQAAAPQLRKQR-GAIVNITDIHAERPLKNYPVYCA  158 (249)
T ss_pred             HHCCCCCEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCCHHHHH
T ss_conf             98399989998998899-99815599999999999833999999999999987478-87899987122778898567899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH---------HCCCCCCCCCCCHHHHHHHHHHHHCHHHCCCCC
Q ss_conf             99999999999999854438699755328837977984---------414443245888899999999961975626685
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK---------AMPAEDPNTVPHPQKVAKIISFLCATQKIETGK  241 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~---------~~~~~~~~~~~~pediA~~v~fL~s~~~~~tG~  241 (257)
                      ||+||.+|||+||.||+++ ||||+|+||+|.|++..+         .....|.+|+++|||||+++.||+|+++|+|||
T Consensus       159 sKaal~~ltr~lA~ela~~-IrVNaVaPG~i~t~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fLasdasyiTGq  237 (249)
T PRK09135        159 AKAALEMLTRSLALELAPE-VRVNAVAPGAILWPENDQGLDAEARQAILARTPLKRIGTPEDIAEAVLFLLEDASFITGQ  237 (249)
T ss_pred             HHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             9999999999999997799-889999307736776334499999999985799999819999999999996567874298


Q ss_pred             EEEECCCCEEC
Q ss_conf             79876876315
Q gi|254780337|r  242 LFSVPQNRFVN  252 (257)
Q Consensus       242 ~~~vdgG~~~n  252 (257)
                      +|.||||+.++
T Consensus       238 ~i~VDGG~slt  248 (249)
T PRK09135        238 ILAVDGGRSLT  248 (249)
T ss_pred             EEEECCCCCCC
T ss_conf             48859894576


No 62 
>PRK07035 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=445.61  Aligned_cols=237  Identities=24%  Similarity=0.351  Sum_probs=225.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ++|+||++|||||++|||+++|+.|+++|++|++++|+.++++++.+++++.+.++.++.||++|+++++++++++.++|
T Consensus         4 ~~L~gKvalITGas~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~   83 (252)
T PRK07035          4 FDLTGKIALVTGASRGIGEAIAKLLAQQGAHVIVSSRKLDGCQAVADAIVAAGGKAEALACHIGEMEQIDALFAQIRERH   83 (252)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             46789989995887499999999999879989999798899999999999649957999824899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+....+++.+++.++|++++++|++++|+++|++.|.|+++++|+|||++|.++..+.+..++|++||+
T Consensus        84 G~iDilVnnAg~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IvnisS~~~~~~~~~~~~Y~asKa  163 (252)
T PRK07035         84 GRLDILVNNAAANPYFGHILDTDLGAFQKTVDVNIRGYFFMSVEAGKLMKEQGGGSIVNVASVNGVSPGDFQGIYSITKA  163 (252)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
T ss_conf             99778987685588888820099999999999871243100045369999669974999725443688987488999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCE
Q ss_conf             999999999998544386997553288379779844----------14443245888899999999961975-6266857
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKL  242 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~  242 (257)
                      |+.+|||+||.||+++|||||+|+||+++|+|....          ....|.+|+++|||||+++.||+|++ +|+|||+
T Consensus       164 al~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~S~~a~~iTG~~  243 (252)
T PRK07035        164 AVISMTKAFAKECAPFGIRVNALLPGLTDTKFASALFKNDAILKQALAHIPLRRHAEPSEMAGAVLYLVSDASSYTTGEC  243 (252)
T ss_pred             HHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             99999999999860329599999628788742430248999999998569999982999999999999685422936864


Q ss_pred             EEECCCCE
Q ss_conf             98768763
Q gi|254780337|r  243 FSVPQNRF  250 (257)
Q Consensus       243 ~~vdgG~~  250 (257)
                      |.||||..
T Consensus       244 i~VDGG~~  251 (252)
T PRK07035        244 LNVDGGYL  251 (252)
T ss_pred             EEECCCCC
T ss_conf             88694987


No 63 
>PRK08265 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=444.83  Aligned_cols=234  Identities=24%  Similarity=0.305  Sum_probs=215.9

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ++|+||+|||||+++|||+++|++|+++|++|++++|++++++++.+++   +.++.+++||++++++++++++++.++|
T Consensus         2 ~~L~gKvalVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~---~~~~~~~~~Dv~~~~~i~~~~~~~~~~f   78 (261)
T PRK08265          2 IGLAGKVAIVTGGATLIGAAVARALVAAGACVAILDIDADNGAAVAASL---GERARFIATDITDDAAIERAVATAVARF   78 (261)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH---CCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             8999998999487768999999999987998999979889999999981---9972899813899999999999999981


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||...  .+..+.++|+|++++++|++++|+++|+++|+|+++ +|+||||+|.++..+.++..+|++||+
T Consensus        79 G~iDiLVNNAg~~~--~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m~~~-~G~IInisS~~~~~~~~~~~~Y~asKa  155 (261)
T PRK08265         79 GGLDILVNLACTYV--DDGLASSRADWLAALDVNLVSAAMLAQAAHPHLKRG-GGAIVNFTSISAKVAQTGRWLYPASKA  155 (261)
T ss_pred             CCCCEEEECCCCCC--CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCEEEEEEECCCCCCCCCCCHHHHHHH
T ss_conf             99878998575578--873439999999999998399999999999999876-977999965330457888506799999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC------------CCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             99999999999854438699755328837977984414------------443245888899999999961975-62668
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP------------AEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~------------~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
                      ||.+|||+||.||+++|||||+|+||+|+|||..+...            ..|.+|+++|+|||++++||||++ +|+||
T Consensus       156 al~~ltk~lA~e~a~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~p~dIa~~v~fL~Sd~a~~iTG  235 (261)
T PRK08265        156 AIRQLTRSMAMDLAPDGIRVNSVSPGWTWSRVMDELSGGDRAKADRVAAPFHLLGRVGDPEEVAQVVAFLCSDAASFVTG  235 (261)
T ss_pred             HHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             99999999999974109299888558778677876435889999998613788899758999999999996774238359


Q ss_pred             CEEEECCCCEECC
Q ss_conf             5798768763154
Q gi|254780337|r  241 KLFSVPQNRFVNY  253 (257)
Q Consensus       241 ~~~~vdgG~~~n~  253 (257)
                      |+|.||||+.+..
T Consensus       236 q~i~VDGG~sa~~  248 (261)
T PRK08265        236 ADYAVDGGYSALG  248 (261)
T ss_pred             CEEEECCCCCCCC
T ss_conf             7087281901379


No 64 
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=443.55  Aligned_cols=236  Identities=26%  Similarity=0.368  Sum_probs=223.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999-78989999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      |+|+||+||||||++|||+++|++|+++|++|+++ +|++++++++.+++++.+.++.++++|++|+++++++++++.++
T Consensus         1 m~L~gK~vlITGgs~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~   80 (247)
T PRK05565          1 MKLMGKVAIVTGASGGIGRAIAELLAKEGAKVVIAYDKNEEAANELLEEIKEVGGDAIAVKADVSSEDDVENLVEQIVEK   80 (247)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             99899889993784589999999999879989998179989999999999963990899983589999999999999998


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      ||++|+||||||+. ..+||.+++.++|++++++|++++|+++|+++|+|+++++|+|||++|.++..+.|+.++|++||
T Consensus        81 ~g~iD~lVnnAg~~-~~~~~~~~~~~~~~~~~~~Nl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~~~~~~~Y~asK  159 (247)
T PRK05565         81 FGKIDILVNNAGIS-KFGLVTDMTDEEWDRVINVNLTGVMRLTRYALPIMIKRGSGVIVNISSIWGLIGASCEVLYSASK  159 (247)
T ss_pred             CCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
T ss_conf             09984999899878-99991559999999999985478999999857988756997599973512257899833889999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEE
Q ss_conf             9999999999998544386997553288379779844--------14443245888899999999961975-62668579
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF  243 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~  243 (257)
                      +||.+|+|++|.||+++|||||+|+||+++|+|....        ....|.+|+++|+|||+++.||||++ +|+|||+|
T Consensus       160 aal~~ltr~lA~e~~~~gIrvN~V~PG~~~T~~~~~~~~~~~~~~~~~~p~~R~~~p~dva~~v~fL~s~~s~~itG~~i  239 (247)
T PRK05565        160 GAVNAFTKALAKELAPSGIRVNAIAPGAIETEMNSSFSEEDKEGLAEEIPLGRLGEPEEIAKVVLFLASDDASYITGQII  239 (247)
T ss_pred             HHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEE
T ss_conf             99999999999995430949999960989574210049778999985599889939999999999996862218568648


Q ss_pred             EECCCCE
Q ss_conf             8768763
Q gi|254780337|r  244 SVPQNRF  250 (257)
Q Consensus       244 ~vdgG~~  250 (257)
                      .||||..
T Consensus       240 ~VDGG~t  246 (247)
T PRK05565        240 TVDGGWT  246 (247)
T ss_pred             EECCCCC
T ss_conf             7484927


No 65 
>PRK07677 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=442.88  Aligned_cols=238  Identities=21%  Similarity=0.335  Sum_probs=221.5

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             48899999389986889999999988998999978989999999999864992899987899999999999999998189
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      |+||+||||||++|||+++|++|+++|++|++++|++++++++.+++++.|.++.++++|++|+++++++++++.++||+
T Consensus         1 L~gK~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~g~   80 (254)
T PRK07677          1 MKEKVVIITGGSSGMGKAMAKRFAEEGANVVITGRTKEKLEEAKLEIEQFPGQVLTVQMDVRNPDDVQKMIEQIDEKFGR   80 (254)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             95298999587678999999999987999999969999999999999856990999980389999999999999998399


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             879987687588888867659999999999998999999999999998608-9869997883564788983688989999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      +|+||||||.. ...|+.++++|+|++++++|++|+|+++|.+.|+|.+++ +|+|||++|..++.+.|+..+|++||+|
T Consensus        81 iDiLVnNAg~~-~~~~~~~~t~~~~~~~~~vnl~g~~~~~~~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~y~asKaa  159 (254)
T PRK07677         81 IDALINNAAGN-FICPAEDLSVNGWKSVIDIVLNGTFYCSQAVGKYWIEKGIKGNIINMVATYAWDAGAGVIHSAAAKAG  159 (254)
T ss_pred             CCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHH
T ss_conf             88899757557-78882659999999999997231889999999999982899539999511005688982889999999


Q ss_pred             HHHHHHHHHHHHHH-HCCEEEEECCCCCCCHH-H----------HHHCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             99999999998544-38699755328837977-9----------84414443245888899999999961975-626685
Q gi|254780337|r  175 IEALARTWSKETVN-TALRVINIDPGPTRTSM-R----------AKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       175 l~~lt~~la~E~~~-~gIrvn~I~PG~v~T~m-~----------~~~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      |.+|||+||.||++ ||||||+|+||+|+|++ .          ++.....|.+|+++|||||+++.||||++ +|+|||
T Consensus       160 l~~ltk~lA~ela~~~gIrvN~I~PG~i~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fL~S~~asyiTG~  239 (254)
T PRK07677        160 VLAMTRTLAVEWGRKYGIRVNAIAPGPIERTGGADKLWISEEAAKRTIQSVPLGRLGTPEEIAGLAYYLLSDEAAYINGT  239 (254)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999998572339899999427677764032324999999999857999998499999999999958732482487


Q ss_pred             EEEECCCCEECCC
Q ss_conf             7987687631543
Q gi|254780337|r  242 LFSVPQNRFVNYL  254 (257)
Q Consensus       242 ~~~vdgG~~~n~~  254 (257)
                      +|.||||++++-+
T Consensus       240 ~i~VDGG~~l~~~  252 (254)
T PRK07677        240 CITMDGGQWLNQY  252 (254)
T ss_pred             EEEECCCCCCCCC
T ss_conf             2886899010789


No 66 
>PRK09134 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=443.93  Aligned_cols=243  Identities=24%  Similarity=0.347  Sum_probs=226.8

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             3265248899999389986889999999988998999-978989999999999864992899987899999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIA-CGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~-~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      -|+ .|++|+||||||++|||+++|++|+++|++|++ ++|+.++++++.+++++.|.++.++++|++|+++++++++++
T Consensus         3 ~m~-~~~~KvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~i~~~g~~~~~~~~Dl~~~~~~~~~v~~~   81 (256)
T PRK09134          3 AMP-MAAPRAALVTGAARRIGRAIALDLAAHGFDVAVHYNRSRDEAEALAAEIRALGRRAVALQADLADEAQVRALVARA   81 (256)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             698-9999979994886789999999999879989998499989999999999964991899975589999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             99818987998768758888886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      .++||++|+||||||+. ...+++|+++|+|+++|++|++++|+++|++.|+|++++.|+|||++|.++..+.|++.+|+
T Consensus        82 ~~~~G~iDiLVnNAg~~-~~~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m~~~~~G~IVni~s~~~~~~~~~~~~Y~  160 (256)
T PRK09134         82 SAALGPITLLVNNASLF-EYDSAASFTRASWDRHMATNLRAPFVLAQAFARALPADARGLVVNMIDQRVWNLNPDFLSYT  160 (256)
T ss_pred             HHHHCCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCCCHHHH
T ss_conf             99829987899887116-89970209999999997540105999999999998860780699980076547899715169


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHH------HHHHCCCCCCCCCCCHHHHHHHHHHHHCHHHCCCCCEE
Q ss_conf             899999999999999854438699755328837977------98441444324588889999999996197562668579
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSM------RAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLF  243 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m------~~~~~~~~~~~~~~~pediA~~v~fL~s~~~~~tG~~~  243 (257)
                      +||+|+.+|||+||.|++++ ||||+|+||++.++.      +++.....|.+|+++|||||+++.|||| ++++|||+|
T Consensus       161 asKaal~~ltr~lA~ela~~-IrVN~VaPG~~~~~~~~~~~~~~~~~~~~pl~R~~~pediA~~v~fLas-~~~iTGq~i  238 (256)
T PRK09134        161 LSKAALWTATRTLAQALAPR-IRVNAIGPGPTLPSGRQSPEDFARQHAATPLGRGPNPEEIGAALRYLLD-APSVTGQMI  238 (256)
T ss_pred             HHHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHC-CCCCCCCEE
T ss_conf             99999999999999997799-9899994250056876799999999837998899699999999999974-788778828


Q ss_pred             EECCCCEECCCCCC
Q ss_conf             87687631543799
Q gi|254780337|r  244 SVPQNRFVNYLTPN  257 (257)
Q Consensus       244 ~vdgG~~~n~~~p~  257 (257)
                      .||||++|+|++||
T Consensus       239 ~VDGG~~l~~~~~~  252 (256)
T PRK09134        239 AVDGGQHLAWETPD  252 (256)
T ss_pred             EECCCCCCCCCCCC
T ss_conf             86968337999987


No 67 
>PRK06947 glucose-1-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=442.50  Aligned_cols=235  Identities=26%  Similarity=0.329  Sum_probs=219.3

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             2488999993899868899999999889989999-789899999999998649928999878999999999999999981
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      +++|||||||||++|||+++|+.|+++|++|+++ .|+++.++++.+++++.+.++.++++|++|+++++++++++.++|
T Consensus         3 ~~~~KvalVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~   82 (252)
T PRK06947          3 NSDRKVVLITGASRGIGRATAVLAAARGWSVGINYARDAAAAEETADAVRAAGGRACVVAGDVANEADVIAMFDAVQAAF   82 (252)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             99990899938835899999999998799899980898789999999999649928999847999999999999999984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCEEEEECCHHHCCCCCC-CHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608---986999788356478898-36889
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH---CGRAIILSSGAAYKCRPL-WGAYS  169 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~---~G~IInisS~~g~~~~~~-~~~Y~  169 (257)
                      |++|+||||||+..+..|+.|+++|+|++++++|++|+|+++|++.|+|++++   .|+|||++|.+++.+.|. +.+|+
T Consensus        83 G~iD~lVnNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~~~~g~IinisS~~~~~~~~~~~~~Y~  162 (252)
T PRK06947         83 GRLDALVNNAGIVAPSMPLADMDAARLRRMFDTNVLGAYLCAREAARRLSTDRGGRGGAIVNVSSIASRLGSPNEYVDYA  162 (252)
T ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHCCCCCCCHHHHH
T ss_conf             99889998764357999812399999999999985799999999999999845799858999856654558887306679


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH---------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             899999999999999854438699755328837977984---------414443245888899999999961975-6266
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK---------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~---------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      +||+||.+|||+||.||+++|||||+|+||+|+|+|...         .....|.+|+++|||||+++.||+|++ +|+|
T Consensus       163 ~sK~al~~ltr~lA~e~a~~gIrvN~IaPG~i~T~~~~~~~~~~~~~~~~~~~Pl~R~g~p~dIa~~v~fL~Sd~s~~iT  242 (252)
T PRK06947        163 GSKGAVDTLTLGLAKELGPHGVRVNAVRPGLIETEIHASGGQPGRAARLGAQTPLGRAGEADEVAEAIVWLLSDAASYVT  242 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999997462928998971158775422369969999998379999981999999999999687114865


Q ss_pred             CCEEEECCCC
Q ss_conf             8579876876
Q gi|254780337|r  240 GKLFSVPQNR  249 (257)
Q Consensus       240 G~~~~vdgG~  249 (257)
                      ||+|.|||||
T Consensus       243 Gq~i~VdGG~  252 (252)
T PRK06947        243 GALLDVGGGR  252 (252)
T ss_pred             CCEEEECCCC
T ss_conf             8537848999


No 68 
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=444.52  Aligned_cols=235  Identities=26%  Similarity=0.372  Sum_probs=210.4

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |.-+|+||++|||||++|||+++|++|+++|++|++++++.++..   +++++.+  ...++||++|+++++++++++.+
T Consensus         1 M~grL~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~---~~~~~~~--~~~~~~Dvt~~~~v~~~v~~~~~   75 (254)
T PRK06463          1 MSGKFKGKVALITGGSRGIGRAIAEKFLKEGAKVAILYNSSEDKA---KELKEKG--VETFKCDVSNRDQVRKAKEEIHK   75 (254)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHH---HHHHHCC--CEEEEEECCCHHHHHHHHHHHHH
T ss_conf             997569898999484778999999999988999999649978999---9998669--88999738999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC-CCCCCCHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564-78898368898
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAY-KCRPLWGAYSA  170 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~-~~~~~~~~Y~a  170 (257)
                      +||++|+||||||+. ...|++|+++|+|++++++||+|+|+++|+++|+|++++ |+||||+|.++. .+.++.++|++
T Consensus        76 ~~G~iDiLVNNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~-G~IVnisS~~g~~~~~~~~~~Y~a  153 (254)
T PRK06463         76 KLGRIDVLVNNAGIW-YLMPFEEFDEEKYNRMLDVNLNGTIYTTYEFLPDLKEEN-GVIINIASNAGIGTAAEGTTFYAI  153 (254)
T ss_pred             HHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEEEHHHCCCCCCCCHHHHH
T ss_conf             829998999899778-999915599999999999983899999999999887639-869999757542878876178899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH-------------HCCCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             99999999999999854438699755328837977984-------------414443245888899999999961975-6
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK-------------AMPAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~-------------~~~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      ||+|+.+|||+||.||+++|||||+|+||+|+|+|...             .....+.+|+++|||||+++.||||++ +
T Consensus       154 sKaav~~ltr~lA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~pl~R~g~pediA~~v~fLaSd~a~  233 (254)
T PRK06463        154 TKAGIIMLTKRLAFELGKYGIRVNAVAPGWIETDMTIGGKSPEEIEKLEEDFRSRTVLHTTGKPEDIANIVLFLASDDAR  233 (254)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999999999970239599999868898765335688578999999998279978981999999999999584424


Q ss_pred             CCCCCEEEECCCCEECC
Q ss_conf             26685798768763154
Q gi|254780337|r  237 IETGKLFSVPQNRFVNY  253 (257)
Q Consensus       237 ~~tG~~~~vdgG~~~n~  253 (257)
                      |+|||+|.||||+..|.
T Consensus       234 ~iTG~~i~VDGG~v~~l  250 (254)
T PRK06463        234 YITGQVIVADGGRIDNL  250 (254)
T ss_pred             CCCCCEEEECCCEECCC
T ss_conf             91586599639995888


No 69 
>PRK12743 acetoin dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=441.27  Aligned_cols=235  Identities=23%  Similarity=0.314  Sum_probs=220.3

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             89999938998688999999998899899997-89899999999998649928999878999999999999999981898
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~-r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      |||||||||++|||+++|+.|+++|++|++++ |+++.++++.+++++.|.++.++++|++|+++++++++++.++||++
T Consensus         2 ~KValITGgs~GIG~a~a~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~i   81 (253)
T PRK12743          2 AQVAIVTASDSGIGKACALLLAQQGFDIGITWHSDEEGAKETAEEVVSHGVRAEIVHLDLSNLPEGAQAIEKLIQRLGRL   81 (253)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99899907588999999999998799899974899799999999999459918999904899999999999999981999


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608-98699978835647889836889899999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      |+||||||+. ...|+.|+++|+|++++++|++++|+++|++.|+|++++ +|+|||++|.+++.+.++.++|++||+|+
T Consensus        82 DilVNnAG~~-~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~k~~~~G~IVnisS~~~~~~~~~~~~Y~asKaal  160 (253)
T PRK12743         82 DVLVNNAGAM-TKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARHMVKQGQGGRIINITSVHEHTPLPDASAYTAAKHAL  160 (253)
T ss_pred             CEEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHHCCCCCCCHHHHHHHHHH
T ss_conf             8999899899-999800299999999999985999999999999999758996389996366557889858999999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH--------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEEC
Q ss_conf             999999999854438699755328837977984--------414443245888899999999961975-62668579876
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAK--------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVP  246 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~--------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vd  246 (257)
                      .+|||++|.||+++|||||+|+||+|+|||...        .....|.+|+++|||||+++.||||++ +|+|||+|.||
T Consensus       161 ~~ltk~lA~ela~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~~iPl~R~g~pedia~~v~fL~Sd~s~yiTG~~i~VD  240 (253)
T PRK12743        161 GGLTKAMALELVEHKILVNAVAPGAIATPMNGMDDSDVKPDAEPSIPLRRPGHTHEIASLVAWLCSEGASYTTGQSLIVD  240 (253)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEEC
T ss_conf             99999999997021929999964889877666787779999985799899849999999999993852258258648978


Q ss_pred             CCCEECC
Q ss_conf             8763154
Q gi|254780337|r  247 QNRFVNY  253 (257)
Q Consensus       247 gG~~~n~  253 (257)
                      ||.++.-
T Consensus       241 GG~~l~~  247 (253)
T PRK12743        241 GGFMLAN  247 (253)
T ss_pred             CCEECCC
T ss_conf             6868076


No 70 
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=100.00  E-value=0  Score=441.45  Aligned_cols=237  Identities=27%  Similarity=0.378  Sum_probs=221.4

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH-HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899-99999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQ-LEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~-l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|+.++ .+.+.+.+...+.++.++++|++++++++++++.+.++
T Consensus         1 ~~L~gK~~lITGgs~GIG~aia~~la~~G~~Vii~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlt~~~~v~~~~~~~~~~   80 (248)
T PRK05557          1 MSLEGKVALVTGASRGIGRAIAERLAAQGANVVLNYASSEAGAEALVAEIGALGGKALAVQGDVADAESIERAVDEAKAE   80 (248)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             96799889994897689999999999879989999698565899999999963995899990389999999999999998


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      ||++|+||||||+. ..++++++++++|++++++|++++|+++|+++|+|+++++|+||||+|.++..+.|+.++|++||
T Consensus        81 ~g~iD~linnAg~~-~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asK  159 (248)
T PRK05557         81 FGGVDILVNNAGIT-RDNLLMRMKEEDWDRVIDTNLTGVFNLTKAVARPMMKQRSGRIINISSVVGLMGNPGQANYAASK  159 (248)
T ss_pred             CCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
T ss_conf             29971999899779-99991559999999999878304999999999999970697189980466567899955569999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEE
Q ss_conf             9999999999998544386997553288379779844--------14443245888899999999961975-62668579
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF  243 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~  243 (257)
                      +|+.+|||+||.||+++|||||+|+||+|+|+|.+..        ....|.+|+++|||||+++.||||++ +|+|||+|
T Consensus       160 aal~~lt~~lA~e~~~~gIrvN~V~PG~i~T~~~~~~~~~~~~~~~~~~pl~R~~~p~dva~~v~fL~S~~s~~iTG~~i  239 (248)
T PRK05557        160 AGVIGFTKSLARELASRGITVNAVAPGFIETDMTDALPEDVKEAILAQIPLGRLGQPEEIASAVAFLASDEAAYITGQTL  239 (248)
T ss_pred             HHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEE
T ss_conf             99999999999985331949999974888775421179999999985799999809999999999996872228358728


Q ss_pred             EECCCCEE
Q ss_conf             87687631
Q gi|254780337|r  244 SVPQNRFV  251 (257)
Q Consensus       244 ~vdgG~~~  251 (257)
                      .||||.++
T Consensus       240 ~VDGG~~~  247 (248)
T PRK05557        240 HVNGGMVM  247 (248)
T ss_pred             EECCCHHC
T ss_conf             87967113


No 71 
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=440.96  Aligned_cols=238  Identities=29%  Similarity=0.453  Sum_probs=223.4

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             2652488999993899868899999999889989999789-899999999998649928999878999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      |..+|+||++|||||++|||+++|++|+++|++|++++|+ .+.+++++++++..+.++.++++|++++++++++++++.
T Consensus         1 ~m~~LkgK~~lITGas~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~   80 (250)
T PRK12825          1 LMGSLSGRVALVTGAARGIGRAIALRLAAAGADVIVHPPSDEAAAEETVAAVEALGRRAQAVQADVTDAAALEAAVEELV   80 (250)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             98660978899938955899999999998799899997988789999999998539948999941899999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||++|+||||||+. ...|++++++|+|++++++|++|+|+++|+++|+|+++++|+|||++|.++..+.|+.++|++
T Consensus        81 ~~~g~iDilInnAg~~-~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~~~~~~~Y~~  159 (250)
T PRK12825         81 ERFGAIDILVNNAGIT-GDGRLWEMSDDEWERVIDVNLTGVFNVLRAVVPPMIEAGGGRIVNISSVAGLKGNPGQVNYAA  159 (250)
T ss_pred             HHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHH
T ss_conf             9769998999899889-998902399999999999851899999999899999749973999914555578999677899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             999999999999998544386997553288379779844--------14443245888899999999961975-626685
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      ||+|+.+|||++|.|++++|||||+|+||+|+|+|.+..        ....|.+|+++|||||+++.||+|++ +|+|||
T Consensus       160 sK~Al~~l~~~la~e~~~~gIrvN~I~PG~v~T~~~~~~~~~~~~~~~~~~p~~R~~~pedva~~v~fL~s~~s~~itG~  239 (250)
T PRK12825        160 AKAGLVGLTKALARELAERGIRVNAVAPGAIDTEMIEATIEEAREAILKLIPLGRLGTPEEIADAVAFLASDAAGYITGQ  239 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999999860429299999728887703212588899999826998998399999999999968622282488


Q ss_pred             EEEECCCCE
Q ss_conf             798768763
Q gi|254780337|r  242 LFSVPQNRF  250 (257)
Q Consensus       242 ~~~vdgG~~  250 (257)
                      +|.||||-.
T Consensus       240 ~i~vDGGl~  248 (250)
T PRK12825        240 VIAVDGGMG  248 (250)
T ss_pred             EEEECCCCC
T ss_conf             689896813


No 72 
>PRK06398 aldose dehydrogenase; Validated
Probab=100.00  E-value=0  Score=445.47  Aligned_cols=232  Identities=25%  Similarity=0.366  Sum_probs=211.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      .+|+||++|||||++|||+++|++|+++|++|++++|++++..          ..+.+++||++++++++++++++.++|
T Consensus         2 ~~L~gKvalVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~----------~~~~~i~~Dvt~~~~v~~~v~~~~~~~   71 (256)
T PRK06398          2 RDLRDKVVIVTGGSSGIGLAIVSRFVDEGSKVVSISRSEPEDI----------NKSDHIKCDVTNEDEVKNAINEISKKY   71 (256)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCC----------CCCCEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             8999898999687878999999999986999999948751251----------722389854799999999999999983


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ...+++++++|+|++++++||+|+|+++|+++|+|+++++|+||||+|.++..+.|+.++|++||+
T Consensus        72 G~iDiLVNNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKa  150 (256)
T PRK06398         72 GRIDVLVNNAGIE-KYGSLHKTDSGTWRRIIDVNVNGVYYMSKEVIPHMLRSGTGSIVNISSVQADIATKNAAAYVTSKH  150 (256)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             9997999899999-999904499999999999973628999999999999839957999804020777999689999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-------------------CCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             9999999999985443869975532883797798441-------------------444324588889999999996197
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-------------------PAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-------------------~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      ||.+|||+||.||+++ ||||+|+||+|+|||..+..                   ...|.+|+++|||||+++.||||+
T Consensus       151 al~~ltrslA~ela~~-IrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~peeiA~~v~FLaSd  229 (256)
T PRK06398        151 ALIGLTKSIAVDYAPL-IRCNAVCPGTIDTPLVDKAAELEVGKDPEAIERKILEWGNLHPMGRIGRPEEVASVVAFLASD  229 (256)
T ss_pred             HHHHHHHHHHHHHCCC-CEEEEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             9999999999997799-889999737888616676766432689899999999764578988977899999999999484


Q ss_pred             H-HCCCCCEEEECCCCEECC--CCCC
Q ss_conf             5-626685798768763154--3799
Q gi|254780337|r  235 Q-KIETGKLFSVPQNRFVNY--LTPN  257 (257)
Q Consensus       235 ~-~~~tG~~~~vdgG~~~n~--~~p~  257 (257)
                      + +|+|||+|.||||..+-.  -|||
T Consensus       230 ~as~iTG~~i~VDGG~t~~~p~~~p~  255 (256)
T PRK06398        230 ESSFITGTCLYVDGGLSVLAPISTPD  255 (256)
T ss_pred             HHCCCCCCEEEECCCHHHCCCCCCCC
T ss_conf             53383386177893932186212589


No 73 
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=442.22  Aligned_cols=229  Identities=24%  Similarity=0.353  Sum_probs=206.1

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|++++.         .+.++.++++|++|+++++++++++.++|
T Consensus         5 ~~L~gKvalVTGgs~GIG~aia~~la~~Ga~V~~~d~~~~~~---------~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~   75 (266)
T PRK06171          5 LNLQGKIIIVTGGSSGIGLAIVEELLAQGANVQMVDIHGGDE---------KHKGYQFWPTDISSAKEVNHTVAEIIERF   75 (266)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHC---------CCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             389999799947787899999999998799999997885350---------58976999816999999999999999983


Q ss_pred             CCCCEEEECCCCCCCC--------CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCC
Q ss_conf             8987998768758888--------88676599999999999989999999999999986089869997883564788983
Q gi|254780337|r   94 GKLDILIANAGILGSI--------SPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLW  165 (257)
Q Consensus        94 g~iDilVNNAGi~~~~--------~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~  165 (257)
                      |+||+||||||+..+.        ...+|+++|+|++++++||+|+|+++|+++|+|+++++|+|||++|.+++.+.|+.
T Consensus        76 G~iDiLVNNAGi~~~~~~~d~~~~~~~~e~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~g~~g~~~~  155 (266)
T PRK06171         76 GRIDGLVNNAGINFPRLLVDEKAPAGQYELNEAAFEKMVNINQKGVFLMSQAVARQMVKQHDGVIVNMSSEAGLEGSEGQ  155 (266)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCC
T ss_conf             99889998886676532124457665455999999999999949999999999999998399579980577756789875


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHH-----HHHH------------------CCCCCCCCCCCHH
Q ss_conf             6889899999999999999854438699755328837977-----9844------------------1444324588889
Q gi|254780337|r  166 GAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSM-----RAKA------------------MPAEDPNTVPHPQ  222 (257)
Q Consensus       166 ~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m-----~~~~------------------~~~~~~~~~~~pe  222 (257)
                      ++|++||+||.+|||+||.||+++|||||+|+||+++|++     .++.                  ....|.+|+++||
T Consensus       156 ~~Y~asKaav~~ltr~lA~ela~~gIrVNaV~PG~i~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~pe  235 (266)
T PRK06171        156 SCYAATKAAVNSFTRSWAKELGKHGIRVVGVAPGILEATGLRTPEYEEALAYTRNITVEQLRAGYTKTSTIPLGRSGKLS  235 (266)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCCHH
T ss_conf             89999999999999999999845495999983177166545670157776540366588999888776579988974999


Q ss_pred             HHHHHHHHHHCHH-HCCCCCEEEECCCCEE
Q ss_conf             9999999961975-6266857987687631
Q gi|254780337|r  223 KVAKIISFLCATQ-KIETGKLFSVPQNRFV  251 (257)
Q Consensus       223 diA~~v~fL~s~~-~~~tG~~~~vdgG~~~  251 (257)
                      |||++++||+|++ +|+|||+|.||||+..
T Consensus       236 eiA~~v~fLaSd~as~iTG~~i~VDGG~T~  265 (266)
T PRK06171        236 EVADLVCYLLSERASYITGVTTNIAGGKTR  265 (266)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEEECCCCCC
T ss_conf             999999999585525805862898788268


No 74 
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=441.08  Aligned_cols=235  Identities=23%  Similarity=0.353  Sum_probs=216.0

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ++|+||++|||||++|||+++|+.|+++|++|++++++..  ++..++++..|.++.+++||++++++++++++++.++|
T Consensus         4 f~L~gKvalVTGas~GIG~aia~~la~~Ga~Vv~~~~~~~--~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~   81 (251)
T PRK12481          4 FDLNGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEA--PETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEVM   81 (251)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCH--HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             2899998999486768999999999986999999789871--99999999759947999912799999999999999981


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608-98699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |++|+||||||+. ...++.++++++|++++++|++++|+++|++.|.|++++ +|+||||+|.++..+.+...+|++||
T Consensus        82 g~iDilVNNAG~~-~~~~~~~~~~~~w~~~~~vNl~~~~~~~q~~~~~m~~~~~~G~IVnisS~~~~~~~~~~~~Y~asK  160 (251)
T PRK12481         82 GHIDILINNAGII-RRQDLLEFGNKDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQGGIRVPSYTASK  160 (251)
T ss_pred             CCCCEEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCHHHHHH
T ss_conf             9998999899899-999903499999999999983779999999999999856993487402133336889871479999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             9999999999998544386997553288379779844----------14443245888899999999961975-626685
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      +|+.+|||+||.||+++|||||+|+||+++|+|.+..          ....|.+|+++|||||+++.||||++ +|+|||
T Consensus       161 aav~~ltr~lA~e~a~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~S~~a~~iTG~  240 (251)
T PRK12481        161 SAVMGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPASRWGTPDDLAGPAIFLSSSASDYVTGY  240 (251)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999997030969999952888777521103799999999955999998689999999999938253590485


Q ss_pred             EEEECCCCEE
Q ss_conf             7987687631
Q gi|254780337|r  242 LFSVPQNRFV  251 (257)
Q Consensus       242 ~~~vdgG~~~  251 (257)
                      +|.||||...
T Consensus       241 ~i~VDGG~~a  250 (251)
T PRK12481        241 TLAVDGGWLA  250 (251)
T ss_pred             EEEECCCHHC
T ss_conf             5897846425


No 75 
>PRK06125 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=440.14  Aligned_cols=237  Identities=23%  Similarity=0.362  Sum_probs=219.1

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             265248899999389986889999999988998999978989999999999864-9928999878999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      |+|+|+||+|||||+++|||+++|++|+++|++|++++|++++++++.++++.. +.++..+.+|+++++++++++    
T Consensus         1 M~~~l~gK~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~----   76 (259)
T PRK06125          1 MDLHLAGKRVLITGASKGIGAAAAEAFAAEGCHLVLAARDADALAALAADLRAAHGVDVAVHALDLSSPEAREQLA----   76 (259)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH----
T ss_conf             9988699989996877689999999999879989999798899999999998700986699988899999999999----


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      +++|++|+||||||.. +.++|+++++++|++++++|++++|+++|+++|+|+++++|+|||++|.++..+.|+..+|++
T Consensus        77 ~~~g~iDiLVnnAG~~-~~~~~~~~~~~~w~~~~~vnl~~~~~l~~~~~p~m~~~~~G~Iini~s~~~~~~~~~~~~y~a  155 (259)
T PRK06125         77 AEAGDIDILVNNAGAI-PGGSLDDVDDAAWRAGWELKVFGYINLTRLFYPRMKARGSGVIVNVIGAAGENPDAGYICGSA  155 (259)
T ss_pred             HHHCCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHH
T ss_conf             9858998999768778-998645499999999999863437889999999765349819999942133788876489999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH------------------CCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             999999999999998544386997553288379779844------------------14443245888899999999961
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA------------------MPAEDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~------------------~~~~~~~~~~~pediA~~v~fL~  232 (257)
                      +|+|+.+|||+||.|++++|||||+|+||+|+|+++.+.                  ....|.+|+++|||||+++.|||
T Consensus       156 sKaal~~ltr~lA~e~~~~gIrVNaV~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeiA~~v~fLa  235 (259)
T PRK06125        156 GNAALMAFTRALGGKSLDDGIRVVGVNPGPVGTDRMLTLLKGRARAELGDESRWQELLAGLPLGRPATPREVADLVAFLA  235 (259)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999999999856678499998668888705777877777662388999999984799899788999999999995


Q ss_pred             CHH-HCCCCCEEEECCCCEECC
Q ss_conf             975-626685798768763154
Q gi|254780337|r  233 ATQ-KIETGKLFSVPQNRFVNY  253 (257)
Q Consensus       233 s~~-~~~tG~~~~vdgG~~~n~  253 (257)
                      |++ +|+|||+|.||||.....
T Consensus       236 Sd~ss~itG~~i~vDGG~ta~~  257 (259)
T PRK06125        236 SPRSGYTSGTVVTVDGGISARG  257 (259)
T ss_pred             CHHHCCCCCCEEEECCCCCCCC
T ss_conf             8053685385278680810388


No 76 
>PRK06500 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=440.00  Aligned_cols=231  Identities=27%  Similarity=0.364  Sum_probs=215.2

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +|+||+||||||++|||+++|++|+++|++|++++|++++++++.+++   +.++.++++|++|+++++++++++.++||
T Consensus         3 rl~gK~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l---~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g   79 (249)
T PRK06500          3 RLQGKTALITGGTSGIGLETARQFAAEGARVAITGRDAATLEAARAEL---GEDALVIRNDAGSVAAQRALAQALAEAGG   79 (249)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH---CCCEEEEEEECCCHHHHHHHHHHHHHHCC
T ss_conf             989988999376878999999999987999999969989999999985---89759999517999999999999999769


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      ++|+||||||+. ..+||+|++.|+|++++++|++|+|+++|+++|.|++  .|+||+++|.++..+.|+.++|++||+|
T Consensus        80 ~iDiLvnnAG~~-~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~p~m~~--~g~iI~~sS~~~~~~~~~~~aY~asKaa  156 (249)
T PRK06500         80 RLDAVFINAGVA-KFAPLEDWDEAMFDRSFNTNVKGPYFLIQALLPLLNN--PASIVLNGSINAHIGMPNSSVYAASKAA  156 (249)
T ss_pred             CCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCEEEEEECEEEECCCCCHHHHHHHHH
T ss_conf             998999899878-9999166999999999998645699999999998622--9818998223076168973778999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             99999999998544386997553288379779844--------------14443245888899999999961975-6266
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------------MPAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------------~~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      |.+|||++|.||+++|||||+|+||+|+|||+.+.              ....|.+|+++|||||++++||||++ +|+|
T Consensus       157 l~~ltk~lA~E~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~iPl~R~g~peeia~~v~fL~S~~as~iT  236 (249)
T PRK06500        157 LLSLAKTLSGELLPRGIRVNAVSPGPVQTPLYGKLGLSEADLEATAAQIQGLVPLGRFGTPEEIAKAVVFLASDESAFIV  236 (249)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999650495999997788977335531798010599999998379999985999999999999587422814


Q ss_pred             CCEEEECCCCEE
Q ss_conf             857987687631
Q gi|254780337|r  240 GKLFSVPQNRFV  251 (257)
Q Consensus       240 G~~~~vdgG~~~  251 (257)
                      ||+|.||||..|
T Consensus       237 G~~i~vDGG~sl  248 (249)
T PRK06500        237 GSEIIVDGGMGL  248 (249)
T ss_pred             CCEEEECCCCCC
T ss_conf             863888958130


No 77 
>PRK12746 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=439.63  Aligned_cols=235  Identities=27%  Similarity=0.377  Sum_probs=219.4

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999-78989999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .+|+||++|||||++|||+++|++|+++|++|+++ +|++++++++.++++..+.++.++++|++++++++++++++.++
T Consensus         2 ~~l~gKvalITGga~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~   81 (254)
T PRK12746          2 KNLDGKVALVTGASRGIGRAIAMRLANDGALVAIHYGRNKAAADETIREIESNGGKAFLIEADLNSIDGVKKLVEQLKNE   81 (254)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             69999889994847689999999999879999996599989999999999855992899975779999999999999999


Q ss_pred             H------CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCH
Q ss_conf             1------8987998768758888886765999999999999899999999999999860898699978835647889836
Q gi|254780337|r   93 W------GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG  166 (257)
Q Consensus        93 ~------g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~  166 (257)
                      |      |++|+||||||+. ..++++++++|+|++++++||+++|+++|+++|+|++  .|+|||++|.++..+.++..
T Consensus        82 ~~~~~g~g~iDiLVnnAg~~-~~~~~~~~~~~~~~~~~~vNl~~~f~~~k~~~p~m~~--~G~IVnisS~~~~~~~~~~~  158 (254)
T PRK12746         82 LQIRVGTSEIDILVNNAGIG-TQGTIENTTEEIFDEIMAVNIKAPFFLIQQTLPLLRA--EGRVINISSAEVRLGFTGSI  158 (254)
T ss_pred             HHHHCCCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCEEEEECHHHCCCCCCCH
T ss_conf             86641689851899799788-9999144999999999998534689999999999861--69669992432335788737


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC----------CCCCCCCCCHHHHHHHHHHHHCHH-
Q ss_conf             889899999999999999854438699755328837977984414----------443245888899999999961975-
Q gi|254780337|r  167 AYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP----------AEDPNTVPHPQKVAKIISFLCATQ-  235 (257)
Q Consensus       167 ~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~----------~~~~~~~~~pediA~~v~fL~s~~-  235 (257)
                      +|++||+||.+|||++|.||+++|||||+|+||+++|+|..+...          ..+.+|+++|+|||+++.||+|++ 
T Consensus       159 ~Y~asKaal~~ltr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~lgR~g~p~dia~~v~FL~S~~s  238 (254)
T PRK12746        159 AYGLSKGALNTMTLPLAKHLGERGITVNTIMPGYTKTDINAKLLDDPEIRNFATNSSVFGRIGQVEDIADAVAFLASSDS  238 (254)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHH
T ss_conf             78999999999999999996513989999878989863343304999999999727997897599999999999958632


Q ss_pred             HCCCCCEEEECCCCEE
Q ss_conf             6266857987687631
Q gi|254780337|r  236 KIETGKLFSVPQNRFV  251 (257)
Q Consensus       236 ~~~tG~~~~vdgG~~~  251 (257)
                      +|+|||+|.||||..|
T Consensus       239 ~~iTG~~l~VDGG~~l  254 (254)
T PRK12746        239 RWVTGQIIDVSGGFCL  254 (254)
T ss_pred             CCEECCEEEECCCCCC
T ss_conf             3840885887958478


No 78 
>PRK12937 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=438.44  Aligned_cols=233  Identities=27%  Similarity=0.408  Sum_probs=217.1

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEC-CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             5248899999389986889999999988998999978-989999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGR-SISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r-~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      |++.||+||||||++|||+++|++|+++|++|+++++ +.+.++++.+++++.+.++..+++|++|+++++++++++.++
T Consensus         1 M~~sgK~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~v~~~~~~   80 (245)
T PRK12937          1 MTDSNKVAIVTGASRGIGAAIARRLAADGFAVAVNYAGSAAMADELVEEIEAAGGRAIAVQADVADAAAVDRLFEAAETA   80 (245)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             99999889994857789999999999879999997699868999999999965995899983789999999999999998


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      ||++|+||||||+. ...++.++++|+|++++++|++++|+++|++.|+|++  +|+||||+|.++..+.|++++|++||
T Consensus        81 ~g~iDilVnNAg~~-~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~--~G~IInisS~~~~~~~~~~~~Y~asK  157 (245)
T PRK12937         81 FGRIDVLVNSAGIM-PLAPIADGDLEGFDRTIAVNLRGAFNVLGEAARHLRR--GGRIINLSTSVIARALPGYGPYAASK  157 (245)
T ss_pred             HCCCCEEEEECCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCEEEEEEECHHCCCCCCCHHHHHHH
T ss_conf             19988999805489-9988134999999999999859999999999999972--88299997300057899948899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCE
Q ss_conf             9999999999998544386997553288379779844---------14443245888899999999961975-6266857
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKL  242 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~  242 (257)
                      +|+.+|||+||.||+++|||||+|+||+++|+|+.+.         ....|.+|+++|||||+++.||||++ +|+|||+
T Consensus       158 aav~~ltk~lA~el~~~gIrVN~I~PG~i~T~~~~~~~~~e~~~~~~~~~Pl~R~g~pedia~~v~fL~S~~a~~iTG~~  237 (245)
T PRK12937        158 AAVEGLVHVLANELRGRGITVNAVAPGPTATELFFNGKSPEQIDQLARLAPLERLGEPDEIAAAVAFLAGPDGAWVNGQV  237 (245)
T ss_pred             HHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             99999999999996051929999976458875543679999999998569999983999999999999687024913873


Q ss_pred             EEECCCC
Q ss_conf             9876876
Q gi|254780337|r  243 FSVPQNR  249 (257)
Q Consensus       243 ~~vdgG~  249 (257)
                      |.||||.
T Consensus       238 i~VDGG~  244 (245)
T PRK12937        238 LRVNGGF  244 (245)
T ss_pred             EEECCCC
T ss_conf             6857790


No 79 
>PRK08628 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=439.22  Aligned_cols=237  Identities=23%  Similarity=0.363  Sum_probs=215.8

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+|+|+||++|||||++|||+++|++|+++|++|++++|+.+. .++.+++...+.++.++.+|++|+++++++++++.+
T Consensus         1 M~~~l~gKvalVTG~s~GIG~a~a~~la~~Ga~v~i~~~~~~~-~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~v~~~~~   79 (258)
T PRK08628          1 MDLNLKDKVVIVTGGASGIGAAISLRLAEEGAIPVVFGRSAPD-DEFAEELRALQPRAEFVQVDLQDDAQCRDAVAQTVA   79 (258)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCH-HHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             9999799989992777789999999999879989998088023-999999995399789999527999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +||++|+||||||+. ...+ .|.+.|+|++++++|++++|+++|+++|+|++++ |+||||+|.+++.+.|+.++|++|
T Consensus        80 ~~g~iDiLVnnAGi~-~~~~-~e~~~e~~~~~~~~Nl~~~~~l~~~~~p~l~~~~-GsIInisS~~a~~~~~~~~~Y~as  156 (258)
T PRK08628         80 KFGRIDGLVNNAGVN-DGVG-LDAGRDAFVASLERNLIHYYVMAHYCLPHLKASR-GAIVNISSKTALTGQGGTSGYAAA  156 (258)
T ss_pred             HHCCCCEEEECCCCC-CCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEECHHCCCCCCCCHHHHHH
T ss_conf             829988999888227-8877-7899999999999874999999999999888549-549998122101679984889999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC--------------CCCC-CCCCCHHHHHHHHHHHHCHH-
Q ss_conf             9999999999999854438699755328837977984414--------------4432-45888899999999961975-
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP--------------AEDP-NTVPHPQKVAKIISFLCATQ-  235 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~--------------~~~~-~~~~~pediA~~v~fL~s~~-  235 (257)
                      |+||.+|||+||.||+++|||||+|+||++.|||.++...              ..|. +|+++|||||+++.||||++ 
T Consensus       157 Kaal~~ltr~lA~e~~~~gIRvNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~pl~~R~g~p~eiA~~v~FL~Sd~s  236 (258)
T PRK08628        157 KGAQLGLTREWAVALAKDGVRVNAVIPAEVMTPLYANWLATFDDPEAKLAKITRKIPLGHRMTTAEEIADTAVFLLSERA  236 (258)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHH
T ss_conf             99999999999999641195999998788987667988760478699999999549986788299999999999958343


Q ss_pred             HCCCCCEEEECCCCE-EC
Q ss_conf             626685798768763-15
Q gi|254780337|r  236 KIETGKLFSVPQNRF-VN  252 (257)
Q Consensus       236 ~~~tG~~~~vdgG~~-~n  252 (257)
                      +|+|||+|.||||.. ||
T Consensus       237 ~~iTG~~i~VDGG~v~l~  254 (258)
T PRK08628        237 SHTTGQWLFVDGGYVHLD  254 (258)
T ss_pred             CCCCCCEEEECCCEEECC
T ss_conf             493388799739888425


No 80 
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=100.00  E-value=0  Score=439.52  Aligned_cols=232  Identities=25%  Similarity=0.369  Sum_probs=215.8

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      ..|+|+||++|||||++|||+++|++|+++|++|++++|+.+++++        +.++..+.+|++|+++++++++++.+
T Consensus         2 ~~~~l~gK~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~l~~--------~~~~~~~~~Dv~~~~~v~~~~~~~~~   73 (253)
T PRK08220          2 NSMDFSGKTVWVTGAAQGIGYAVALAFVEAGAKVIGFDQAFEQLNE--------QYPFATFVLDVADAAAVAQVCQRLLA   73 (253)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHC--------CCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             9889999989995885689999999999879999999788778748--------99779999737999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +||++|+||||||+. ..+|+++++.|+|++++++|++++|+++|+++|+|+++++|+|||++|.++..|.|++++|++|
T Consensus        74 ~~g~iDilVnnAG~~-~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IV~isS~~~~~~~~~~~~Y~as  152 (253)
T PRK08220         74 ETGPLDVLVNVAGVL-RMGATDSLSDEDWQQTFAVNAGGVFNLSRAVMPQFRRQRGGAIVTVGSNAAHTPRIGMAAYGAS  152 (253)
T ss_pred             HCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHHCCCCCCHHHHHH
T ss_conf             739988899899878-9998044999999999999746389999999987777389659999747871868983889999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC------------------CCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             9999999999999854438699755328837977984414------------------4432458888999999999619
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP------------------AEDPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~------------------~~~~~~~~~pediA~~v~fL~s  233 (257)
                      |+|+.+|||+||.|++++|||||+|+||+|+|||+...+.                  ..|.+|+++|||||+++.||||
T Consensus       153 Kaal~~lt~~lA~el~~~gIrVN~V~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~iPl~R~~~p~diA~~v~fL~S  232 (253)
T PRK08220        153 KAALTSLTKCVGLELAPYGVRCNVVSPGSTDTDMQRTLWVDEDGEQQRIAGFPEQFKLGIPLGKIARPQEIANAVLFLAS  232 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             99999999999999543095999996088987445543248147899998659988558998898199999999999958


Q ss_pred             HH-HCCCCCEEEECCCCEEC
Q ss_conf             75-62668579876876315
Q gi|254780337|r  234 TQ-KIETGKLFSVPQNRFVN  252 (257)
Q Consensus       234 ~~-~~~tG~~~~vdgG~~~n  252 (257)
                      ++ +|+|||+|.||||..+-
T Consensus       233 ~~s~~itGq~i~vDGG~tlg  252 (253)
T PRK08220        233 DLASHITMQDIVVDGGATLG  252 (253)
T ss_pred             CHHCCCCCCEEEECCCCCCC
T ss_conf             54339248328899371029


No 81 
>PRK06123 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=436.32  Aligned_cols=234  Identities=26%  Similarity=0.315  Sum_probs=216.5

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEC-CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             48899999389986889999999988998999978-98999999999986499289998789999999999999999818
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGR-SISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r-~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +.||+||||||++|||+++|+.|+++|++|++++| +++.++++.++++..+.++.++++|++++++++++++.+.++||
T Consensus         1 m~nKvalITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G   80 (249)
T PRK06123          1 MMRKVMIITGASRGIGAATALLAAERGYAVCLNYLRNRDAAEAVVQAIRRQGGEALAVAADVADEADVLRLFEAVDRELG   80 (249)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             99988999686879999999999987998999808987899999999996499099998479999999999999999829


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCEEEEECCHHHCCCCCC-CHHHHH
Q ss_conf             9879987687588888867659999999999998999999999999998608---986999788356478898-368898
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH---CGRAIILSSGAAYKCRPL-WGAYSA  170 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~---~G~IInisS~~g~~~~~~-~~~Y~a  170 (257)
                      ++|+||||||+.....+++++++++|++++++|++++|+++|+++|+|++++   .|+||||+|.+++.+.|. +.+|++
T Consensus        81 ~iDiLVnNAG~~~~~~~~~~~~~~~w~~~~~vNl~~~~~~~~~~~~~m~~~~~g~~g~IInisS~~~~~~~~~~~~~Y~a  160 (249)
T PRK06123         81 RLDALVNNAGILEAQMRLEQMDAARLTRIFATNVVGSFLCAREAVKRMSTRHGGRGGAIVNVSSMAARLGSPGEYIDYAA  160 (249)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHCCCCCCCHHHHHH
T ss_conf             98789988855789997212999999999854069999999999999999708998379997447656589830687899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH---------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             99999999999999854438699755328837977984---------414443245888899999999961975-62668
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK---------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~---------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
                      ||+||.+|||+||.||+++|||||+|+||+++|+|...         .....|.+|+++|||||+++.||||++ +|+||
T Consensus       161 sKaav~~ltr~lA~ela~~gIrvN~IaPG~i~T~~~~~~~~~~~~~~~~~~ipl~R~g~pedvA~~v~fL~S~~s~~iTG  240 (249)
T PRK06123        161 SKGAIDTMTIGLAKEVAAEGIRVNAVRPGVIYTEIHASGGEPGRVDRVKAGIPMGRGGTAEEVARAILWLLSDEASYTTG  240 (249)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             99999999999999986559699999867897743212599799999985799899839999999999996862258658


Q ss_pred             CEEEECCCC
Q ss_conf             579876876
Q gi|254780337|r  241 KLFSVPQNR  249 (257)
Q Consensus       241 ~~~~vdgG~  249 (257)
                      |+|.|||||
T Consensus       241 q~i~VdGGq  249 (249)
T PRK06123        241 TFIDVSGGR  249 (249)
T ss_pred             CEEEECCCC
T ss_conf             557848999


No 82 
>PRK07985 oxidoreductase; Provisional
Probab=100.00  E-value=0  Score=436.14  Aligned_cols=237  Identities=26%  Similarity=0.324  Sum_probs=218.1

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC--HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             652488999993899868899999999889989999789--899999999998649928999878999999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS--ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~--~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      .-+|+||+||||||++|||+++|+.||++|++|++++|+  .+.++++.+.+++.|.++.++++|++|+++++.+++++.
T Consensus        44 ~GrL~gKvalVTGas~GIG~aiA~~lA~~GA~Vvi~~~~~~~~~a~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~lv~~~~  123 (294)
T PRK07985         44 SGRLKDRKALVTGGDSGIGRAAAIAYAREGADVAISYLPVEEEDAQDVKKIIEECGRKAVLLPGDLSDEKFARSLVHEAH  123 (294)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             77789997999172669999999999987999999429966678999999999729958999767899999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||++|+||||||......++.++++|+|+++|++|++++|+++|+++|+|++  +|+||||+|.+++.+.|+.++|++
T Consensus       124 ~~fG~iDiLVnnAG~~~~~~~~~~~s~e~~~~~~~vNl~g~~~~~qaa~p~m~~--gGsIInisS~~~~~~~p~~~~Y~a  201 (294)
T PRK07985        124 KALGGLDIMALVAGKQVAIPDIADLTSEQFQKTFAINVFALFWLTQEAIPLLPK--GASIITTSSIQAYQPSPHLLDYAA  201 (294)
T ss_pred             HHHCCCCEEEEECCCCCCCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHHCC--CCEEEEECCHHHCCCCCCCHHHHH
T ss_conf             985998889980666668888365899999999998653478888876776424--877999666465278887307799


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH----------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             99999999999999854438699755328837977984----------414443245888899999999961975-6266
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK----------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~----------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      ||+||.+|||+||.||+++|||||+|+||+|+|+|...          .....+.+|+++|||||++++||+|++ +|+|
T Consensus       202 sKaav~~lTrslA~Ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~peDIA~av~fLaS~~a~~IT  281 (294)
T PRK07985        202 TKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTALQISGGQTQDKIPQFGQQTPMKRAGQPAELAPVYVYLASQESSYVT  281 (294)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999965339299999638787710202799999999998569988993999999999999582436726


Q ss_pred             CCEEEECCCCEE
Q ss_conf             857987687631
Q gi|254780337|r  240 GKLFSVPQNRFV  251 (257)
Q Consensus       240 G~~~~vdgG~~~  251 (257)
                      ||+|.||||..+
T Consensus       282 Gq~i~VDGG~~l  293 (294)
T PRK07985        282 AEVHGVCGGEHL  293 (294)
T ss_pred             CCEEEECCCCCC
T ss_conf             722798876002


No 83 
>PRK07791 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=433.90  Aligned_cols=235  Identities=27%  Similarity=0.336  Sum_probs=213.9

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEC---------CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHH
Q ss_conf             248899999389986889999999988998999978---------98999999999986499289998789999999999
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGR---------SISQLEKLKNALQKINKKIDIFAFDLRDSNALELT   85 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r---------~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~   85 (257)
                      .|+||++|||||++|||+++|+.|+++|++|+++|+         +.+.++++.+++...|+++.++++|++|+++++++
T Consensus         3 ~L~GKvalVTGas~GIG~aiA~~lA~~GA~Vvi~D~~~~~~~~~~~~~~a~~~~~ei~~~g~~~~~~~~Dvsd~~~v~~~   82 (285)
T PRK07791          3 LLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPASGGAAQAVVDEITAAGGEAVANGDDIADWDQAANL   82 (285)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHH
T ss_conf             88998799928676899999999998699999983764312244567999999999997498399996899999999999


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC------CCEEEEECCHHHC
Q ss_conf             9999998189879987687588888867659999999999998999999999999998608------9869997883564
Q gi|254780337|r   86 KTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH------CGRAIILSSGAAY  159 (257)
Q Consensus        86 ~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~------~G~IInisS~~g~  159 (257)
                      ++++.++||+||+||||||+.. ..+|+++++|+|++++++||+|+|+++|++.|+|++++      .|+|||++|.+++
T Consensus        83 v~~~~~~fG~iDiLVNNAGi~~-~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~~g~~~~G~IInisS~~g~  161 (285)
T PRK07791         83 VDAAVETFGGLDVLVNNAGILR-DRMFANTSEEEWDAVIRVHLKGHFATLRHAAAYWRDQSKAGKAVDARIINTSSGAGL  161 (285)
T ss_pred             HHHHHHHHCCCCEEEECCCCCC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHC
T ss_conf             9999998399869997886678-887566999999999999838899999999999999864589984599996644537


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-----CCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             788983688989999999999999985443869975532883797798441-----444324588889999999996197
Q gi|254780337|r  160 KCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-----PAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       160 ~~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-----~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      .+.|+.++|++||+||.+|||+||.||+++|||||+|+||. .|+|....+     ...+..++.+|||||++++||||+
T Consensus       162 ~g~~~~~~Y~asKaav~~lTr~lA~Ela~~gIrVNaVaPg~-~t~~~~~~~~~~~~~~~~~~~~~~PedIA~~v~FLaSd  240 (285)
T PRK07791        162 QGSVGQANYSAAKAGIAALTLVAAAELGRYGVTVNAIAPAA-RTRMTETVFADMMAKPEDGFDAMAPENVSPLVVWLGSA  240 (285)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCC-CCCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             79998678999999999999999999631295999983778-88876334799874640036888999999999998174


Q ss_pred             H-HCCCCCEEEECCCCEE
Q ss_conf             5-6266857987687631
Q gi|254780337|r  235 Q-KIETGKLFSVPQNRFV  251 (257)
Q Consensus       235 ~-~~~tG~~~~vdgG~~~  251 (257)
                      + +|+|||+|.||||+..
T Consensus       241 ~asyITGq~l~VDGG~va  258 (285)
T PRK07791        241 ESRDVTGKVFEVEGGKIS  258 (285)
T ss_pred             CCCCCCCCEEEECCCEEE
T ss_conf             007877875997799377


No 84 
>PRK07856 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=436.62  Aligned_cols=233  Identities=22%  Similarity=0.319  Sum_probs=213.9

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      -|+|+|+||++||||+++|||+++|+.|+++|++|++++|++.++         .+.+..++++|++|+++++++++++.
T Consensus         1 ~M~~~l~~K~alITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~---------~~~~~~~~~~Dv~~~~~v~~~~~~~~   71 (254)
T PRK07856          1 AINLDLTGRVVLVTGGTRGVGAGISEAFLAAGATVVVCGRRAPEV---------DGRPAEFHACDIRDPDQVAALVDAIA   71 (254)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHC---------CCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             974235999899947676899999999998799999997985574---------89843999846999999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608-98699978835647889836889
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      ++||++|+||||||+. ...++.++++++|+++|++|++|+|+++|++.|+|++++ +|+||||+|.++.++.|+..+|+
T Consensus        72 ~~~g~iDilVnNAG~~-~~~~~~~~~~~~~~~~~~vNl~~~~~l~q~~~~~m~~~~~~G~IVnisS~~~~~~~~~~~~Y~  150 (254)
T PRK07856         72 ERHGRLDVLVNNAGGS-PYALAAEASPRFHEKIVELNLLAPLLVAQAANAVMQQQPGGGSIVNIGSVSGRRPSPGTAAYG  150 (254)
T ss_pred             HHHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHCCCCCCCHHHH
T ss_conf             9809988899889889-998813499999999999982899999999999999727997899945424327889728799


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             8999999999999998544386997553288379779844----------14443245888899999999961975-626
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
                      +||+||.+|||+||.||+++ ||||+|+||+|+|+|....          ....|.+|+++|||||+++.||||++ +|+
T Consensus       151 asKaal~~ltk~lA~e~a~~-IrVN~VaPG~i~T~~~~~~~~~~e~~~~~~~~iPlgR~g~pedvA~~v~fL~S~~s~~i  229 (254)
T PRK07856        151 AAKAGLLNLTTSLAVEWAPK-VRVNAVVVGLVETEQSELHYGDAEGIAAVAATVPLGRLATPADIGWACLFLASDAASYV  229 (254)
T ss_pred             HHHHHHHHHHHHHHHHHCCC-CEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCE
T ss_conf             99999999999999997799-88999975989771143315999999999837999997699999999999958721681


Q ss_pred             CCCEEEECCCCEECCC
Q ss_conf             6857987687631543
Q gi|254780337|r  239 TGKLFSVPQNRFVNYL  254 (257)
Q Consensus       239 tG~~~~vdgG~~~n~~  254 (257)
                      |||+|.||||.....|
T Consensus       230 TG~~i~VDGG~~~~~~  245 (254)
T PRK07856        230 SGANLEVHGGGEPPAF  245 (254)
T ss_pred             ECCEEEECCCCCCHHH
T ss_conf             0855788999993467


No 85 
>PRK08945 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=433.14  Aligned_cols=231  Identities=34%  Similarity=0.547  Sum_probs=219.0

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCC-CEEEEECCC--CCHHHHHHHHHHHHH
Q ss_conf             24889999938998688999999998899899997898999999999986499-289998789--999999999999999
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAFDL--RDSNALELTKTYIAK   91 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~-~~~~~~~Dv--~d~~~v~~~~~~~~~   91 (257)
                      .|+||++|||||++|||+++|++|+++|++|++++|+.++++++.+++++.+. +..++.+|+  +++++++++++.+.+
T Consensus        10 ~L~gK~~lITGas~GIG~aiA~~la~~Ga~Vil~~r~~~~l~~~~~el~~~~~~~~~~~~~d~~~~~~~~~~~~~~~i~~   89 (245)
T PRK08945         10 LLKDRIILVTGAGDGIGREAALTYARHGATVILLGRTEEKLEAVYDEIEAAGGPQPAIIPLDLLGATEQNYQDLADTIEE   89 (245)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             78979899948861899999999998799899996988999999999997479844899944675999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +||++|+||||||+.....|++++++++|++++++|++|+|+++|+++|.|++++.|+|||++|.+|..+.+++++|++|
T Consensus        90 ~~g~iD~lVnNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~p~m~~~~~G~Ii~isS~~g~~~~~~~~~Y~as  169 (245)
T PRK08945         90 QFGRLDGVLHNAGLLGELGPMEQQDPEVWQDVMQVNVNATFMLTQALLPLLLKSPAASLVFTSSSVGRQGRAFWGAYAVS  169 (245)
T ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
T ss_conf             80998799988875578988266999999998756759999999999999987799789997862106788886689999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEE
Q ss_conf             9999999999999854438699755328837977984414443245888899999999961975-6266857987
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSV  245 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~v  245 (257)
                      |+|+.+|||+||.||+++|||||+|+||+|+|+|+++.++.+++.++++|||||+++.||+|++ +|+|||+|.-
T Consensus       170 Kaal~~lt~~la~El~~~gIrVN~I~PG~v~T~m~~~~~~~~~~~~~~~pedIa~~v~fL~Sd~s~~itGq~i~a  244 (245)
T PRK08945        170 KFATEGMMQVLADEYQGTNLRVNCINPGATRTAMRASAYPGEDPQKLKTPEDIMPLYLYLMGDDSRRVNGQSFDA  244 (245)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCCCHHHCCCHHHHHHHHHHHHCCHHCCCCCCEEEC
T ss_conf             999999999999985756849999972888774145318976633269999999999999483017912226856


No 86 
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=436.02  Aligned_cols=230  Identities=27%  Similarity=0.363  Sum_probs=216.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      .+|+||++|||||++|||+++|+.|+++|++|++++|++++++++.+++++.|.++.++.||++|+++++++++++.++|
T Consensus         2 ksL~gKvalITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~   81 (238)
T PRK07666          2 ESLQGKNALITGAGRGIGRAVAIALAKEGVNVGLLARSEENLKAVAKEVEAEGVKAVIATADVSDYEEVTTAIETLKNGL   81 (238)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             89999989991637789999999999879989999899999999999999559927999930799999999999999981


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ..++++++++|+|+++++||++|+|+++|+++|+|++++.|+||||+|.+|+.+.|+.++|++||+
T Consensus        82 G~iDiLVNNAGi~-~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IInisS~ag~~~~~~~~~Y~aSK~  160 (238)
T PRK07666         82 GSIDILINNAGIS-KFGKFLELDVAEWEKIIQVNLMGVYYVTRAVLPSMIEQQSGDIINISSTAGQKGAPVTSAYSASKF  160 (238)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHCCCCCCCHHHHHHH
T ss_conf             9987899847457-999823399999999998962999999999999999749958999877777067999806999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-CCCCCCCCCCHHHHHHHHHHHHC-HH-HCCCCCEEE
Q ss_conf             9999999999985443869975532883797798441-44432458888999999999619-75-626685798
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-PAEDPNTVPHPQKVAKIISFLCA-TQ-KIETGKLFS  244 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-~~~~~~~~~~pediA~~v~fL~s-~~-~~~tG~~~~  244 (257)
                      |+.+||++||.|++++|||||+|+||+|+|||..... +...+.++.+|||||++|+|+++ +. .|+||..+-
T Consensus       161 av~glt~~la~El~~~gIrVn~v~PG~v~T~m~~~~~~~~~~~~~~~~PedVA~~vv~~l~~~~~~~i~~~~~~  234 (238)
T PRK07666        161 AVLGLTESLMMEVRKHNIRVTALTPSTVATDMAVDLGLTDGNPDKVMQPEDLAEFIVAQLKLNPRTFIKSAGLW  234 (238)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEECCCEEE
T ss_conf             99999999999854139699999858898624678777878830257999999999999839986377464030


No 87 
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=433.43  Aligned_cols=236  Identities=27%  Similarity=0.338  Sum_probs=219.6

Q ss_pred             ECCCCCEEEEECCCC--HHHHHHHHHHHHCCCEEEEEECCH-----------HHHHHHHHHHHHCCCCEEEEECCCCCHH
Q ss_conf             524889999938998--688999999998899899997898-----------9999999999864992899987899999
Q gi|254780337|r   14 VNLDNRLALVTGSSR--GIGYYTALELARSGAYVIACGRSI-----------SQLEKLKNALQKINKKIDIFAFDLRDSN   80 (257)
Q Consensus        14 ~~l~~K~alVTGas~--GIG~a~a~~la~~G~~Vi~~~r~~-----------~~l~~~~~~~~~~g~~~~~~~~Dv~d~~   80 (257)
                      |+|+||+||||||++  |||+++|+.|+++|++|++++|+.           +..+++.++++..+.++..+++|+++++
T Consensus         1 m~L~gKvalVTGasr~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~   80 (257)
T PRK12748          1 LPLMKKIAIVTGASRLNGIGAAICRVLAQKGIDIFFTYWSQYDKAMPWGMHDKEPFLLKEEIESYGVRCEMLEIDLSQSY   80 (257)
T ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHH
T ss_conf             99999889992889998549999999998799999970752554434234606799999999965982899984689999


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC
Q ss_conf             99999999999818987998768758888886765999999999999899999999999999860898699978835647
Q gi|254780337|r   81 ALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK  160 (257)
Q Consensus        81 ~v~~~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~  160 (257)
                      +++++++++.++||++|+||||||+.. .+++.++++|+|+++|++|++++|+++|++.|+|+++++|+|||++|.++..
T Consensus        81 ~~~~~~~~~~~~~G~iDiLVnnAg~~~-~~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~~~m~~~~~G~IInisS~~~~~  159 (257)
T PRK12748         81 SPNRLFYMVSERLGDPSILINNAAYST-HTRIEELDVEQLDKHYAVNVRATMLLSSLFAKQFASKTGGRIINLTSGQSLG  159 (257)
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHC
T ss_conf             999999999997499989998998899-9990559999999999998389999999999988653892799982278606


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHH-----HHHHCCCCCCCCCCCHHHHHHHHHHHHCHH
Q ss_conf             889836889899999999999999854438699755328837977-----984414443245888899999999961975
Q gi|254780337|r  161 CRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSM-----RAKAMPAEDPNTVPHPQKVAKIISFLCATQ  235 (257)
Q Consensus       161 ~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m-----~~~~~~~~~~~~~~~pediA~~v~fL~s~~  235 (257)
                      |.|+..+|++||+||.+|||+||.||+++|||||+|+||+++|++     .+...+..|.+|+++|||||+++.||+|++
T Consensus       160 ~~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~PlgR~g~pedia~~v~fL~S~~  239 (257)
T PRK12748        160 PMPDELAYAATKGAIEAFTKSLAPVLAEKGITVNAVNPGPTDTGWITEELKHHLVPKFPQGRVGEPVDAARLIAFLASEE  239 (257)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCH
T ss_conf             48760486999999999999999997230949999977878988889899999985799899859999999999994855


Q ss_pred             -HCCCCCEEEECCCCE
Q ss_conf             -626685798768763
Q gi|254780337|r  236 -KIETGKLFSVPQNRF  250 (257)
Q Consensus       236 -~~~tG~~~~vdgG~~  250 (257)
                       +|+|||+|.||||..
T Consensus       240 a~~iTG~~i~VDGG~s  255 (257)
T PRK12748        240 AKWITGQVIHSEGGFS  255 (257)
T ss_pred             HCCEECCEEEECCCCC
T ss_conf             3484085589775804


No 88 
>PRK07060 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=435.09  Aligned_cols=232  Identities=28%  Similarity=0.325  Sum_probs=211.9

Q ss_pred             CCEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             73265248899999389986889999999988998999978989999999999864992899987899999999999999
Q gi|254780337|r   10 SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        10 ~~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      ..|+|+|+||++|||||++|||+++|+.|+++|++|++++|++++++++.+++.     +..+++|+++++++++    +
T Consensus         1 m~m~~~l~gK~~lVTG~~~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~~-----~~~~~~Dv~~~~~v~~----~   71 (245)
T PRK07060          1 MNMAFDFSGKSVLVTGASSGIGRACAVALAARGARVVAAARNQADLDRLAGETG-----CEPLRLDVGDDAAIRA----A   71 (245)
T ss_pred             CCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC-----CEEEEEECCCHHHHHH----H
T ss_conf             999737999989994777689999999999879999999799899999998639-----8799980799999999----9


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHH
Q ss_conf             998189879987687588888867659999999999998999999999999998608-9869997883564788983688
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      .++||++|+||||||+. ...|+.++++|+|++++++|++++|+++|+++|.|++++ +|+||||+|.+++++.|+.++|
T Consensus        72 ~~~~g~iDilVnnAG~~-~~~~~~~~~~e~~~~~~~vNl~~~~~~~k~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~Y  150 (245)
T PRK07060         72 LAGAGAFDGLVNCAGIA-SLESAIDMTAAGFDRVMAVNARGALLVARHVARAMIRAGRGGSIVNVSSQAALVGLPDHLAY  150 (245)
T ss_pred             HHHCCCCCEEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHH
T ss_conf             99659998999898879-99990139999999999997099999999999999980898079998664325789974789


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC----------CCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             9899999999999999854438699755328837977984414----------443245888899999999961975-62
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP----------AEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~----------~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      ++||+|+.+|||++|.||+++|||||+|+||+++|+|..+.++          ..|.+|+++|||||+++.||+|++ +|
T Consensus       151 ~asKaav~~ltkslA~el~~~gIRVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~pl~R~g~peeiA~~v~fL~S~~ss~  230 (245)
T PRK07060        151 CASKAALDAATRVLCVELGPHGIRVNSVNPTVTLTPMAEFAWSDPQKSEPMLAAIPLGRFAEVDDVAAPILFLLSDAASM  230 (245)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             99999999999999999610192999997698987667642489999999995599999788999999999995864258


Q ss_pred             CCCCEEEECCCCEE
Q ss_conf             66857987687631
Q gi|254780337|r  238 ETGKLFSVPQNRFV  251 (257)
Q Consensus       238 ~tG~~~~vdgG~~~  251 (257)
                      +|||+|.||||...
T Consensus       231 iTG~~i~VDGG~ta  244 (245)
T PRK07060        231 VSGVSLPVDGGYTA  244 (245)
T ss_pred             CCCCEEEECCCHHC
T ss_conf             14842886956316


No 89 
>PRK08278 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=434.52  Aligned_cols=235  Identities=20%  Similarity=0.274  Sum_probs=214.7

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH-------HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899-------99999999864992899987899999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQ-------LEKLKNALQKINKKIDIFAFDLRDSNALELTK   86 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~-------l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~   86 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|+.+.       ++++.+++++.|+++..+++|++|++++++++
T Consensus         2 m~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~l~~~~~~~a~e~~~~g~~~~~~~~Dv~~~~~v~~~v   81 (273)
T PRK08278          2 MSLSGKTLFITGASRGIGLAIALRAARDGANIVIAAKTAEPHPKLPGTIHTAAAEIEAAGGQALPLVGDVRDEDQVAAAV   81 (273)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHH
T ss_conf             89899989994876599999999999879989999677222133454899999999974990899971179999999999


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC--CC
Q ss_conf             9999981898799876875888888676599999999999989999999999999986089869997883564788--98
Q gi|254780337|r   87 TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCR--PL  164 (257)
Q Consensus        87 ~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~--~~  164 (257)
                      +++.++||++|+||||||+. ...++++++.++|++++++|++|+|+++|+++|+|++++.|+|||+||..+..+.  ++
T Consensus        82 ~~~~~~~G~iDiLVNNAG~~-~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IinisS~~~~~~~~~~~  160 (273)
T PRK08278         82 AKTVERFGGIDICVNNASAI-NLTGTEDTPMKRFDLMQGINVRGTFLVSQACLPHLKKSANPHILTLSPPLNLDPKWFAP  160 (273)
T ss_pred             HHHHHHHCCCCEEEECCCCC-CCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCC
T ss_conf             99999859962999878666-67507775189999999983559999998765676657997899988878746877788


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECC-CCCCCHHHHHHCCC-CCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             3688989999999999999985443869975532-88379779844144-43245888899999999961975-626685
Q gi|254780337|r  165 WGAYSASKAAIEALARTWSKETVNTALRVINIDP-GPTRTSMRAKAMPA-EDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       165 ~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~P-G~v~T~m~~~~~~~-~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      +.+|++||+|+.+|||++|.||+++|||||+|+| +.+.|++.++.... ++.+|+++|||||++++||||++ +|+|||
T Consensus       161 ~~aY~asKaal~~ltrslA~Ela~~gIrVNaVaP~~~~~t~~~~~~~~~~~~l~R~g~PediA~av~FL~Sd~as~iTGq  240 (273)
T PRK08278        161 HTAYTMAKYGMSLCTLGLAEEFREDGIAVNALWPRTMIATAAVQNLLGGDEAMRRSRTPEIMADAAHAILTRPAREFTGN  240 (273)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCHHHHHHCCCCCHHHCCCCHHHHHHHHHHHHCCHHHCCCCC
T ss_conf             47999999999999999999960309899997279817689998410472122146788999999999938753285486


Q ss_pred             EEEECCCCE
Q ss_conf             798768763
Q gi|254780337|r  242 LFSVPQNRF  250 (257)
Q Consensus       242 ~~~vdgG~~  250 (257)
                      ++ ||+|-+
T Consensus       241 ~l-V~~~~~  248 (273)
T PRK08278        241 FL-IDEEVL  248 (273)
T ss_pred             EE-EHHHHH
T ss_conf             88-623579


No 90 
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=435.86  Aligned_cols=223  Identities=22%  Similarity=0.365  Sum_probs=204.4

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +|+||++|||||++|||+++|++|+++|++|+.++|+...         ....++.++++|++|+.     ++++.++||
T Consensus         2 dl~gK~alVTGas~GIG~aia~~~a~~Ga~V~~~d~~~~~---------~~~~~~~~~~~Dv~~~~-----v~~~~~~~g   67 (237)
T PRK06550          2 EFMTKTVLVTGAASGIGLAQARAFLEQGAHVYGVDKSDKP---------DLSGNFHFIQLDLSSDK-----LEPLFKVVP   67 (237)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH---------HCCCCEEEEECCCCHHH-----HHHHHHHCC
T ss_conf             9899899993747799999999999879999997086124---------30697389986388899-----999999759


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      ++|+||||||+.....|++++++|+|++++++||+|+|+++|+++|+|+++++|+|||++|.+|..+.++.++|++||+|
T Consensus        68 ~iDiLvNnAGi~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IVnisS~~g~~~~~~~~~Y~asKaa  147 (237)
T PRK06550         68 SVDILCNTAGILDDYKPLLDTSDEEWQHIFDINLFSTFLLTRAYLPQMLEKKSGVIINMCSIAGFVAGGGGVAYTASKHA  147 (237)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHCCCCCCCHHHHHHHHH
T ss_conf             99799989888999999055999999999999729999999999999998099189995463435579986889999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-----------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCE
Q ss_conf             999999999985443869975532883797798441-----------4443245888899999999961975-6266857
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-----------PAEDPNTVPHPQKVAKIISFLCATQ-KIETGKL  242 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-----------~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~  242 (257)
                      |.+|||+||.||+++|||||+|+||+|+|||..+.+           ...|.+|+++|||||+++.||||++ +|+|||+
T Consensus       148 l~~lTrslA~ela~~gIrVNaVaPG~i~T~m~~~~~~~~~~~~~~~~~~~Pl~R~g~p~eiA~~v~FLaSd~as~iTG~~  227 (237)
T PRK06550        148 LAGFTKQLALDYAKDGIQVFGIAPGAIKTPMNAADFAEPGGMADWVARETPIKRWAEPEEVAELTLFLASGKADYMQGTI  227 (237)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             99999999999650195999997688987320100359699999998569999978899999999999585533814862


Q ss_pred             EEECCCCEE
Q ss_conf             987687631
Q gi|254780337|r  243 FSVPQNRFV  251 (257)
Q Consensus       243 ~~vdgG~~~  251 (257)
                      |.||||..+
T Consensus       228 i~VDGG~t~  236 (237)
T PRK06550        228 VPIDGGWTL  236 (237)
T ss_pred             EEECCCCCC
T ss_conf             896827308


No 91 
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=431.66  Aligned_cols=234  Identities=27%  Similarity=0.318  Sum_probs=218.7

Q ss_pred             CCCCCEEEEECCCC--HHHHHHHHHHHHCCCEEEEEE-----------CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             24889999938998--688999999998899899997-----------89899999999998649928999878999999
Q gi|254780337|r   15 NLDNRLALVTGSSR--GIGYYTALELARSGAYVIACG-----------RSISQLEKLKNALQKINKKIDIFAFDLRDSNA   81 (257)
Q Consensus        15 ~l~~K~alVTGas~--GIG~a~a~~la~~G~~Vi~~~-----------r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~   81 (257)
                      +|+||+||||||++  |||+++|++|+++|++|++++           ++.++..++++++.+.+.++..+++|++++++
T Consensus         3 ~L~gKvalVTGas~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dl~~~~~   82 (257)
T PRK12859          3 QLKNKVAVVTGVSRLDGIGAAICKELAEAGYDIFFTYWTAYDKEMPWGVDQSEQIQLQEELLKNGVKVSSMELDLTQNDA   82 (257)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHH
T ss_conf             88988899928899986299999999987998999836520111234537579999999999549859999835899999


Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC
Q ss_conf             99999999998189879987687588888867659999999999998999999999999998608986999788356478
Q gi|254780337|r   82 LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC  161 (257)
Q Consensus        82 v~~~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~  161 (257)
                      ++.+++++.++||.+|+||||||+. ...||.+++.|+|++++++|++++|+++|++.|+|+++++|+||||+|.+++.+
T Consensus        83 ~~~~i~~~~~~~g~iDilVnnAg~~-~~~~~~~~~~e~~~~~~~vN~~~~~~~~~~~~~~m~~~~~G~IInisS~~~~~~  161 (257)
T PRK12859         83 PKELINKVTEQLGYPHILINNAAYS-TNNDFSNLTAEELDKHYMVNIRATTLLSSQFARGFDKKSGGRIVNMTSGQFQGP  161 (257)
T ss_pred             HHHHHHHHHHHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCC
T ss_conf             9999999999829998999899999-999905599999999999983578999999999875537953999942686076


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHH-----HHHCCCCCCCCCCCHHHHHHHHHHHHCHH-
Q ss_conf             898368898999999999999998544386997553288379779-----84414443245888899999999961975-
Q gi|254780337|r  162 RPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMR-----AKAMPAEDPNTVPHPQKVAKIISFLCATQ-  235 (257)
Q Consensus       162 ~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~-----~~~~~~~~~~~~~~pediA~~v~fL~s~~-  235 (257)
                      .|++++|++||+||.+|||+||.||+++|||||+|+||+++|++.     +...+..|.+|+++|||||+++.||||++ 
T Consensus       162 ~~~~~~Y~asKaal~~ltrslA~ela~~gIrVN~V~PG~~~T~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~FL~S~~a  241 (257)
T PRK12859        162 MVGELAYATTKGAIDALTSTLSAEVAHLGITVNAINPGPTDTGWMTEEIKQGLKPMFPFGRIGEPKDAARLIKFLVSEEA  241 (257)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHH
T ss_conf             87617789999999999999999985519189999768789787799999989857998998599999999999958552


Q ss_pred             HCCCCCEEEECCCC
Q ss_conf             62668579876876
Q gi|254780337|r  236 KIETGKLFSVPQNR  249 (257)
Q Consensus       236 ~~~tG~~~~vdgG~  249 (257)
                      +|+|||+|.||||.
T Consensus       242 ~~iTGq~i~VDGG~  255 (257)
T PRK12859        242 EWITGQVIHSEGGF  255 (257)
T ss_pred             CCEECCEEEECCCC
T ss_conf             58618758968796


No 92 
>PRK09730 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=431.69  Aligned_cols=231  Identities=27%  Similarity=0.296  Sum_probs=213.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9999938998688999999998899899997-898999999999986499289998789999999999999999818987
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~-r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      |+||||||++|||+++|++|+++|++|++++ ++.+.++++.+++++.|.++.+++||++|+++++++++++.++||++|
T Consensus         2 KValITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~i~~~~g~id   81 (247)
T PRK09730          2 AIALVTGGSRGIGRATALLLAQEGYTVAVNYQQNLHAAQEVVNLITQAGGKAFVLQADISDENQVVAMFTAIDQHDEPLA   81 (247)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             79999062269999999999987999999669987899999999997499289998258999999999999999759955


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCEEEEECCHHHCCCCCCC-HHHHHHHH
Q ss_conf             9987687588888867659999999999998999999999999998608---9869997883564788983-68898999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH---CGRAIILSSGAAYKCRPLW-GAYSASKA  173 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~---~G~IInisS~~g~~~~~~~-~~Y~asKa  173 (257)
                      +||||||+.....+++++++|+|++++++||+|+|+++|++.|+|++++   .|+|||++|.+++.+.|+. .+|++||+
T Consensus        82 ~LVNNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~~~~~~~g~IVnisS~~~~~g~~~~~~~Y~asKa  161 (247)
T PRK09730         82 ALVNNAGILFTQCTVENLTAERINRVLSTNVTGYFLCCREAVKRMALKNGGSGGAIVNVSSVASRLGSPGEYVDYAASKG  161 (247)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHCCCCCCCHHHHHHHHH
T ss_conf             99989863568998133999999999999738999999999999999628999769998126546589841277799999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEE
Q ss_conf             999999999998544386997553288379779844---------14443245888899999999961975-62668579
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF  243 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~  243 (257)
                      ||.+|||+||.||+++|||||+|+||+|+|+|....         ....|.+|+++|||||+++.||||++ +|+|||+|
T Consensus       162 av~~ltk~lA~ela~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~Sd~a~~iTGq~i  241 (247)
T PRK09730        162 AIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASGGEPGRVDRVKSNIPMQRGGQAEEVAQAIVWLLSDKASYVTGSFI  241 (247)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEE
T ss_conf             99999999999970549289999778897854323499699999985799899849999999999996872248348347


Q ss_pred             EECCCC
Q ss_conf             876876
Q gi|254780337|r  244 SVPQNR  249 (257)
Q Consensus       244 ~vdgG~  249 (257)
                      .||||+
T Consensus       242 ~VDGG~  247 (247)
T PRK09730        242 DLAGGK  247 (247)
T ss_pred             EECCCC
T ss_conf             857999


No 93 
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=431.64  Aligned_cols=236  Identities=24%  Similarity=0.324  Sum_probs=213.7

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             652488999993899868899999999889989999789-8999999999986499289998789999999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      .++|+||++|||||++|||+++|+.|+++|++|++++++ .+.++++.++++..|.++.++.+|++|+++++++++.+ +
T Consensus         4 ~~dL~GKvalVTGas~GIGraiA~~lA~~GA~Vvi~d~~~~~~~~~~~~ei~~~G~~~~~~~~Dvsd~~~v~~lv~~~-~   82 (303)
T PRK07792          4 TTDLSGKVAVVTGAAAGLGRAEALGLARLGATVVVNDIASALDASDVLDEIRAAGAKAVAVAGDISQRATADELVATA-D   82 (303)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH-H
T ss_conf             756899989992886689999999999869999997189724799999999844993899966768999999999999-9


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-------CCEEEEECCHHHCCCCCC
Q ss_conf             8189879987687588888867659999999999998999999999999998608-------986999788356478898
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-------CGRAIILSSGAAYKCRPL  164 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-------~G~IInisS~~g~~~~~~  164 (257)
                      +||+||+||||||+.. ..+++++++|+|+++++|||+|+|+++|++.|+|+++.       +|+|||++|.+++.+.++
T Consensus        83 ~~G~iDiLVNNAGi~~-~~~~~~~t~e~wd~v~~vNL~g~f~~~r~a~~~m~~~~~~~~g~~~G~IInisS~ag~~g~~g  161 (303)
T PRK07792         83 GLGGLDIVVNNAGITR-DRMLFNMSDEEWDAVIAVHLRGHFLLTRNAAAYWRAKAKEAGGPVYGRIVNTSSEAGLVGPVG  161 (303)
T ss_pred             HHCCCCEEEECCCCCC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHCCCCCC
T ss_conf             8399969998885567-876100999999999988738999999999999999745169986349999744765668998


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCC---C--CCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             368898999999999999998544386997553288379779844144432---4--5888899999999961975-626
Q gi|254780337|r  165 WGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDP---N--TVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       165 ~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~---~--~~~~pediA~~v~fL~s~~-~~~  238 (257)
                      +++|++||+|+.+|||++|.||+++|||||+|+||. .|+|..+.+...+.   .  +...|||||++++||+|++ +|+
T Consensus       162 ~~~Y~AsKagv~~lTrslA~Ela~~gIRVNaIaP~a-~t~~~~~~~~~~~~~~~~~~~p~~PeeVA~~v~fLaSd~as~I  240 (303)
T PRK07792        162 QANYGAAKAGITALTLSAARALGRYGVRANAICPRA-RTAMTADVFGDAPDVAAGGIDPLSPEHVVTLVQFLASPAAAGV  240 (303)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCC-CCHHHHHHHHHCHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCC
T ss_conf             588999999999999999999855196999989999-8702244420177779757799999999999999739100698


Q ss_pred             CCCEEEECCCCEE
Q ss_conf             6857987687631
Q gi|254780337|r  239 TGKLFSVPQNRFV  251 (257)
Q Consensus       239 tG~~~~vdgG~~~  251 (257)
                      |||+|.||||+..
T Consensus       241 TGq~l~VdGG~v~  253 (303)
T PRK07792        241 NGQLFIVYGPQVT  253 (303)
T ss_pred             CCCEEEECCCEEE
T ss_conf             7987998699999


No 94 
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=430.11  Aligned_cols=233  Identities=18%  Similarity=0.234  Sum_probs=216.1

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-C-CCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             899999389986889999999988998999978989999999999864-9-92899987899999999999999998189
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-N-KKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g-~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      ||+||||||++|||+++|++|+++|++|++++|+.++++++.+++... + .++..+++|++|+++++++++++.++||+
T Consensus         2 nKvalITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~   81 (259)
T PRK12384          2 NKVAVVIGGGQTLGAFLCHGLAEEGYRVAVADINSEKAANVAQEINAEYGEGMAYGFGADATSEQSVLALSRGVDEIFGR   81 (259)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             97899946886899999999998799999997988999999999986248860899983279999999999999998299


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             879987687588888867659999999999998999999999999998608-9869997883564788983688989999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      +|+||||||+. ...|+++++.++|++++++|++|+|+++|++.|+|++++ .|+|||++|.+++.+.+..++|++||+|
T Consensus        82 iDilVnnAG~~-~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~Iv~isS~~~~~~~~~~~~Y~asK~a  160 (259)
T PRK12384         82 VDLLVYSAGIA-KAAKITDFQLGDFDRSLQVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFG  160 (259)
T ss_pred             CCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCHHHHHHHH
T ss_conf             71999899777-88991459999999999988644223467763689973898459998352545588543067999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCC-CCCCHHHHHHC-------------------CCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             9999999999854438699755328-83797798441-------------------444324588889999999996197
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPG-PTRTSMRAKAM-------------------PAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG-~v~T~m~~~~~-------------------~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      +.+|||+||.||+++|||||+|+|| .++|||++...                   ...|.+|+++|||||+++.||||+
T Consensus       161 l~~ltk~lA~e~a~~gIrVN~I~PG~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~p~diA~~v~fL~S~  240 (259)
T PRK12384        161 GVGLTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLLPQYAKKLGIKPDEVEQYYIDKVPLKRGCDYQDVLNMLLFYASP  240 (259)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             99999999999623197999983887156766666558788772999899999998479989996999999999999585


Q ss_pred             H-HCCCCCEEEECCCCEE
Q ss_conf             5-6266857987687631
Q gi|254780337|r  235 Q-KIETGKLFSVPQNRFV  251 (257)
Q Consensus       235 ~-~~~tG~~~~vdgG~~~  251 (257)
                      + +|+|||+|.||||++|
T Consensus       241 ~a~~iTG~~i~vDGG~~m  258 (259)
T PRK12384        241 KASYCTGQSINVTGGQVM  258 (259)
T ss_pred             HHCCCCCCEEEECCCHHH
T ss_conf             633803872898978331


No 95 
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=426.26  Aligned_cols=241  Identities=22%  Similarity=0.309  Sum_probs=222.7

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999-789899999999998-6499289998789999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQ-KINKKIDIFAFDLRDSNALELTKTY   88 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~-~~g~~~~~~~~Dv~d~~~v~~~~~~   88 (257)
                      .|+.+|+||++|||||++|||+++|+.|+++|++|+++ +++++.++++.++++ +++.++.++++|++|++++++++++
T Consensus         1 ~M~~~L~gK~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dv~~~~~~~~~~~~   80 (260)
T PRK08416          1 NMNNEMKGKTLVISGGTRGIGKAIVYEFAQSGVNIAFTYNSNVEEADKIAQDLEKKYGIKARAYPLNILEPETYKELFKK   80 (260)
T ss_pred             CCCCCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             98877899989996734099999999999879999998599889999999999884198369997788999999999999


Q ss_pred             HHHHHCCCCEEEECCCCCC-----CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC
Q ss_conf             9998189879987687588-----88886765999999999999899999999999999860898699978835647889
Q gi|254780337|r   89 IAKRWGKLDILIANAGILG-----SISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRP  163 (257)
Q Consensus        89 ~~~~~g~iDilVNNAGi~~-----~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~  163 (257)
                      +.++||++|+||||||+..     .+.++.+++.++|++++++|+.+++.++|.+.|+|+++++|+|||++|.++..+.|
T Consensus        81 i~~~~g~iDilVnnA~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~~~~~GsIv~isS~~~~~~~~  160 (260)
T PRK08416         81 IDADFDRVDFFISNAIISGRAVVGGYTKFMRLKPKGLNNIYTATVLAFVVGAQEAAKRMEKVGGGSIISLSSTGNLVYIE  160 (260)
T ss_pred             HHHHHCCCCEEEECCEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCC
T ss_conf             99981997899864342276423577746659899999999999899999999999999970990899976544566798


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             8368898999999999999998544386997553288379779844----------144432458888999999999619
Q gi|254780337|r  164 LWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       164 ~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s  233 (257)
                      +.++|++||+|+.+|||+||.||+++|||||+|+||+++|+|....          ....|.+|+++|||||+++.||||
T Consensus       161 ~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fL~S  240 (260)
T PRK08416        161 NYAGHGTSKAAVEAMVRYAATELGEKNIRVNAVSGGPIDTDALKAFTNYEEVKAKTEELSPLNRMGQPEDLAGACLFLCS  240 (260)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             51778988889999999999998455959999973779866665169849999999857998998199999999999948


Q ss_pred             HH-HCCCCCEEEECCCCEE
Q ss_conf             75-6266857987687631
Q gi|254780337|r  234 TQ-KIETGKLFSVPQNRFV  251 (257)
Q Consensus       234 ~~-~~~tG~~~~vdgG~~~  251 (257)
                      ++ +|+|||+|.||||...
T Consensus       241 ~~ss~iTG~~i~VDGG~t~  259 (260)
T PRK08416        241 EKASWLTGQTIIVDGGTTF  259 (260)
T ss_pred             CHHCCCCCCEEEECCCEEC
T ss_conf             5426865983898977548


No 96 
>PRK12747 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=429.03  Aligned_cols=233  Identities=30%  Similarity=0.351  Sum_probs=215.6

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH-
Q ss_conf             488999993899868899999999889989999-789899999999998649928999878999999999999999981-
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW-   93 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~-   93 (257)
                      |+||+||||||++|||+++|++|+++|++|+++ ++++++++++.+++++.+.++..+.+|++++++++.+++.+.+++ 
T Consensus         2 L~gKvalITGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~   81 (252)
T PRK12747          2 LKGKVALVTGASRGIGRAIAKRLANDGALVAIHYGNRKEEAEETVYEIQSNGGSAFSIGANLESLHGVEALYSSLDNELQ   81 (252)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf             89599999484778999999999987999999659987899999999996499579983363567999999999999999


Q ss_pred             -----CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             -----898799876875888888676599999999999989999999999999986089869997883564788983688
Q gi|254780337|r   94 -----GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        94 -----g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                           +++|+||||||+. +..+++++++|+|++++++|++|+|+++|+++|+|+++  |+||||+|.++..+.|++++|
T Consensus        82 ~~~g~~~iDiLVnnAG~~-~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~--g~IVnisS~~~~~~~~~~~~Y  158 (252)
T PRK12747         82 KRTGSTKFDILINNAGIG-PGAFIEETTEQFFDRMVSVNAKAPFFIIQQALSRLRDN--SRIINISSAATRISLPDFIAY  158 (252)
T ss_pred             HHCCCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCEEEECCCCCCCCCCHHH
T ss_conf             842899810899899999-99881349999999999997568999999999999766--975089851112688972778


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC----------CCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             98999999999999998544386997553288379779844144----------43245888899999999961975-62
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA----------EDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~----------~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      ++||+|+.+|||++|.||+++|||||+|+||+|+|+|..+..+.          .+.+|+++|||||+++.||||++ +|
T Consensus       159 ~asKaav~~ltr~lA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~p~~R~g~p~dvA~~v~fL~S~~a~~  238 (252)
T PRK12747        159 SMTKGAINTMTFTLAKQLGARGITVNAILPGFIKTDMNAELLSDPMMKQYATTISAFNRLGEVEDIADTAAFLASPDSRW  238 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             99999999999999999733395998887775987322111278999999864788799859999999999995844338


Q ss_pred             CCCCEEEECCCCEE
Q ss_conf             66857987687631
Q gi|254780337|r  238 ETGKLFSVPQNRFV  251 (257)
Q Consensus       238 ~tG~~~~vdgG~~~  251 (257)
                      +|||+|.||||.+|
T Consensus       239 iTG~~i~VDGG~~L  252 (252)
T PRK12747        239 VTGQLIDVSGGSCL  252 (252)
T ss_pred             CCCCEEEECCCCCC
T ss_conf             22883748988789


No 97 
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=425.51  Aligned_cols=237  Identities=22%  Similarity=0.267  Sum_probs=215.8

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      +|+.+|+||+||||||++|||+++|++|+++|++|++++|++ .++++.+++...+.++..+++|++++++++++++++.
T Consensus         1 mM~~~l~gKvalITGas~GIG~aiA~~la~~Ga~V~~~~r~~-~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~   79 (260)
T PRK12823          1 MMNQRFAGKVAVVTGAAQGIGRGVALRAAAEGARVVLVDRSE-LVHEVAAELVAAGGEALALTADLETYAGAQAVMAAAV   79 (260)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             988887999899948867899999999998799999996946-8999999998549948999812688589999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||++|+||||||......|+++++.++|++++++|++++|+++|+++|+|+++++|+|||++|.++.  .+...+|++
T Consensus        80 ~~~G~iDiLVnnag~~~~~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~p~m~~~~~G~Ii~isS~~~~--~~~~~~Y~a  157 (260)
T PRK12823         80 EAFGRIDVLINNVGGTIWAKPFEEYEEEQIEAEIRRSLFPTLWCCRAVLPHMLAQGGGAIVNVSSIATR--GINRVPYSA  157 (260)
T ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECHHHCC--CCCCCHHHH
T ss_conf             983998799977522457898265999999999999854068999999999998169679998202205--887512699


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHH---------------------HHCCCCCCCCCCCHHHHHHHHH
Q ss_conf             9999999999999985443869975532883797798---------------------4414443245888899999999
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRA---------------------KAMPAEDPNTVPHPQKVAKIIS  229 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~---------------------~~~~~~~~~~~~~pediA~~v~  229 (257)
                      ||+|+.+|||+||.||+++|||||+|+||+++||+..                     +.....|.+|+++|||||+++.
T Consensus       158 sKaal~~ltr~lA~ela~~gIrVN~I~PG~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~R~g~peevA~~v~  237 (260)
T PRK12823        158 AKGGVNALTASLAFEYAEHGIRVNAVAPGGTEAPPRRVPRNAAPQSEQEKAWYQQIVDQTLDSSLMKRYGTIDEQVAAIL  237 (260)
T ss_pred             HHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
T ss_conf             99999999999999961529699999358677633332101343346678789999999863699889869999999999


Q ss_pred             HHHCHH-HCCCCCEEEECCCCE
Q ss_conf             961975-626685798768763
Q gi|254780337|r  230 FLCATQ-KIETGKLFSVPQNRF  250 (257)
Q Consensus       230 fL~s~~-~~~tG~~~~vdgG~~  250 (257)
                      ||||++ +|+|||+|.||||++
T Consensus       238 fL~S~~s~~iTG~~i~VDGG~~  259 (260)
T PRK12823        238 FLASDEASYITGSVLPVGGGDL  259 (260)
T ss_pred             HHHCCHHCCCCCCEEEECCCCC
T ss_conf             9958542480478688685989


No 98 
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=427.55  Aligned_cols=233  Identities=21%  Similarity=0.281  Sum_probs=215.1

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             4889999938998688999999998899899997-898999999999986499289998789999999999999999818
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~-r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      |+||+||||||++|||+++|++|+++|++|++++ |+.+.++++.+++++.+.++.++++|++++++++++++++.++||
T Consensus         1 L~gKvalITGgs~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~g   80 (249)
T PRK06077          1 LKDKVVVVTGSGRGIGRAIAVRLAKEGAKVVVNAKKRAEEMNETLRMVKEYGGEGIGVLADVSTREGCRTLAKAALDNFG   80 (249)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             96198999263678999999999987998999848876899999999997599589998479999999999999999819


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      ++|+||||||+. ...||++.++++|+++|++|++++|+++|+++|+|++  .|+|||++|.+++.+.|+.++|++||+|
T Consensus        81 ~iDiLVnNAG~~-~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~--~G~IInisS~~~~~~~~~~~~Y~asKaa  157 (249)
T PRK06077         81 VVDILVNNAGLG-LFSPFLNADDRLIEKHISTDLKSVIYCSQEAAKVMRE--GGEIINIASIAGIRPFVGLSIYGAMKAA  157 (249)
T ss_pred             CCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCEEEECCCHHHCCCCCCCHHHHHHHHH
T ss_conf             988899857757-8875010999999999988621899999999999616--9789982676545689997789999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC-----------C-CCCCCCCCHHHHHHHHHHHHCHHHCCCCCE
Q ss_conf             9999999999854438699755328837977984414-----------4-432458888999999999619756266857
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP-----------A-EDPNTVPHPQKVAKIISFLCATQKIETGKL  242 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~-----------~-~~~~~~~~pediA~~v~fL~s~~~~~tG~~  242 (257)
                      +.+|||+||.||+++ ||||+|+||+|+|+|.+....           . .+.+|+++|||||++++||||++ ++|||+
T Consensus       158 l~~ltr~lA~ela~~-IrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~R~~~peeia~~v~fLas~~-~iTGq~  235 (249)
T PRK06077        158 VINLTQYLALELAPR-IRVNAVAPGVVKTKMGESLVKLLGMTEEEFAKKHTLTGKILDPEDVAELVWALVKIE-SITGQV  235 (249)
T ss_pred             HHHHHHHHHHHHCCC-CEEEEEEECCCCCCHHHHHHHCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCC-CCCCCE
T ss_conf             999999999998699-889999846898742555554048678999860798789739999999999996458-999883


Q ss_pred             EEECCCCEECC
Q ss_conf             98768763154
Q gi|254780337|r  243 FSVPQNRFVNY  253 (257)
Q Consensus       243 ~~vdgG~~~n~  253 (257)
                      |.||||+.+..
T Consensus       236 i~VDGG~~l~g  246 (249)
T PRK06077        236 IVIDSGESLKG  246 (249)
T ss_pred             EEECCCHHHHC
T ss_conf             88682656458


No 99 
>PRK07074 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=424.59  Aligned_cols=229  Identities=23%  Similarity=0.282  Sum_probs=210.6

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      +||++|||||++|||+++|++|+++|++|++++|++++++++.+++.  +.++..+.||++|+++++.+++.+ ++||++
T Consensus         1 TnKvalITGgs~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~l~--~~~~~~~~~Dv~~~~~~~~~~~~i-~~~g~i   77 (256)
T PRK07074          1 TSRTALVTGAAGGIGQALARRFLAAGDRVLALDIDRAALAAFVDALG--DAAVAPVICDLTDAASVERLAAAL-ANEGPV   77 (256)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC--CCCEEEEEEECCCHHHHHHHHHHH-HHHCCC
T ss_conf             99889998846899999999999869999999798899999999826--997799997279999999999999-985998


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      |+||||||+. ...++.++++|+|++++++||+|+|+++|+++|.|+++++|+||||+|.++..+. +.++|++||+|+.
T Consensus        78 DiLVNNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~~~~~~-~~~~Y~asKaal~  155 (256)
T PRK07074         78 DVLVANAGAA-RAATLHDTTSASWRADNALNLEATYLCVEAVEAGMKARSRGAIVNIGSVNGMAAL-GHPAYSAAKAGLI  155 (256)
T ss_pred             CEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCC-CCHHHHHHHHHHH
T ss_conf             7999888778-9989155999999999999859999999999999987599769999665656768-8578999999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-----------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEE
Q ss_conf             9999999985443869975532883797798441-----------4443245888899999999961975-626685798
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-----------PAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFS  244 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-----------~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~  244 (257)
                      +|||+||.||+++|||||+|+||+++|||++...           ...|.+|+++|||||+++.||||++ +|+|||+|.
T Consensus       156 ~ltk~lA~e~~~~gIrVN~VaPG~i~T~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedIA~~v~FLaS~~as~iTG~~i~  235 (256)
T PRK07074        156 SYTKSLAIEYGRFGIRANAVCPGTVKTQAWEARVAANPQVFEELKKWYPLQDFATPDDVANAVLFLASPAARAITGVCLP  235 (256)
T ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             99999999964249799998427798736664322499999999847998898699999999999958053593587388


Q ss_pred             ECCCCE
Q ss_conf             768763
Q gi|254780337|r  245 VPQNRF  250 (257)
Q Consensus       245 vdgG~~  250 (257)
                      ||||..
T Consensus       236 VDGG~t  241 (256)
T PRK07074        236 VDGGLT  241 (256)
T ss_pred             ECCCHH
T ss_conf             588700


No 100
>PRK07069 short chain dehydrogenase; Validated
Probab=100.00  E-value=0  Score=424.89  Aligned_cols=229  Identities=24%  Similarity=0.319  Sum_probs=211.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH-HHHHHHHHHHCCC--CEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9993899868899999999889989999789899-9999999986499--289998789999999999999999818987
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQ-LEKLKNALQKINK--KIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~-l~~~~~~~~~~g~--~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      ||||||++|||+++|+.|+++|++|++++|+.++ ++++.++++...+  .+..+++|++|+++++++++++.++||+||
T Consensus         2 AlVTGgs~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iD   81 (251)
T PRK07069          2 AFITGAAGGLGRAIARRMAEQGARVFLTDINDAAALDAFAAEINAAHGEGVAFAAVQDVTDEAQWQALLAQAADAMGGLS   81 (251)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             79985578899999999998699999996894358999999998615996399995779999999999999999829998


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             99876875888888676599999999999989999999999999986089869997883564788983688989999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      +||||||+. ...+++++++++|++++++|++|+|+++|+++|+|+++++|+||||+|.+++.+.|+.++|++||+|+.+
T Consensus        82 ilVNnAGi~-~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaal~~  160 (251)
T PRK07069         82 VLVNNAGVG-SFGAIEQIELDEWRRVMAINVESIVLGCKHALPYLRASQPASIVNISSVAAFKAEPDYTAYNASKAAVAS  160 (251)
T ss_pred             EEEECCCCC-CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             999899999-9999034999999999999978999999999999996699789992867545779996689999999999


Q ss_pred             HHHHHHHHHHHHC--CEEEEECCCCCCCHHHHHHC-------------CCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             9999999854438--69975532883797798441-------------4443245888899999999961975-626685
Q gi|254780337|r  178 LARTWSKETVNTA--LRVINIDPGPTRTSMRAKAM-------------PAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       178 lt~~la~E~~~~g--Irvn~I~PG~v~T~m~~~~~-------------~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      |||+||.||+++|  ||||+|+||+++|||.+...             ...|.+|+++|||||++++||||++ +|+||+
T Consensus       161 ltk~lA~el~~~gi~IrvN~i~Pg~i~T~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~Sd~s~~iTG~  240 (251)
T PRK07069        161 LTKSIALDCARRGLDVRCNSIHPAFIRTGIVDPIFRRLGEEEATRKLARGIPLGRLGEPDDVAHAVLYLASDESRFVTGA  240 (251)
T ss_pred             HHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999877199689999886868863557887613849999999857999998589999999999958542482586


Q ss_pred             EEEECCCCE
Q ss_conf             798768763
Q gi|254780337|r  242 LFSVPQNRF  250 (257)
Q Consensus       242 ~~~vdgG~~  250 (257)
                      +|.||||..
T Consensus       241 ~i~VDGG~t  249 (251)
T PRK07069        241 ELVIDGGMC  249 (251)
T ss_pred             EEEECCCHH
T ss_conf             177382463


No 101
>PRK05717 oxidoreductase; Validated
Probab=100.00  E-value=0  Score=427.74  Aligned_cols=233  Identities=24%  Similarity=0.314  Sum_probs=214.1

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      .+|+||+||||||++|||+++|++|+++|++|++++|++++++++.+++   +.++.++++|++|+++++++++++.++|
T Consensus         6 ~~l~GKvalITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~---~~~~~~~~~Dvt~~~~v~~~i~~~~~~~   82 (255)
T PRK05717          6 PGHNGRVALVTGAARGIGLGIAAWLIAEGWQVVLADLDRERGAKVAKAL---GENAWFIAMDVADEAQVAAGVAEVLGQF   82 (255)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH---CCCEEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             8999988999587888999999999987998999969889999999984---8975899930799999999999999982


Q ss_pred             CCCCEEEECCCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             898799876875888-8886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGS-ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~-~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |+||+||||||+... ..|++++++++|++++++||+|+|+++|++.|+|++++ |+|||++|.++..+.|+.++|++||
T Consensus        83 G~id~lvnNAg~~~~~~~~l~~~~~~~w~~~~~vNl~g~f~~~k~~~~~m~~~~-G~IInisS~~~~~~~~~~~~Y~asK  161 (255)
T PRK05717         83 GRLDALVCNAAIANPHNTTLESLSLAQWNRVLAVNLGGPMLLAKHCAPYLRAHN-GAIVNLASTRARQSEPDTEAYAASK  161 (255)
T ss_pred             CCCCEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHCC-CCEEEEEECCCCCCCCCCHHHHHHH
T ss_conf             999899987730578999835599999999999860426577664319887479-9869997601454789837679999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH---------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCE
Q ss_conf             999999999999854438699755328837977984---------414443245888899999999961975-6266857
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK---------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKL  242 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~---------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~  242 (257)
                      +||.+|||++|.||+++ ||||+|+||+++|++...         .....|.+|+++|||||+++.||||++ +|+|||+
T Consensus       162 aal~~ltkslA~e~a~~-IRvN~I~PG~i~t~~~~~~~~~~~~~~~~~~~Pl~R~g~~edia~~v~fL~S~~ss~iTGq~  240 (255)
T PRK05717        162 GGLLALTHALAISLGPE-IRVNAVSPGWIDARDPSQRRAEPLSEADHAQHPAGRVGTVEDVAAMVAWLLSRNAGFVTGQE  240 (255)
T ss_pred             HHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCHHHHCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             99999999999997799-98999962718888745524646899998479978981999999999999677214815983


Q ss_pred             EEECCCCEE
Q ss_conf             987687631
Q gi|254780337|r  243 FSVPQNRFV  251 (257)
Q Consensus       243 ~~vdgG~~~  251 (257)
                      |.||||...
T Consensus       241 i~VDGG~t~  249 (255)
T PRK05717        241 FVVDGGMTR  249 (255)
T ss_pred             EEECCCHHH
T ss_conf             897989400


No 102
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=428.01  Aligned_cols=236  Identities=22%  Similarity=0.276  Sum_probs=214.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             524889999938998688999999998899899997898-9999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSI-SQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~-~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      |+|+||++|||||++|||+++|+.|+++|++|++++|+. +.++++.+   +.+.++..+++|++|+++++++++++.++
T Consensus         2 ~~L~gK~alVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~---~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~   78 (254)
T PRK08642          2 MDISEQIVLVTGGSRGLGAAIARAFAREGARVVVNYHRSEDAAEALAD---ELGDRAIAIQADVTDRNQVDAMFATATEH   78 (254)
T ss_pred             CCCCCCEEEEECHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHH---HHCCCEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             898989999978111999999999998799999961898899999999---81994699980699999999999999999


Q ss_pred             HCC-CCEEEECCCCCC-----CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCH
Q ss_conf             189-879987687588-----88886765999999999999899999999999999860898699978835647889836
Q gi|254780337|r   93 WGK-LDILIANAGILG-----SISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG  166 (257)
Q Consensus        93 ~g~-iDilVNNAGi~~-----~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~  166 (257)
                      ||+ +|+|||||++..     ...++.+++.|+|++++++|++++|+++|+++|+|+++++|+|||++|.++..+.+.+.
T Consensus        79 ~G~~idilVnnA~~~~~~~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~~~~~~~m~~~~~G~IinisS~~~~~~~~~~~  158 (254)
T PRK08642         79 FGKPITTVVNNALADFSFDGDARPKAEDITWEDFQQQLEGAVKGALNTIQAALPGMRERGFGRIINIGTNLFQNPVVPYH  158 (254)
T ss_pred             HCCCCEEEEECCEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHCCCCCCCH
T ss_conf             49977699867642245687666893459999999999999999999999999977874899668860033158887603


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH---------HCCCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             889899999999999999854438699755328837977984---------414443245888899999999961975-6
Q gi|254780337|r  167 AYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK---------AMPAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       167 ~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~---------~~~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      +|++||+||.+|||+||.||+++|||||+|+||+++|++...         .....|.+|+++|||||+++.||||++ +
T Consensus       159 ~Y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~t~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~v~fL~S~~as  238 (254)
T PRK08642        159 DYTAAKAALLSLTRTLAADLGPYGITVNMVSGGLLRTTDASAATPEEVFDLIAATTPLRRVTTPQEFADAVLFFASPWSR  238 (254)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             77899999999999999997133969988745554676655569899999998479989995999999999999481536


Q ss_pred             CCCCCEEEECCCCEEC
Q ss_conf             2668579876876315
Q gi|254780337|r  237 IETGKLFSVPQNRFVN  252 (257)
Q Consensus       237 ~~tG~~~~vdgG~~~n  252 (257)
                      |+|||+|.||||.+||
T Consensus       239 ~iTGq~i~VDGG~~mn  254 (254)
T PRK08642        239 AVTGQNLVVDGGLVMN  254 (254)
T ss_pred             CEECCEEEECCCCCCC
T ss_conf             8208748967081159


No 103
>PRK12744 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=425.40  Aligned_cols=237  Identities=22%  Similarity=0.324  Sum_probs=212.5

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC----HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             2652488999993899868899999999889989999789----899999999998649928999878999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS----ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKT   87 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~----~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~   87 (257)
                      .+.+|+||++|||||++|||+++|++|+++|++|++++++    ++.++++..+++..+.++.++++|++++++++++++
T Consensus         2 ~~~~L~gKvalVTGgs~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~   81 (257)
T PRK12744          2 ADHSLKGKVVLIAGGAKNLGGLIARDLAAQGAKAVAIHYNSAATKADAEETVAAVKAAGAKAVAFQADLTTAAAVEKLFD   81 (257)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH
T ss_conf             99998999899928875899999999998799899993787436899999999999739928999768899999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHH
Q ss_conf             99998189879987687588888867659999999999998999999999999998608986999788356478898368
Q gi|254780337|r   88 YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA  167 (257)
Q Consensus        88 ~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~  167 (257)
                      ++.++||+||+||||||+. ...|++++++++|++++++|++++|+++|++.|+|++  .|+|||++|.++....|++++
T Consensus        82 ~~~~~~G~iDilVnnAG~~-~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~--~G~ii~i~ss~~~~~~~~~~~  158 (257)
T PRK12744         82 DAKAAFGRPDIAINTVGKV-LKKPIVEISEAEYDEMFAVNSKSAFFFIKEAGRHLND--NGKIVTLVTSLLGAFTPFYSA  158 (257)
T ss_pred             HHHHHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCEEEEEECHHHCCCCCHHH
T ss_conf             9999809988999766445-6772333228888889888876699999999998741--894999981154467895188


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------------CCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             898999999999999998544386997553288379779844--------------144432458888999999999619
Q gi|254780337|r  168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------------MPAEDPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       168 Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------------~~~~~~~~~~~pediA~~v~fL~s  233 (257)
                      |++||+|+.+|||+||.||+++|||||+|+||+|+|||....              ....++.++++|||||+++.||+|
T Consensus       159 Y~asKaav~~ltr~lA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pedia~~v~fLaS  238 (257)
T PRK12744        159 YAGSKAPVEHFTRAASKEFGARGISVTAVGPGPMDTPFFYPQEGAEAVAYHKTAAALSPFSKTGLTDIEDIVPFIRFLVT  238 (257)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             99999999999999999965449699999638898776576557045777778886287688999999999999999947


Q ss_pred             HHHCCCCCEEEECCCCEE
Q ss_conf             756266857987687631
Q gi|254780337|r  234 TQKIETGKLFSVPQNRFV  251 (257)
Q Consensus       234 ~~~~~tG~~~~vdgG~~~  251 (257)
                      +++|+|||+|.||||...
T Consensus       239 da~~iTGq~i~VDGG~T~  256 (257)
T PRK12744        239 DGWWITGQTILINGGYTT  256 (257)
T ss_pred             CCCCCCCCEEEECCCEEC
T ss_conf             588832983897948017


No 104
>PRK06523 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=427.11  Aligned_cols=231  Identities=24%  Similarity=0.339  Sum_probs=208.9

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      ..+|+|+||+||||||++|||+++|++|+++|++|++++|+..+         ..+..+.++++|++++++++++++++.
T Consensus         2 ~~~l~L~gK~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~---------~~~~~~~~~~~Dv~~~~~v~~~v~~~~   72 (260)
T PRK06523          2 SDDLELAGKRALVTGGTKGIGAATVARFREAGARVVTTARSRPD---------DLPEGVEFVAADLTTAEGCAAVARAVL   72 (260)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCC---------CCCCCCEEEECCCCCHHHHHHHHHHHH
T ss_conf             98738999989994757699999999999879999999488401---------379862899837999999999999999


Q ss_pred             HHHCCCCEEEECCCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCC-CHHH
Q ss_conf             98189879987687588-888867659999999999998999999999999998608986999788356478898-3688
Q gi|254780337|r   91 KRWGKLDILIANAGILG-SISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL-WGAY  168 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~-~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~-~~~Y  168 (257)
                      ++||++|+||||||... +.++++++++|+|++++++|++++|+++|+++|+|+++++|+|||++|.++..+.|. ..+|
T Consensus        73 ~~~g~iDiLVnNAG~~~~~~~~~~~~~~~~w~~~~~~Nl~~~~~~~q~~~p~m~~~~~G~IinisS~~~~~~~~~~~~~Y  152 (260)
T PRK06523         73 ERLGGVDILVHVLGGSSAPAGGFAALTDEEWQDELNLNLLAAVRLDRALLPAMIARGSGVIIHVTSIQRRLPLPESTTAY  152 (260)
T ss_pred             HHCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCCCCCCCHHH
T ss_conf             97499979998998876799880319999999999998499999999999999983998669995522146888650889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------------------CCCCCCCCCCCHHHHHH
Q ss_conf             98999999999999998544386997553288379779844----------------------14443245888899999
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------------------MPAEDPNTVPHPQKVAK  226 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------------------~~~~~~~~~~~pediA~  226 (257)
                      +++|+|+.+|||+||.||+++|||||+|+||+|+||+....                      ....|.+|+++|||||+
T Consensus       153 ~asKaal~~ltk~lA~e~~~~gIrvN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iPlgR~g~peeiA~  232 (260)
T PRK06523        153 AAAKAALSTYSKSLSKEVAPKGVRVNRVSPGWIETEAAVALAERLAEAAGTDYEGAKQIIMDSLGGIPLGRPAEPEEVAE  232 (260)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHH
T ss_conf             99999999999999999734392999996488987527889999987618998999999998527889889759999999


Q ss_pred             HHHHHHCHH-HCCCCCEEEECCCCE
Q ss_conf             999961975-626685798768763
Q gi|254780337|r  227 IISFLCATQ-KIETGKLFSVPQNRF  250 (257)
Q Consensus       227 ~v~fL~s~~-~~~tG~~~~vdgG~~  250 (257)
                      ++.||||++ +|+|||+|.||||..
T Consensus       233 ~v~FL~Sd~s~~iTG~~i~VDGG~~  257 (260)
T PRK06523        233 LIAFLASDRAASITGTEYVIDGGTV  257 (260)
T ss_pred             HHHHHHCCHHCCEECCEEEECCCCC
T ss_conf             9999948442686085578878895


No 105
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=423.52  Aligned_cols=236  Identities=27%  Similarity=0.353  Sum_probs=215.9

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++++.+.++.+++||++|+++++++++++.++|
T Consensus         1 m~L~gK~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~   80 (253)
T PRK08217          1 MDLKDKVIVITGGAQGLGRAMAEYLAQKGAKLALIDLNQEKLEEAVAQCAALGGEAEVYAANVTDEEDVEATFAQIAEDF   80 (253)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             97899889994887789999999999879989999799999999999999659948999824799999999999999983


Q ss_pred             CCCCEEEECCCCCCC--------CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCC
Q ss_conf             898799876875888--------88867659999999999998999999999999998608-986999788356478898
Q gi|254780337|r   94 GKLDILIANAGILGS--------ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPL  164 (257)
Q Consensus        94 g~iDilVNNAGi~~~--------~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~  164 (257)
                      |++|+||||||+...        ..++++++.++|++++++|++++|+++|+++|.|++++ +|+|||+||.+ ..+.++
T Consensus        81 g~iD~lVnNAGi~~~~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~~g~Ii~isS~~-~~~~~~  159 (253)
T PRK08217         81 GQLNGLINNAGILRDGLLVKAKDGKVTSKMSLEQFQSVIDVNLTGVFLCGREAAAKMIESGSKGVIINISSIA-RAGNMG  159 (253)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHH-CCCCCC
T ss_conf             9985999857436776644466665201199999999999981789999999999999848972799963311-138888


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH--------HCCCCCCCCCCCHHHHHHHHHHHHCHHH
Q ss_conf             36889899999999999999854438699755328837977984--------4144432458888999999999619756
Q gi|254780337|r  165 WGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK--------AMPAEDPNTVPHPQKVAKIISFLCATQK  236 (257)
Q Consensus       165 ~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~--------~~~~~~~~~~~~pediA~~v~fL~s~~~  236 (257)
                      .++|++||+|+.+|||+||.|++++|||||+|+||+|+|+|...        .....|.+|+++|||||+++.||+|+ +
T Consensus       160 ~~~Y~asKaal~~ltk~lA~el~~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~pl~R~g~p~dva~~v~fL~s~-~  238 (253)
T PRK08217        160 QTNYSASKAGVAAMTVTWAKELARYGIRVAAIAPGVIETEMTAAMKPEALERLEKMIPVGRLGEPEEIAHTVRFIIEN-D  238 (253)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHC-C
T ss_conf             616899999999999999999532195999997388987331117999999998579999984999999999999958-9


Q ss_pred             CCCCCEEEECCCCEE
Q ss_conf             266857987687631
Q gi|254780337|r  237 IETGKLFSVPQNRFV  251 (257)
Q Consensus       237 ~~tG~~~~vdgG~~~  251 (257)
                      |+|||+|.||||..+
T Consensus       239 ~iTG~~i~VDGG~~l  253 (253)
T PRK08217        239 YVTGRVLEIDGGLRL  253 (253)
T ss_pred             CCCCCEEEECCCCCC
T ss_conf             988996786968309


No 106
>PRK07775 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=424.42  Aligned_cols=235  Identities=23%  Similarity=0.341  Sum_probs=218.3

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      .+++|+|||||||+|||+++|++|+++|++|++++|+.++++++.+++++.|+++..+.+|++|+++++++++++.++||
T Consensus         7 ~~~~KtAlVTGAssGIG~aiA~~la~~G~~V~l~~R~~e~l~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G   86 (275)
T PRK07775          7 HPARRPAIVAGASSGIGAATAIELAAHGFPVALGARRVEKCEEIVDKIRADGGEAVAFPLDVTDPDSVKSFVAQATEALG   86 (275)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             99999799946235999999999998799899998989999999999996499489999128999999999999999859


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      ++|+||||||+. ..+++.+++.++|++++++|++|+|+++|+++|.|++++.|+||||+|.+++.+.|++++|++||+|
T Consensus        87 ~iDiLVnNAG~~-~~~~~~e~~~e~~~~~~~vNl~g~~~~~~a~lP~M~~~~~G~IV~isS~a~~~~~p~~~~Y~AsKaa  165 (275)
T PRK07775         87 DIEVLVSGAGDT-YFGKLHEISTEQFESQVQIHLVGANRLATAVLPGMVERRRGDLIFVGSDVALRQRPHMGAYGAAKAG  165 (275)
T ss_pred             CCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCCCCCCHHHHHHHHH
T ss_conf             965999767568-8886010999999999988527999999999999997599579998447650689998059999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC--------------CCCCCCCCCHHHHHHHHHHHHC-HH-HCC
Q ss_conf             9999999999854438699755328837977984414--------------4432458888999999999619-75-626
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP--------------AEDPNTVPHPQKVAKIISFLCA-TQ-KIE  238 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~--------------~~~~~~~~~pediA~~v~fL~s-~~-~~~  238 (257)
                      +.+||++|+.|++++|||||+|+||+|+|+|.....+              .....++.+|||||++|.||+| ++ .|+
T Consensus       166 v~~lt~~La~El~~~gIrVn~V~PG~v~T~m~~~~~~~~~~~~~~~~~~~~~~~~~~~l~pedIA~av~flas~P~~~~i  245 (275)
T PRK07775        166 LVAMVTNLQMELEGTGVRASIVHPGPTKTSMGWSLPAEQIGPALEDWAKWGQARHDYFLRASDLARAITFVAETPRGGFI  245 (275)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCC
T ss_conf             99999999998565690899997268818898887866640577888874112566898999999999999669984537


Q ss_pred             CCCEEEECCCCE
Q ss_conf             685798768763
Q gi|254780337|r  239 TGKLFSVPQNRF  250 (257)
Q Consensus       239 tG~~~~vdgG~~  250 (257)
                      ||..|.+|||.-
T Consensus       246 ~~~~l~p~ggla  257 (275)
T PRK07775        246 VNMELQPEAPLA  257 (275)
T ss_pred             CCEEEEECCCCC
T ss_conf             687999777511


No 107
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated
Probab=100.00  E-value=0  Score=424.06  Aligned_cols=235  Identities=20%  Similarity=0.307  Sum_probs=214.7

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|+.|+++|++|+..++++.  ++..++++..+.++..+++|++++++++++++++.++|
T Consensus         6 ~~L~gK~alITGas~GIG~aia~~la~~Ga~Vv~~~~~~~--~~~~~~~~~~~~~~~~~~~D~~~~~~v~~~~~~~~~~~   83 (253)
T PRK08993          6 FSLEGKVAVVTGCDTGLGQGMALGLAEAGCDIVGINIVEP--TETIEQVTALGRRFLSLTADLRKIDGIPALLERAVAEF   83 (253)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCH--HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             3999998999388768999999999987999999558774--99999999659957999803799999999999999984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             8987998768758888886765999999999999899999999999999860-898699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS-HCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~-~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |++|+||||||+.. ..++.++++++|++++++|++++|+++|.++|+|.++ ++|+|||++|.++..+.+..++|++||
T Consensus        84 G~iDilVnnAG~~~-~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~~~~~~~~G~IvnisS~~~~~~~~~~~~Y~asK  162 (253)
T PRK08993         84 GHIDILVNNAGLIR-REDAIEFSEKDWDDVMNLNIKSVFFMSQAAAKHFIAQGNGGKIINIASMLSFQGGIRVPSYTASK  162 (253)
T ss_pred             CCCEEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCHHHHHHH
T ss_conf             99729998997788-99801299999999999885443566787689999727788523898610036889865679999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCC
Q ss_conf             9999999999998544386997553288379779844----------14443245888899999999961975-626685
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGK  241 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~  241 (257)
                      +|+.+|||+||.||+++|||||+|+||+++|++....          ....|.+|+++|||||+++.||||++ +|+|||
T Consensus       163 aal~~ltr~lA~e~a~~gIrVN~I~PG~v~T~~~~~~~~~~~~~~~~~~~~p~~R~g~peeiA~~v~fL~S~~a~~iTG~  242 (253)
T PRK08993        163 SGVMGVTRLMANEWAKHNINVNAIAPGYMATNNTQQLRADEQRSAEILDRIPAGRWGLPSDLMGPVVFLASSASDYINGY  242 (253)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999999996233959999964878677554303798999999955999998199999999999958432282585


Q ss_pred             EEEECCCCEE
Q ss_conf             7987687631
Q gi|254780337|r  242 LFSVPQNRFV  251 (257)
Q Consensus       242 ~~~vdgG~~~  251 (257)
                      +|.||||.+.
T Consensus       243 ~i~VDGG~~a  252 (253)
T PRK08993        243 TIAVDGGWLA  252 (253)
T ss_pred             EEEECCCCCC
T ss_conf             3898957125


No 108
>PRK08324 short chain dehydrogenase; Validated
Probab=100.00  E-value=0  Score=420.74  Aligned_cols=235  Identities=27%  Similarity=0.354  Sum_probs=216.0

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ..|+||+||||||++|||+++|++|+++|++|+++||+.++++++.+++.. ++++..+.||++|+++++++++++.++|
T Consensus       417 ~~L~GKVALVTGga~GIG~A~A~~fa~eGA~Vvl~D~~~~~l~~~a~el~~-~~~~~~~~~DVtd~~~v~~~v~~~~~~f  495 (676)
T PRK08324        417 KPLAGKVALVTGAAGGIGLATAKRLAAEGACVVLADIDEEAAEAAAAELGG-RDRALGVACDVTDEAAVQAAFEEAALAF  495 (676)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHC-CCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             888998799947988162999999998799899995888999999999707-9947999806899999999999999985


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             898799876875888888676599999999999989999999999999986089-8699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHC-GRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~-G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |+||+||||||+. ..+++.++++++|++++++|++|+|+++|++.|+|++|+. |+|||++|..+..+.|+.++|++||
T Consensus       496 GgIDiLVnNAGi~-~~~~~~e~s~e~w~~~~~vNl~g~f~~~r~a~p~M~~qg~GG~IV~isS~~a~~~~~~~~aY~asK  574 (676)
T PRK08324        496 GGVDIVVSNAGIA-LSGPIGETSDELWRRSFEVNFTGHFLVAREAVRIMKAQGTGGNLVFIASKNAVNPGPNFGAYSAAK  574 (676)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHCCCCCCHHHHHHH
T ss_conf             9988899767778-998826599999999998860999999999999999769991999982577526799968999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCH--HHHHH----------------CCCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             99999999999985443869975532883797--79844----------------1444324588889999999996197
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTS--MRAKA----------------MPAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~--m~~~~----------------~~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      +|+.+|||++|.||+++|||||+|+||.|.|+  ++...                ....+.+|+++|||||++++||+|+
T Consensus       575 AAl~~Ltr~lA~Ela~~GIRVNaV~Pg~V~t~~~~~~~~~~~~ra~a~g~~~e~y~~~~~L~R~~~peDVA~av~fLASd  654 (676)
T PRK08324        575 AAELHLVRQYALELGPDGIRVNGVNPDAVRSGSGIWTGEWIEARAAAYGLSEEEYMARNLLKREVTPEDVAEAFVFLASD  654 (676)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHCCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             99999999999997122969999857964778755773346888875599989996059889967899999999998480


Q ss_pred             H-HCCCCCEEEECCCCE
Q ss_conf             5-626685798768763
Q gi|254780337|r  235 Q-KIETGKLFSVPQNRF  250 (257)
Q Consensus       235 ~-~~~tG~~~~vdgG~~  250 (257)
                      . +|+||++|.||||-.
T Consensus       655 ~ss~iTG~~l~VDGG~~  671 (676)
T PRK08324        655 LLAKTTGAIITVDGGNA  671 (676)
T ss_pred             HHCCCCCCEEEECCCHH
T ss_conf             74292688778586868


No 109
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=422.34  Aligned_cols=235  Identities=26%  Similarity=0.314  Sum_probs=209.8

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             65248899999389986889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      +.-|+||++|||||++|||+++|+.|+++|++|+++|++... +++.+...+.+++  .+.+|++++++++++++++.++
T Consensus       202 ~~pL~GKVALVTGAArGIG~AIA~~LAreGA~VVi~Di~~a~-~~l~~~a~elgg~--al~~DVt~~~a~~~lv~~~~~~  278 (447)
T PRK08261        202 DRPLAGKVALVTGAARGIGAAIAEVLARDGAHVVCLDVPQAG-DDLAAVAARLGGT--ALALDITAPDAPAKIAEHLAER  278 (447)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH-HHHHHHHHHCCCE--EEEECCCCHHHHHHHHHHHHHH
T ss_conf             888999989991725789999999999869999998271148-9999999870980--8995368999999999999996


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      ||++||||||||+.. .+++.++++++|++++++|++++|+++|+++|+|+.+++|+||||+|++++.+.++..+|++||
T Consensus       279 ~G~lDILVnNAGi~~-~~~l~~~~~e~Wd~v~~vNl~g~~~l~qall~~m~~~~gG~IVnIsSiag~~g~~g~~~YaaSK  357 (447)
T PRK08261        279 HGGLDIVVHNAGITR-DKTLANMDEARWDSVIAVNLLAPLRITEALLDNGALGDGGRIVCVSSISGIAGNRGQTNYAASK  357 (447)
T ss_pred             CCCCCEEEECCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCEECCCCCCCCHHHHHHH
T ss_conf             499989998997899-9771119999999999998699999999999977654795799850200046788742879999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC--------CCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEE
Q ss_conf             999999999999854438699755328837977984414--------443245888899999999961975-62668579
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP--------AEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF  243 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~--------~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~  243 (257)
                      +|+.+|||++|.||+++|||||+|+||+|+|+|.++...        ....++.++|+|||+++.||||++ +|+|||++
T Consensus       358 aAv~~ltrslA~ela~~GIRVNaVaPG~I~T~mta~~p~~~re~~rr~~sL~r~G~PeDVA~aVaFLASd~A~~ITGqvL  437 (447)
T PRK08261        358 AGVIGLVQALAPLLAARGITINAVAPGFIETQMTAAIPFAIREAGRRMNSLSQGGLPVDVAETIAWFASPASGAVTGNVV  437 (447)
T ss_pred             HHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCHHHCCCCCCEE
T ss_conf             99999999999996040959999976888863010377356999885086678979999999999970943279879778


Q ss_pred             EECCCCEE
Q ss_conf             87687631
Q gi|254780337|r  244 SVPQNRFV  251 (257)
Q Consensus       244 ~vdgG~~~  251 (257)
                      .||||.++
T Consensus       438 ~VDG~~ll  445 (447)
T PRK08261        438 RVCGQSLL  445 (447)
T ss_pred             EECCCCCC
T ss_conf             98987333


No 110
>PRK09186 flagellin modification protein A; Provisional
Probab=100.00  E-value=0  Score=418.21  Aligned_cols=236  Identities=22%  Similarity=0.274  Sum_probs=211.7

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             48899999389986889999999988998999978989999999999864-99289998789999999999999999818
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      |+||++|||||++|||+++|++|+++|++|++++|+.++++++.+++.+. +.++.++++|++|+++++++++++.++||
T Consensus         2 L~gK~~lVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~l~~~~~~~v~~~~~Dvt~~~~v~~~~~~~~~~~g   81 (255)
T PRK09186          2 LEGKTILITGAGGLIGSALVKAILEAGGIVIAADINKEALNKLLESLGTIEKTKLTLVELDITDQESLEEFLSKSQERYG   81 (255)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             89598999795868999999999987999999969889999999999870598079998468999999999999999819


Q ss_pred             CCCEEEECCCCCCC--CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC--------CC-
Q ss_conf             98799876875888--88867659999999999998999999999999998608986999788356478--------89-
Q gi|254780337|r   95 KLDILIANAGILGS--ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC--------RP-  163 (257)
Q Consensus        95 ~iDilVNNAGi~~~--~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~--------~~-  163 (257)
                      ++|+||||||....  ..++++++.|+|++++++|++++|+++|++.|+|+++++|+|||+||.+|...        .+ 
T Consensus        82 ~id~lVnnA~~~~~~~~~~~~~~~~~~~~~~~~vnl~~~~~~~~~~~~~m~~~~~G~IVnisSi~g~~~~~~~~~~g~~~  161 (255)
T PRK09186         82 KIDGAVNCAYPRNKQYGKKFFDVSLDDFNENLSLHLGSSFLFSQQFAKYFKKQGGGSLVNISSIYGVVAPKFEIYEGTSM  161 (255)
T ss_pred             CCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHCCCCCCCCCCCCC
T ss_conf             97789975766787677770109999999999998399999999999988742897389956678734764211268765


Q ss_pred             -CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH----HCCCCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             -836889899999999999999854438699755328837977984----414443245888899999999961975-62
Q gi|254780337|r  164 -LWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK----AMPAEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       164 -~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~----~~~~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                       ...+|++||+|+.+|||+||.||+++|||||+|+||+|.|++.+.    .....+..++.+|+|||++++||||++ +|
T Consensus       162 ~~~~~Y~asKaal~~ltr~lA~e~a~~gIrVN~VaPG~i~~~~~~~~~~~~~~~~~~~~~~~p~dia~~v~fL~Sd~s~~  241 (255)
T PRK09186        162 TSPVEYAAIKSGIIHLTKYLAKYFKDSNIRVNCVSPGGILDNQPEAFLNAYKKSCNGKGMLDPEDICGSLVFLLSDQSKY  241 (255)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             44676799889999999999999675898999985576889998999999986355779989999999999995705368


Q ss_pred             CCCCEEEECCCCEE
Q ss_conf             66857987687631
Q gi|254780337|r  238 ETGKLFSVPQNRFV  251 (257)
Q Consensus       238 ~tG~~~~vdgG~~~  251 (257)
                      +|||+|.||||..|
T Consensus       242 iTGq~i~VDGG~sl  255 (255)
T PRK09186        242 ITGQNIIVDDGFSL  255 (255)
T ss_pred             CCCCEEEECCCCCC
T ss_conf             01852883858066


No 111
>PRK07326 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=419.80  Aligned_cols=219  Identities=29%  Similarity=0.356  Sum_probs=205.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+++||++|||||++|||+++|++|+++|++|++++|++++++++.+++...  ++.++++|++|+++++++++++.++|
T Consensus         1 M~~~GKvalITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~--~~~~~~~Dv~d~~~v~~~v~~~~~~~   78 (235)
T PRK07326          1 MSGNGKAALVTGGSKGIGFAVAEALAAAGYRVAICARDESELEAAAQELGKR--NVLGLACDVRDEADVRQAVDAHVEAF   78 (235)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCC--CEEEEEEECCCHHHHHHHHHHHHHHC
T ss_conf             9999989999382679999999999987999999989889999999984239--86999963899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ..++++|+++|+|++++++|++|+|+++|+++|+|+++++|+||||+|.+|+.+.|+.++|++||+
T Consensus        79 G~iDiLVNNAGi~-~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IinisS~ag~~~~~~~~~Y~asK~  157 (235)
T PRK07326         79 GGLDILVNNAGVG-HFAPVEELTLEEWRLVIDTNLTGAFYTIKAAVPALLKRGGGYIVNISSLAGKNPFAGGAAYNASKF  157 (235)
T ss_pred             CCCEEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCCCCCCHHHHHHHH
T ss_conf             9966999888778-998826599999999999987999999999999999719988999836555075899836999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHHH
Q ss_conf             999999999998544386997553288379779844144432458888999999999619756
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQK  236 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~~  236 (257)
                      |+.+||++||.||+++|||||+|+||+|+|+|+... +.+....+.+|||||++|+||+|...
T Consensus       158 al~~lt~~la~El~~~gIrVn~v~PG~v~T~~~~~~-~~~~~~~~l~PedVA~av~flls~P~  219 (235)
T PRK07326        158 GLLGLSEALMLDLRDYDVRVSTIMPGSVATHFNGHP-PGEDDAWKIQPEDVAQAVLDLLRMPP  219 (235)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCEECCCCCCC-CCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             999999999998474694999998058907888999-86221137999999999999984989


No 112
>TIGR02415 23BDH acetoin reductases; InterPro: IPR014007   One member of this family, as characterised in Klebsiella terrigena , is able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+). It is also capable of irreversible reduction of diacetyl with NADH to acetoin. There has been a reuctance to classify the enzyme as either 1.1.1.4 from EC, which is (R,R)-butanediol dehydrogenase, or 1.1.1.5 from EC, which is acetoin dehydrogenase without a specified stereochemistry . Another member of this family, from Corynebacterium glutamicum (Brevibacterium flavum), is called L-2,3-butanediol dehydrogenase .    This enzyme is a homotetramer in the family of short chain dehydrogenases (IPR002198 from INTERPRO). .
Probab=100.00  E-value=0  Score=427.16  Aligned_cols=231  Identities=25%  Similarity=0.362  Sum_probs=219.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC--HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             999993899868899999999889989999789--899999999998649928999878999999999999999981898
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRS--ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~--~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      ||||||||++|||++|+++|++.|-+|+++|.+  ++.+.++..++++.|.++.+|++||+++++++++++++.++||.+
T Consensus         1 KvAlvTGgAqGIG~gIa~RLa~DGF~vav~D~n~Qe~~A~~t~~~i~~~G~~Ava~~~DV~~k~~~~~~i~~A~~~fG~f   80 (258)
T TIGR02415         1 KVALVTGGAQGIGKGIAERLAKDGFNVAVADLNNQEETAKETAKEINQKGGKAVAYKLDVSDKSQVFEAIDQAVEKFGGF   80 (258)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             92678568543238999999834613787256663689999999998669737998647345678999999999970893


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCC-CEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             799876875888888676599999999999989999999999999986-089-869997883564788983688989999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKK-SHC-GRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~-~~~-G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      |++|||||+. ...|+.++++|+++++|+||++|+++-+|++...+++ ++. |+|||=.|.+|+.++|.+++||+||+|
T Consensus        81 dV~VNNAGva-~~~pi~~iteE~l~k~y~vNV~GvlfGIQAA~~~Fkk~~~~tGkIINAaSiAg~~G~p~ls~YsstKFA  159 (258)
T TIGR02415        81 DVMVNNAGVA-PVTPILEITEEELEKLYNVNVKGVLFGIQAAARQFKKQGHGTGKIINAASIAGVEGNPVLSAYSSTKFA  159 (258)
T ss_pred             EEEEECCCCC-CCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             2786524100-027745467003423430101456678899998778716898711577657554044146777767888


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC--------------------CCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999999985443869975532883797798441--------------------444324588889999999996197
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM--------------------PAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~--------------------~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      |.+|||+-|+||++.||+||+-|||.|.||||++.-                    +....+|..+|||||++|-||+|+
T Consensus       160 VRgLTQtAA~eLA~~GITVNaYcPGiV~T~M~~~Id~~~~~~~gSk~i~~~~~~fss~I~LGR~~~PeDVA~lVSFLAS~  239 (258)
T TIGR02415       160 VRGLTQTAAQELAPKGITVNAYCPGIVKTEMWEEIDEKTVELAGSKPIGEGFEEFSSEIKLGRLSEPEDVAGLVSFLASE  239 (258)
T ss_pred             HHHHHHHHHHHHHHCCCEECCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCC
T ss_conf             87657999999752487374408886505417999999987327700678999987531379899971388788985147


Q ss_pred             HH-CCCCCEEEECCCCE
Q ss_conf             56-26685798768763
Q gi|254780337|r  235 QK-IETGKLFSVPQNRF  250 (257)
Q Consensus       235 ~~-~~tG~~~~vdgG~~  250 (257)
                      ++ |+|||+|.||||..
T Consensus       240 dSdYiTGQsilvDGGm~  256 (258)
T TIGR02415       240 DSDYITGQSILVDGGMV  256 (258)
T ss_pred             CCCCCCCCEEEECCCCC
T ss_conf             67801265344517404


No 113
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=100.00  E-value=0  Score=417.07  Aligned_cols=236  Identities=22%  Similarity=0.299  Sum_probs=210.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+   ..+.++..+++|++++++++++++++.++|
T Consensus         1 M~L~gKvalITGgs~GIG~aia~~~a~~Ga~V~i~~r~~~~l~~~~~---~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~   77 (262)
T TIGR03325         1 MRLKGEVVLVTGGASGLGRAIVDRFVAEGARVAVLDKSAAGLQELEA---AHGDAVVGVEGDVRSLDDHKEAVARCVAAF   77 (262)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH---HCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             99899889990678789999999999879999999899899999998---679967999845799999999999999984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCC----HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             89879987687588888867659----99999999999899999999999999860898699978835647889836889
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIK----EKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~----~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      |++|+||||||+.....|+.+.+    +++|++++++|++|+|+++|.++|+|++++ |+||+++|.++..+.++..+|+
T Consensus        78 G~iDiLVnNAG~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~-g~iI~~~S~~~~~~~~~~~~Y~  156 (262)
T TIGR03325        78 GKIDCLIPNAGIWDYSTALVDIPDDRIDEAFDEVFHINVKGYLLAVKAALPALVASR-GSVIFTISNAGFYPNGGGPLYT  156 (262)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCCHHHH
T ss_conf             998889972651687764345862414999999999974999999999999999709-8189998710324889966899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHH--------HHC----------CCCCCCCCCCHHHHHHHHHHH
Q ss_conf             89999999999999985443869975532883797798--------441----------444324588889999999996
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRA--------KAM----------PAEDPNTVPHPQKVAKIISFL  231 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~--------~~~----------~~~~~~~~~~pediA~~v~fL  231 (257)
                      +||+||.+|||+||.||+++ ||||+|+||+|.|+|+.        +..          ...|.+|+++|||+|++++||
T Consensus       157 asKaal~~ltr~lA~e~~~~-IRVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~PlgR~g~peeia~av~fL  235 (262)
T TIGR03325       157 AAKHAVVGLVKELAFELAPY-VRVNGVAPGGMSSDLRGPKSLGMADKSISTVPLGDMLKSVLPIGRMPDAEEYTGAYVFF  235 (262)
T ss_pred             HHHHHHHHHHHHHHHHHCCC-CEEEEEEECCCCCCCCCCCCCCHHHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999999999997599-78999953788879867544313555421105899997079989983999999999998


Q ss_pred             HCH-HH-CCCCCEEEECCCCEECCC
Q ss_conf             197-56-266857987687631543
Q gi|254780337|r  232 CAT-QK-IETGKLFSVPQNRFVNYL  254 (257)
Q Consensus       232 ~s~-~~-~~tG~~~~vdgG~~~n~~  254 (257)
                      ||+ ++ |+||++|.||||..+..|
T Consensus       236 ~s~~~s~~iTG~~l~VDGG~~~~~~  260 (262)
T TIGR03325       236 ATRGDTVPATGAVLNYDGGMGVRGF  260 (262)
T ss_pred             CCCCHHCCEECCEEEECCCCCCCEE
T ss_conf             1980226945868897947106730


No 114
>PRK08303 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=414.54  Aligned_cols=239  Identities=21%  Similarity=0.231  Sum_probs=212.6

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCH----------HHHHHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             26524889999938998688999999998899899997898----------99999999998649928999878999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSI----------SQLEKLKNALQKINKKIDIFAFDLRDSNA   81 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~----------~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~   81 (257)
                      |..+|+||+||||||++|||+++|++|+++|++|++++|+.          +.++++.+++++.|+++..++||++|+++
T Consensus         2 Mm~~L~GKvAlVTGasrGIGraiA~~LA~~GA~V~i~~r~~~~~~~~~~~~e~l~e~a~~i~~~Gg~~~~v~~Dvsd~~~   81 (305)
T PRK08303          2 MMKPLRGKVALVAGATRGAGRGIAVELGAAGATVYVTGRSTRARRSEYDRPETIEETAELVTAAGGRGIAVQVDHLVPEQ   81 (305)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHH
T ss_conf             99987999899908875899999999998799899982761100000120679999999999759908999756899999


Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCC----CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH
Q ss_conf             999999999981898799876875888----8886765999999999999899999999999999860898699978835
Q gi|254780337|r   82 LELTKTYIAKRWGKLDILIANAGILGS----ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGA  157 (257)
Q Consensus        82 v~~~~~~~~~~~g~iDilVNNAGi~~~----~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~  157 (257)
                      ++.+++++.++||+||||||||+....    ..++|+.+.|+|.+++++|+.++|+++|+++|.|+++++|+||||+|.+
T Consensus        82 v~~~v~~~~~~~G~lDILVNNa~~~~~~~~~~~~~~~~~~e~~~~~~~vn~~~~~~~~~~a~p~m~~~~~G~IVnisS~~  161 (305)
T PRK08303         82 VRALVERIDREQGRLDILVNDIWGGEKLFEWGKPVWEHSLDKGLRMLRLAVDTHLITSHHALPLLIRRPGGLVVEVTDGT  161 (305)
T ss_pred             HHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH
T ss_conf             99999999995296208985586665434468027661799999999999899999999999999877995899988555


Q ss_pred             HCCCCC---CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-----------CCCC-CCCCCCHH
Q ss_conf             647889---83688989999999999999985443869975532883797798441-----------4443-24588889
Q gi|254780337|r  158 AYKCRP---LWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-----------PAED-PNTVPHPQ  222 (257)
Q Consensus       158 g~~~~~---~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-----------~~~~-~~~~~~pe  222 (257)
                      +..+.+   ...+|++||+|+.+||++||.||+++|||||+|+||+|+|||..+..           ...+ ..+..+||
T Consensus       162 ~~~~~~~~~~~~~Y~asKaAv~~ltr~lA~Ela~~GIrVNaV~PG~i~T~~~~~~~~~~ee~~~~~~~~~~~~~r~~tPe  241 (305)
T PRK08303        162 AEYNATHYRLSVFYDLAKTAVLRLAFSLAHELAPHGATAVALTPGWLRSEMMLDHFGVTEENWRDATAKEPHFAISETPR  241 (305)
T ss_pred             HCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHCCCCHHHHHHHHHCCCCCCCCCCHH
T ss_conf             52277887751989999999999999999997341919999963887755435332588789999870388655666989


Q ss_pred             HHHHHHHHHHCH-H-HCCCCCEEEECCCCE
Q ss_conf             999999996197-5-626685798768763
Q gi|254780337|r  223 KVAKIISFLCAT-Q-KIETGKLFSVPQNRF  250 (257)
Q Consensus       223 diA~~v~fL~s~-~-~~~tG~~~~vdgG~~  250 (257)
                      |||++|.||+|+ + +|+|||+|.++|+.-
T Consensus       242 eva~aVafLaSDpdas~iTGq~L~~~gl~~  271 (305)
T PRK08303        242 YVGRAVAALAADPDVARWNGQSLSSGGLAR  271 (305)
T ss_pred             HHHHHHHHHHCCCCHHHCCCCEEEECCCHH
T ss_conf             999999999579042315797788777789


No 115
>PRK08703 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=416.05  Aligned_cols=232  Identities=26%  Similarity=0.370  Sum_probs=216.8

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-CCCEEEEECCCC--CHHHHHHHHHHHH
Q ss_conf             5248899999389986889999999988998999978989999999999864-992899987899--9999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAFDLR--DSNALELTKTYIA   90 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g~~~~~~~~Dv~--d~~~v~~~~~~~~   90 (257)
                      .+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++.+. +.+...+.+|+.  ++.+++++...+.
T Consensus         2 ~~L~gK~~lITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~l~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~   81 (239)
T PRK08703          2 ATLSDKTILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGHPEPFAIRFDLMSAEEKEFEQFAATIA   81 (239)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             48596989994886289999999999879989999798889999999999737995499998505630789999999999


Q ss_pred             HHH-CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             981-8987998768758888886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   91 KRW-GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        91 ~~~-g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      +++ |++|+||||||+.....|+++.+.++|++++++|++++|+++|+++|+|+++++|+|||++|.++..|.|++++|+
T Consensus        82 ~~~~G~lD~lvnnAG~~~~~~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~p~m~~~~~g~Ii~isS~~~~~~~~~~~~Y~  161 (239)
T PRK08703         82 EATQGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGETPKAYWGGFG  161 (239)
T ss_pred             HHHCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHCCCCCCCHHHH
T ss_conf             98379976899666545788953328999999999888089999999999999877990899981445477898866899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHC-CEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHHH-CCCCCEEEE
Q ss_conf             899999999999999854438-6997553288379779844144432458888999999999619756-266857987
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTA-LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQK-IETGKLFSV  245 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~g-Irvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~~-~~tG~~~~v  245 (257)
                      +||+||.+|||++|.||+++| ||||+|+||+|+|||..+.++.+...+...|+|||++++||+|+++ |+|||+|.|
T Consensus       162 asKaal~~ltk~lA~E~~~~g~IrVN~i~PG~i~T~~~~~~~~~~~~~~~~~~~dia~a~~~LaS~~s~~itGq~i~v  239 (239)
T PRK08703        162 ASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQRIKSHPGEAKSERKSYGDVLPAFVWWASAESKGRSGEIVYL  239 (239)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCHHHHCCCCCHHCCCCHHHHHHHHHHHHCHHHCCCCEEEEEC
T ss_conf             999999999999999847898989999984889796815458697601059999999999998388777995206769


No 116
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=409.78  Aligned_cols=235  Identities=24%  Similarity=0.294  Sum_probs=213.1

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++   +.++..+.+|++++++++++++++.++||
T Consensus         3 ~L~gK~alVTGas~GIG~aia~~l~~~Ga~V~~~~r~~~~l~~~~~~~---~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G   79 (263)
T PRK06200          3 WLTGQVALITGGGSGIGRALVERFLAEGARVAVLERSAEKCASLRQRF---GDDVLVVEGDVTSYADNQRAVAQTVDRFG   79 (263)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH---CCCEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             717288999586679999999999987999999979999999999981---88646871799999999999999999849


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHH----HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             9879987687588888867659999----999999998999999999999998608986999788356478898368898
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKS----FADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~----~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++|+||||||+.....++.+++.|+    |+++|++|++++|+++|+++|+|++++ |+||+++|.+++.+.++.++|++
T Consensus        80 ~iDiLVnnAG~~~~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m~~~~-g~iI~~~S~~~~~~~~~~~~Y~a  158 (263)
T PRK06200         80 KLDCFVGNAGIWDYYTSLVDIPAETLDTAFDEIFRVNVKGYLLGAKAALPALKASG-GSIIFTLSNSSFYPGGGGPLYTA  158 (263)
T ss_pred             CCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEECCHHHCCCCCCCHHHHH
T ss_conf             98889975754677776033997899999999999987999999999989886079-77999822021258898567899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH-------------------HCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             99999999999999854438699755328837977984-------------------41444324588889999999996
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK-------------------AMPAEDPNTVPHPQKVAKIISFL  231 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~-------------------~~~~~~~~~~~~pediA~~v~fL  231 (257)
                      ||+|+.+|||+||.||+++ ||||+|+||+|+|||+..                   .....|.+|+++|+|+|+++.||
T Consensus       159 sKaal~~ltr~lA~ela~~-IrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pl~R~g~p~dia~~v~fL  237 (263)
T PRK06200        159 SKHAVVGLVRQLAYELAPK-IRVNGVAPGGTVTDLRGPASLGQGETSISDVPGLADMIAAITPLQFAPQPEDHTGPYVLL  237 (263)
T ss_pred             HHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             9999999999999997799-889999628898886442112146654204688999997179989983999999999998


Q ss_pred             HCHH-H-CCCCCEEEECCCCEECCC
Q ss_conf             1975-6-266857987687631543
Q gi|254780337|r  232 CATQ-K-IETGKLFSVPQNRFVNYL  254 (257)
Q Consensus       232 ~s~~-~-~~tG~~~~vdgG~~~n~~  254 (257)
                      +|++ + |+|||+|.||||..+..+
T Consensus       238 ~Sd~~s~~iTG~~i~vDGG~s~~g~  262 (263)
T PRK06200        238 ASRRNSRALTGVVINADGGLGIRGI  262 (263)
T ss_pred             CCCCCCCCEECCEEEECCCHHCCCC
T ss_conf             0853236845867888936203568


No 117
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated
Probab=100.00  E-value=0  Score=412.40  Aligned_cols=241  Identities=22%  Similarity=0.273  Sum_probs=216.1

Q ss_pred             EEECCCCCEEEEECCC--CHHHHHHHHHHHHCCCEEEEEECCH--HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             2652488999993899--8688999999998899899997898--99999999998649928999878999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSS--RGIGYYTALELARSGAYVIACGRSI--SQLEKLKNALQKINKKIDIFAFDLRDSNALELTKT   87 (257)
Q Consensus        12 m~~~l~~K~alVTGas--~GIG~a~a~~la~~G~~Vi~~~r~~--~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~   87 (257)
                      |.|+|+||++|||||+  +|||+++|++|+++|++|++++++.  .++++...++.+.+.+..+++||++|+++++++++
T Consensus         1 M~~~L~GK~alVTGaag~~GiG~aia~~la~~GA~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~   80 (259)
T PRK07370          1 MMLDLTGKKALVTGIANNRSIAWGIAQQLHAAGAELGITYLPDEKGRFEKKVRELTEPLNPSLFLPCNVQDDAQIEEVFE   80 (259)
T ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH
T ss_conf             99899999899979899857999999999986999999947870135899999998412864899912899999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCC
Q ss_conf             999981898799876875888---88867659999999999998999999999999998608986999788356478898
Q gi|254780337|r   88 YIAKRWGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL  164 (257)
Q Consensus        88 ~~~~~~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~  164 (257)
                      ++.++||++|+||||||+...   .++++++++++|++++++|++++|+++|++.|.|++  .|+|||++|.++.++.|+
T Consensus        81 ~~~~~~G~iDilVnna~~~~~~~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~~~~--~g~Ii~iss~~~~~~~~~  158 (259)
T PRK07370         81 TIKQKWGQLDILVHCLAFAGKEELSGDFSATSREGFARALEISAYSLAPLCRAAKPLMSE--GGSIVTLTYLGGVRAIPN  158 (259)
T ss_pred             HHHHHHCCCCEEEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCEEEEEEECCCCCCCC
T ss_conf             999985898779863011464336799255999999999999879999999999886045--885312787413546788


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH----------HCCCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             36889899999999999999854438699755328837977984----------41444324588889999999996197
Q gi|254780337|r  165 WGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK----------AMPAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       165 ~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~----------~~~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      +.+|++||+|+.+|||+||.||+++|||||+|+||+|+|++...          .....|.+|+++|||||++++||||+
T Consensus       159 ~~~y~asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~peeiA~~v~FL~Sd  238 (259)
T PRK07370        159 YNVMGVAKAALEASVRYLAAELGPENIRVNAISAGPIRTLASSAVGGILDMIHHVEEKAPLRRTVTQTEVGNTAAFLLSD  238 (259)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             52058899999999999999837188799998636685512220367299999998579989993999999999999584


Q ss_pred             H-HCCCCCEEEECCCCEECCC
Q ss_conf             5-6266857987687631543
Q gi|254780337|r  235 Q-KIETGKLFSVPQNRFVNYL  254 (257)
Q Consensus       235 ~-~~~tG~~~~vdgG~~~n~~  254 (257)
                      + +|+|||+|.||||..++.+
T Consensus       239 ~s~~iTG~~i~VDGG~s~~G~  259 (259)
T PRK07370        239 LASGITGQTIYVDAGYCIMGM  259 (259)
T ss_pred             HHCCCCCCEEEECCCCHHCCC
T ss_conf             525743871897969130379


No 118
>PRK07577 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=411.06  Aligned_cols=222  Identities=28%  Similarity=0.394  Sum_probs=202.0

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             48899999389986889999999988998999978989999999999864992899987899999999999999998189
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      |+||++|||||++|||+++|+.|+++|++|+.++|+..+         ...  ...+.+|++|+++++++++++.+.+ +
T Consensus         1 L~~K~alITGas~GIG~aia~~la~~G~~Vv~~~r~~~~---------~~~--~~~~~~D~~d~~~~~~~~~~~~~~~-~   68 (234)
T PRK07577          1 MSSRTVLVTGATKGIGLALSLRLANLGHQVIGIARSAID---------DFP--GELFACDLADIEQTAATLAQINEIH-P   68 (234)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCC---------CCC--CEEEEEECCCHHHHHHHHHHHHHHC-C
T ss_conf             941989993778889999999999879999996347544---------789--7699995799999999999999769-9


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             87998768758888886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      +|+||||||+. ..+|++++++|+|++++++|++++|+++|+++|.|+++++|+|||++|.+ ..+.|+.++|++||+||
T Consensus        69 id~LVnnAG~~-~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IInisS~~-~~~~~~~~~Y~asKaal  146 (234)
T PRK07577         69 VDAIVNNVGIA-LPQPLGKIDLAALQDVYDLNVRAAVQVTQAFLEGMKLREQGRIVNICSRA-IFGALDRTSYSAAKSAL  146 (234)
T ss_pred             CCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECHH-CCCCCCCHHHHHHHHHH
T ss_conf             98999899889-99880559999999999999799999999999998874898679996011-02788747789999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH-----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEE
Q ss_conf             9999999998544386997553288379779844-----------14443245888899999999961975-62668579
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKA-----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF  243 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~-----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~  243 (257)
                      .+|||++|.||+++|||||+|+||+|+|+|+.+.           ....|.+|+++|||||++|.||+|++ +|+|||+|
T Consensus       147 ~~ltkslA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~~P~~R~g~p~eia~~v~fL~s~~s~~itGq~i  226 (234)
T PRK07577        147 VGCTRTWALELAEYGITVNAVAPGPIETELFRQTRPVGSEEEKRVLASIPMRRLGTPEEVAAAIAFLLSDDAGFITGQVL  226 (234)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEE
T ss_conf             99999999998655969999954889773554227588899999985799999888999999999995852158128247


Q ss_pred             EECCCCEE
Q ss_conf             87687631
Q gi|254780337|r  244 SVPQNRFV  251 (257)
Q Consensus       244 ~vdgG~~~  251 (257)
                      .||||+.+
T Consensus       227 ~VdGG~sl  234 (234)
T PRK07577        227 GVDGGGSL  234 (234)
T ss_pred             EECCCCCC
T ss_conf             84889589


No 119
>PRK07707 consensus
Probab=100.00  E-value=0  Score=409.84  Aligned_cols=227  Identities=23%  Similarity=0.294  Sum_probs=207.1

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             8999993899868899999999889989999-789899999999998649928999878999999999999999981898
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      +|+||||||++|||+++|++|+++|++|+++ .+++++++++.+++.+..  ...+++|++++++++++++++.+   ++
T Consensus         2 ~KvalVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~--~~~v~~Dl~~~~~~~~~~~~~~~---~i   76 (239)
T PRK07707          2 KKYALVTGASGGIGQAISKQLAQDGYTVYLHYNNNEEKVNELQEELGEVI--PVPVQADLASPDGAEKLWSQIEH---PL   76 (239)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCC--EEEEEEECCCHHHHHHHHHHHCC---CC
T ss_conf             98999966887899999999998799899983999899999999844366--06999868999999999998578---89


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      |+||||||.. ..+++.|+++|+|++++++|++++|+++|+++|+|+++++|+||||+|.++..+.++.++|++||+|+.
T Consensus        77 D~lVnnAG~~-~~~~~~~~~~e~~~~~~~~nl~~~~~~~~~~~p~m~~~~~G~II~isS~~~~~g~~~~~~Y~asKaav~  155 (239)
T PRK07707         77 DAIVYNSGKS-IFGLVTDVTNDELNDMVQLHVKSPYKLLSMLLPSMIQRKSGNIVAVSSIWGQIGASCEVLYSMVKGAQN  155 (239)
T ss_pred             CEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
T ss_conf             9999899999-998701099999999999998999999999989998769967999737887476875168899999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECC
Q ss_conf             999999998544386997553288379779844--------14443245888899999999961975-626685798768
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQ  247 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdg  247 (257)
                      +|||+||.|++++|||||+|+||+++|+|.+..        ....|.+|+++|||||+++.||+|++ +|+|||+|.|||
T Consensus       156 ~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~plgR~g~pediA~~v~FL~S~~a~~iTG~~l~VdG  235 (239)
T PRK07707        156 SFVKALAKELAPSGIRVNAVAPGAIETEMLNVFSEEDKEEIAEEIPLGRLGLPEEVAKTVSFLLSPGASYITGQIISVNG  235 (239)
T ss_pred             HHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECC
T ss_conf             99999999976639699999748898723331399999999856999998589999999999958722475186388587


Q ss_pred             CCE
Q ss_conf             763
Q gi|254780337|r  248 NRF  250 (257)
Q Consensus       248 G~~  250 (257)
                      |.+
T Consensus       236 G~h  238 (239)
T PRK07707        236 GWH  238 (239)
T ss_pred             CCC
T ss_conf             928


No 120
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=408.17  Aligned_cols=237  Identities=17%  Similarity=0.213  Sum_probs=209.0

Q ss_pred             ECCCCCEEEEECCC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             52488999993899--8688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSS--RGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        14 ~~l~~K~alVTGas--~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |.|+||++|||||+  +|||+++|+.|+++|++|++++|++. +++..+++.+..++...++||++|+++++++++++.+
T Consensus         1 M~L~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~-~~~~~~~l~~~~g~~~~~~~Dvs~~~~v~~~~~~i~~   79 (274)
T PRK08415          1 MIMKGKKGLIVGVANNKSIAYGIAKACFEQGAELAFTYLNDA-LKKRVEPIAQELGSPYVYELDVSKEEHFKSLAESIKK   79 (274)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHH-HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHH
T ss_conf             928998799989999837999999999986999999848878-9999999998629976999028999999999999999


Q ss_pred             HHCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             81898799876875888---888676599999999999989999999999999986089869997883564788983688
Q gi|254780337|r   92 RWGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      +||++|+||||||+...   ..++.|++.++|+.++++|+.++|+++|++.|+|++  .|+||+++|..+..+.|++++|
T Consensus        80 ~~G~iDilVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~--~GsIi~iss~~~~~~~p~~~~y  157 (274)
T PRK08415         80 DLGEIDFIVHSVAFAPKEALEGSFLETSKEAFDIAMEISVYSLIELTRALLPLLND--GGSVLTLSYLGGVKYVPHYNVM  157 (274)
T ss_pred             HHCCCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCCCCCCCCCCCCCCCCHHH
T ss_conf             85898888533555764334687333899999999999999999999999987430--7987642202465666630036


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             98999999999999998544386997553288379779844----------14443245888899999999961975-62
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      ++||+|+.+|||+||.||+++|||||+|+||+|+|++....          ....|.+|+++|||||++++||||++ +|
T Consensus       158 ~asKaal~~ltk~lA~Ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~av~FLaSd~ss~  237 (274)
T PRK08415        158 GVAKAALESSVRYLAVDLGKKGIRVNAISAGPIKTLAASGIGDFRMILKWNEINAPLKKNVSIEEVGNSAMYLLSDLASG  237 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             77789999999999999835496999987687776100138889999987874899789969999999999995845357


Q ss_pred             CCCCEEEECCCCEECC
Q ss_conf             6685798768763154
Q gi|254780337|r  238 ETGKLFSVPQNRFVNY  253 (257)
Q Consensus       238 ~tG~~~~vdgG~~~n~  253 (257)
                      +|||+|.||||..+..
T Consensus       238 iTG~~i~VDGG~si~g  253 (274)
T PRK08415        238 VTGEIHYVDAGYNIMG  253 (274)
T ss_pred             CCCCEEEECCCHHHCC
T ss_conf             3687157787933216


No 121
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=100.00  E-value=0  Score=403.22  Aligned_cols=232  Identities=22%  Similarity=0.283  Sum_probs=207.6

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|+.|+++|++|++++|++++++++.+++++.+ ++.++.+|++++++++++++++.+.|
T Consensus         1 m~l~gK~~lVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g-~~~~~~~Dvs~~~~v~~~~~~~~~~~   79 (238)
T PRK05786          1 MRLKGKNVLIVGVSPGLGYAVAYFALREGASVYAFARSEEKLKEIKKTLAKYG-NVIYVVGDVSKLEGAREAAEKAAKVF   79 (238)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             98799889992898789999999999879999999698899999999874359-77999757899999999999999983


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH-CCCCCCCHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356-47889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA-YKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g-~~~~~~~~~Y~asK  172 (257)
                      |++|+||||||... ..++++  .++|++++++|++++|+++|+++|+|++  +++||+++|..+ ..+.|+..+|++||
T Consensus        80 g~iD~lv~naG~~~-~~~~~~--~~~~~~~~~~nl~~~~~~~~~~~~~m~~--g~~ii~iss~~~~~~~~~~~~~Y~asK  154 (238)
T PRK05786         80 GALHGLVVTAGGYI-EDTVEE--LAGLEDMLNNHLKAPLYAVNASLPLLRE--GSSIVLVSSIRGIYKAWPRQLSYAAAK  154 (238)
T ss_pred             CCCCEEEEECCCCC-CCCHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCEEEEEECHHHCCCCCCCCHHHHHHH
T ss_conf             99887998057567-885231--8999999999858999999999997421--677999964454167898617899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC---CCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCC
Q ss_conf             99999999999985443869975532883797798441444---3245888899999999961975-6266857987687
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE---DPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN  248 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~---~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG  248 (257)
                      +||.+|||+||.||+++|||||+|+||+|+|+|..+.....   .......|||||+++.||+|++ +|+|||+|.||||
T Consensus       155 aal~~ltk~lA~ela~~gIrVN~IaPG~i~t~~~~~~~~~~~~~~~~~~~~peeiA~~v~fL~S~~a~~iTG~~i~VDGG  234 (238)
T PRK05786        155 AGLAKAVEILAAELLDRGIRVNGVAPSGIDGDFVPGRDWKKLRKLGDPQAPPEDFAKVIIWLLTDEAEWVNGVVIPVDGG  234 (238)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCC
T ss_conf             99999999999996417959999962889988877768698776301799999999999999697213966880888935


Q ss_pred             CEE
Q ss_conf             631
Q gi|254780337|r  249 RFV  251 (257)
Q Consensus       249 ~~~  251 (257)
                      +.|
T Consensus       235 ~~L  237 (238)
T PRK05786        235 RRL  237 (238)
T ss_pred             HHC
T ss_conf             003


No 122
>PRK06139 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=401.41  Aligned_cols=219  Identities=21%  Similarity=0.299  Sum_probs=205.7

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      .|+||++||||||+|||+++|++|+++|++|++++|++++++++.+++++.|.++.++.+|++|+++++++++++.++||
T Consensus         3 ~L~gKvvlITGASsGIG~aiA~~~A~~Ga~Vvl~~R~~~~L~~~a~e~~~~G~~~~~v~~DVsd~~~v~~~~~~~~~~~G   82 (324)
T PRK06139          3 PLHGAVVVITGASSGIGRATAEAFARRGARLVLAARDEEALFEVAEECRALGAEVLVVPTDVTHADQVQALATQAASFLG   82 (324)
T ss_pred             CCCCCEEEEECHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             85997799938254999999999998799899998999999999999995499489997667885789999999999749


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      +||+||||||+. ..++|+|++.|+|+++++||++|+|+++|+++|+|++++.|+||||+|.+|+.+.|+.++||+||+|
T Consensus        83 ~IDiLVNNAGi~-~~g~~~e~~~e~~~~vi~vNl~G~~~~~~aalp~M~~~g~G~IINisS~ag~~~~P~~saY~ASK~A  161 (324)
T PRK06139         83 RIDVWFNNVGVG-AVGRFEETPLEAHEQVIQTNLIGYLRDAHAALPIFKAQGHGIFINMISLGGFAAQPYAAAYSASKFG  161 (324)
T ss_pred             CCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHCCCCCCCHHHHHHHH
T ss_conf             987886457557-7775355999999999999869999999999999986599189997363241369998419899999


Q ss_pred             HHHHHHHHHHHHHHH-CCEEEEECCCCCCCHHHHHHCC-----CCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999999985443-8699755328837977984414-----44324588889999999996197
Q gi|254780337|r  175 IEALARTWSKETVNT-ALRVINIDPGPTRTSMRAKAMP-----AEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       175 l~~lt~~la~E~~~~-gIrvn~I~PG~v~T~m~~~~~~-----~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      |.+||++|+.|+.++ ||+||+|+||+|+|||+.....     .+++..+-+||.+|++|++++..
T Consensus       162 v~gftesLr~EL~~~~gI~Vt~V~Pg~v~TP~~~~~~~~~~~~~~~~~p~~~pe~vA~ai~~~~~~  227 (324)
T PRK06139        162 LRGFSEALRAELTDFPDIHVCDVYPAFVDTPGFRHGANYTGRRLTPPPPMYDPRRVAKAMVRLADR  227 (324)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             999999999983799891899985799588520143533787889999987999999999999838


No 123
>PRK08340 glucose-1-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=398.94  Aligned_cols=230  Identities=21%  Similarity=0.222  Sum_probs=210.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      .+|||||++|||+++|++|+++|++|++++|++++++++.+++++.+ ++.++++|++|+++++++++++.++||++|+|
T Consensus         2 nVlITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g-~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iD~L   80 (259)
T PRK08340          2 NVLVTASSRGIGFNVARELLKKGARVVISSRNEENLEKALKELKELG-EVYAIKADLSDKDDLKNLVKEAWELLGGIDAL   80 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-CEEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89997587789999999999879999999799899999999987418-87999963699899999999999985998889


Q ss_pred             EECCCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-HHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             876875888-888676599999999999989999999999999-986089869997883564788983688989999999
Q gi|254780337|r  100 IANAGILGS-ISPIWQIKEKSFADVISVNVMANWNIMRSFDPW-LKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus       100 VNNAGi~~~-~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~-m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      |||||.... +..+++.+.++|++.+++|+.+++++++.++|. |+++++|+|||++|.++..+.|...+|++||+|+.+
T Consensus        81 VnNAg~~~~~p~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~G~Ii~isS~~~~~~~~~~~~y~asKaal~~  160 (259)
T PRK08340         81 VWNAGNVKCEPCMLHEAGYSDWLEAALLHLVAPGYLTTLLLQTWLEKKMKGVLVYLSSVSVKEPMPPLLLADVTRAGLVQ  160 (259)
T ss_pred             EECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHEEECCCCCHHHHHHHHHHHHH
T ss_conf             98576677897433549999999999987155999999999999986588649997212102557862689998899999


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCHHHHH--------------------HCCCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             9999999854438699755328837977984--------------------414443245888899999999961975-6
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTSMRAK--------------------AMPAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~--------------------~~~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      |||++|.||+++|||||+|+||+++||+..+                    .....|.+|+++|||||+++.||+|++ +
T Consensus       161 ltk~lA~e~~~~gIrvN~v~pG~i~tp~~~~~~~~~~~~~~~~~~e~~~~~~~~~~Pl~R~g~pediA~~v~fL~Sd~a~  240 (259)
T PRK08340        161 LAKGVSRTYGGRGIRAYTVLLGSFDTPGARENLARIAEERGVSPEETWEKEVLERTPLHRTGRWEELGSLIAFLLSENAE  240 (259)
T ss_pred             HHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999842291999985488989636778999998728997899999997089999985999999999999586426


Q ss_pred             CCCCCEEEECCCCE
Q ss_conf             26685798768763
Q gi|254780337|r  237 IETGKLFSVPQNRF  250 (257)
Q Consensus       237 ~~tG~~~~vdgG~~  250 (257)
                      |+|||+|.||||..
T Consensus       241 ~iTG~~i~VDGG~t  254 (259)
T PRK08340        241 YMLGSTIVFDGAMT  254 (259)
T ss_pred             CCCCCEEEECCCCC
T ss_conf             82182389996512


No 124
>PRK07041 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=398.25  Aligned_cols=227  Identities=25%  Similarity=0.295  Sum_probs=207.0

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+|+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++.+ +.++..+.+|++++++++++++    
T Consensus         1 M~~~l~gK~~lITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~~~~-~~~~~~~~~Dv~~~~~v~~~~~----   75 (240)
T PRK07041          1 MQMSLNDQKVLVVGGSSGIGLAAARAFAARGADVTIASRSRERLAAAARALGG-PRPVRTAALDITDEAAVDAFFA----   75 (240)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC-CCCEEEEECCCCCHHHHHHHHH----
T ss_conf             99885999899957788899999999998799999995988999999998478-8866999847999999999999----


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      ++|++|+||||||.. ..+++.+++.|+|++++++|++++|+++|+    ++.+++|+||+++|.+++++.|+.++|++|
T Consensus        76 ~~g~~d~lv~nag~~-~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~----~~~~~~G~Ii~iss~~~~~~~~~~~~Y~as  150 (240)
T PRK07041         76 EAGPFDHVVITAADT-AGGPVRALPLAAAQAAMDSKFWGAYRVARA----ARIAPGGSLTFVSGFLAVRPSASGVLQGAI  150 (240)
T ss_pred             HHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHH----HHHHCCCEEEEECCHHHCCCCCCCHHHHHH
T ss_conf             709878899823447-999810299999999999888999999999----997169679996443314778861788887


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC------------CCCCCCCCCHHHHHHHHHHHHCHHHCCC
Q ss_conf             9999999999999854438699755328837977984414------------4432458888999999999619756266
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP------------AEDPNTVPHPQKVAKIISFLCATQKIET  239 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~------------~~~~~~~~~pediA~~v~fL~s~~~~~t  239 (257)
                      |+|+.+|||+||.||++  ||||+|+||+|+|||+.+..+            ..|.+|+++|||||+++.||+|+ +|+|
T Consensus       151 Kaal~~ltr~lA~ela~--IrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~~iPl~R~g~pedia~~v~fL~s~-~~it  227 (240)
T PRK07041        151 NAALEALARGLALELAP--VRVNAVSPGLVDTPLWSKLAGDARAAMFAAAAERLPARRVGQPEDVANAIVFLAAN-GFAT  227 (240)
T ss_pred             HHHHHHHHHHHHHHHCC--CEEEEEEECCCCCHHHHHCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHC-CCCC
T ss_conf             67999999999998289--28999841876773665317113899999998459999984999999999999847-8878


Q ss_pred             CCEEEECCCCEE
Q ss_conf             857987687631
Q gi|254780337|r  240 GKLFSVPQNRFV  251 (257)
Q Consensus       240 G~~~~vdgG~~~  251 (257)
                      ||+|.||||+.+
T Consensus       228 G~~i~VDGG~sl  239 (240)
T PRK07041        228 GSTVLVDGGGAI  239 (240)
T ss_pred             CCEEEECCCHHH
T ss_conf             982785877240


No 125
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=397.80  Aligned_cols=237  Identities=18%  Similarity=0.263  Sum_probs=211.5

Q ss_pred             EEECCCCCEEEEECCCC--HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             26524889999938998--6889999999988998999978989999999999864992899987899999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSR--GIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        12 m~~~l~~K~alVTGas~--GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      |+-.|+||++|||||++  |||+++|+.|+++|++|++++|+++..+.+++..++.|.++ .++||++|+++++++++++
T Consensus         1 M~g~L~GK~alITGaa~~~GIG~aiA~~La~~GA~V~i~~~~e~~~~~~~~~~~~~g~~~-~~~~Dvsd~~~v~~~v~~~   79 (271)
T PRK06505          1 MEGLMQGKRGLIMGVANDHSIAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAESLGSDL-VLPCDVEDIASVDAVFEAL   79 (271)
T ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE-EEECCCCCHHHHHHHHHHH
T ss_conf             987579997999799998549999999999869999998186688999999999649818-9983799999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCH
Q ss_conf             9981898799876875888---8886765999999999999899999999999999860898699978835647889836
Q gi|254780337|r   90 AKRWGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG  166 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~  166 (257)
                      .++||+||+||||||+...   ..++.|.+.++|++++++|++++++++|.+.|.|.  +.|+|||++|.++.++.|++.
T Consensus        80 ~~~~G~iDiLVnnAG~~~~~~~~~~~~d~~~e~~~~~~~~n~~~~~~~~~~~~~~~~--~~Gsii~iss~~~~~~~p~~~  157 (271)
T PRK06505         80 EKKWGKLDFVVHAIGFSDKNELKGRYADTTRENFSRTMVISCFSFTEIAKRAAKLMP--DGGSMLTLTYGGSTRVMPNYN  157 (271)
T ss_pred             HHHHCCCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCC--CCCCEEEEECCCCCCCCCCCC
T ss_conf             998399878985664467544445412267999999999997999999998600126--788602463254344578741


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-
Q ss_conf             8898999999999999998544386997553288379779844----------14443245888899999999961975-
Q gi|254780337|r  167 AYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-  235 (257)
Q Consensus       167 ~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-  235 (257)
                      +|++||+||.+|||+||.||+++|||||+|+||+|+|++....          ....|.+|+++|||||++++||||++ 
T Consensus       158 ~Y~asKaal~~ltr~lA~e~a~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~~ediA~~v~fL~Sd~s  237 (271)
T PRK06505        158 VMGVAKAALEASVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAMFSYQQRNSPLRRTVTIDEVGGSALYLLSDLS  237 (271)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHH
T ss_conf             34787877999999999997023989999975777655424477679999999868898999699999999999957542


Q ss_pred             HCCCCCEEEECCCCEE
Q ss_conf             6266857987687631
Q gi|254780337|r  236 KIETGKLFSVPQNRFV  251 (257)
Q Consensus       236 ~~~tG~~~~vdgG~~~  251 (257)
                      +|+|||+|.||||..+
T Consensus       238 ~~iTGq~i~VDGG~si  253 (271)
T PRK06505        238 SGVTGEIHFVDSGYNI  253 (271)
T ss_pred             CCCCCCEEEECCCCCC
T ss_conf             4745870897969301


No 126
>PRK05855 short chain dehydrogenase; Validated
Probab=100.00  E-value=0  Score=395.41  Aligned_cols=218  Identities=28%  Similarity=0.350  Sum_probs=200.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ..|+||+||||||++|||+++|++||++|++|+++||+++.++++.+++++.|.++..+.+||+|+++++++++++.++|
T Consensus       311 ~rFsGKvAvVTGA~sGIGrA~A~~fA~~GA~Vvl~Dr~~~~l~eta~ei~~~G~~a~~~~~DVtd~~av~al~~~v~~~~  390 (582)
T PRK05855        311 GRFGGKLVVVTGAGSGIGRATALAFAREGAEVVASDIDEAAAERTAALIRAAGAVAHAYRVDVSDADAMEALAEWVGAEH  390 (582)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             87499589995875789999999999779999996079999999999999519848999755899999999999999976


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608-98699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |++|+||||||+. ..++|+|++.|+|+++|+||++|+|+++|+++|+|++++ +|+|||+||++|+.+.|+.++||+||
T Consensus       391 G~iDILVNNAGI~-~~g~~~d~s~e~w~~v~dVNl~Gv~~~~ra~lp~M~~rg~gG~IVNiSSiag~~~~p~~~aY~ASK  469 (582)
T PRK05855        391 GVPDIVVNNAGIG-MAGGFLDTSAEEWDRVLDVNLWGVIHGCRLFGRQMVERGTGGHIVNVASAAAYAPSRSLPAYATSK  469 (582)
T ss_pred             CCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHCCCCCCCHHHHHHH
T ss_conf             9999999898758-997803299999999998864999999999999999649980899967864577898864689999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-CC---CC------------CCCCCCHHHHHHHHHHHH
Q ss_conf             99999999999985443869975532883797798441-44---43------------245888899999999961
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM-PA---ED------------PNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-~~---~~------------~~~~~~pediA~~v~fL~  232 (257)
                      +|+.+||++|+.|++++||+||+||||.|+|++..... +.   +.            ..+...||++|+.|+--.
T Consensus       470 aAV~gftesLr~ELa~~GI~V~aVcPG~I~T~I~~~a~~~g~~~~~~~~~~~~~~~~~~~~~~~Pe~vA~~Il~aV  545 (582)
T PRK05855        470 AAVLMLSECLRAELAEAGIGVTAICPGFVDTNIVATTRFAGADAEDEARRRKRADKLYARRGYGPEKVAKAIVSAV  545 (582)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             9999999999998530297799993184646755556647876025677888776665405999999999999998


No 127
>PRK07825 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=397.20  Aligned_cols=214  Identities=24%  Similarity=0.261  Sum_probs=197.8

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +|+||+++|||||+|||+++|+.|+++|++|++++|+++.++++.+++.    ++.++++|++|+++++++++++.++||
T Consensus         2 dl~gKvvlITGassGIG~a~A~~la~~Ga~V~i~~r~~~~l~~~~~~~~----~~~~~~~DVtd~~~v~~~~~~~~~~~G   77 (273)
T PRK07825          2 NLRGKVIAITGGARGIGLATARALAALGAKVAIGDLDEALAKESAAELG----LVVGGPLDVTDPASFAAFLDAVEADLG   77 (273)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC----CCEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             9999889992623399999999999879989999799999999998607----855999147999999999999999709


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      ++|+||||||+. ..++++|.++|+|+++++||++|+|+++|+++|+|++++.|+||||+|.+|+.+.|+.++|++||+|
T Consensus        78 ~iDiLVNNAGi~-~~~~~~e~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IVnisS~ag~~~~p~~~~Y~ASK~a  156 (273)
T PRK07825         78 PIDVLVNNAGIM-PVGPFLDEPDRATRRILDVNVYGVILGSKLAAPRMVPRGRGHIVNVASLAGKIAVPGMATYCASKHA  156 (273)
T ss_pred             CCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCCCCCCCHHHHHHHH
T ss_conf             977899878778-9987343999999999886039999999999999997399479998476764779998359999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999999985443869975532883797798441444324588889999999996197
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      +.+||++|+.|++++|||||+|+||+|+|+|.+.... ..+..+.+|||+|+.|+-.+..
T Consensus       157 v~g~t~sLa~El~~~gIrVn~V~PG~v~T~m~~g~~~-~~~~~~~~pe~vA~~iv~~i~~  215 (273)
T PRK07825        157 VVGLTDALRLELRPTGVHVSVVLPTFVNTELIAGTKG-AKGLKNAEPEDVAAAIVALVAK  215 (273)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999999852309599999709998565799987-6688999999999999999968


No 128
>PRK10538 3-hydroxy acid dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=396.07  Aligned_cols=227  Identities=23%  Similarity=0.331  Sum_probs=205.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      ++||||||+|||+++|++|+++|++|++++|++++++++.+++   +.++.++++|++|+++++++++++.++||++|+|
T Consensus         2 VvlVTGassGIG~a~A~~la~~Ga~Vv~~~r~~~~l~~l~~~l---g~~~~~~~~Dvsd~~~v~~~~~~~~~~~g~iDiL   78 (248)
T PRK10538          2 IVLVTGATAGFGECITRRFIQNGHKVIATGRRQERLQELKDEL---GDNLYIAQLDVRNRAAIEEMLASLPAEWRNIDIL   78 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH---CCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             9999888669999999999987999999989999999999984---8867999973488899999999999970997599


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             87687588888867659999999999998999999999999998608986999788356478898368898999999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALA  179 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt  179 (257)
                      |||||+.....|+++.+.|+|++++++|++|+|+++|+++|.|++++.|+||||||.+|..+.|+.++|++||+|+.+||
T Consensus        79 VnNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~ag~~~~~~~~~Y~asKaal~~~t  158 (248)
T PRK10538         79 VNNAGLALGLEPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTAGSWPYAGGNVYGATKAFVRQFS  158 (248)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             97785467888637689999987775241319999999867666359958999936000788999688999999999999


Q ss_pred             HHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC---------CCCCCCCCHHHHHHHHHHHHCHHHCCC---CCEEEECC
Q ss_conf             999998544386997553288379779844144---------432458888999999999619756266---85798768
Q gi|254780337|r  180 RTWSKETVNTALRVINIDPGPTRTSMRAKAMPA---------EDPNTVPHPQKVAKIISFLCATQKIET---GKLFSVPQ  247 (257)
Q Consensus       180 ~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~---------~~~~~~~~pediA~~v~fL~s~~~~~t---G~~~~vdg  247 (257)
                      ++|+.|++++|||||+|+||+|+|+++......         .+..++.+|||||++++||+|...+.+   ..+.++++
T Consensus       159 ~~La~El~~~gIrVn~v~PG~v~t~~~~~~~~~~~~~~~~~~~~~~~~l~PedVA~av~fl~s~p~~~~i~~i~v~P~~~  238 (248)
T PRK10538        159 LNLRTDLHGTAVRVTDIEPGLVGGTEFSNVRFKGDDGKAEKTYQNTVALTPEDVSEAVWWVATLPAHVNINTLEMMPVTQ  238 (248)
T ss_pred             HHHHHHHCCCCEEEEEEECCCCCCCCHHCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCEEEEEEEEECCC
T ss_conf             99999847868599999847576841111455676888974035789999999999999998299982787899997898


Q ss_pred             CC
Q ss_conf             76
Q gi|254780337|r  248 NR  249 (257)
Q Consensus       248 G~  249 (257)
                      |+
T Consensus       239 ~f  240 (248)
T PRK10538        239 SF  240 (248)
T ss_pred             CC
T ss_conf             76


No 129
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=392.94  Aligned_cols=235  Identities=20%  Similarity=0.276  Sum_probs=208.0

Q ss_pred             ECCCCCEEEEECCC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             52488999993899--8688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSS--RGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        14 ~~l~~K~alVTGas--~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+|+||++|||||+  +|||+++|+.|+++|++|++++|+++..+.+.+..++.+ ...+++||++++++++++++++.+
T Consensus         2 ~~L~GK~alVTGaa~g~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~-~~~~~~~Dvt~~~~v~~~~~~~~~   80 (254)
T PRK07533          2 MPLAGKRGLVVGIANEQSIAWGCARAFRALGAELAVTYLNDKARPYVEPLAEELD-APLLMPLDVREPGQLEAVFARIAE   80 (254)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-CEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             9899998999688898089999999999879999998288778999999997459-818999169999999999999999


Q ss_pred             HHCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             81898799876875888---888676599999999999989999999999999986089869997883564788983688
Q gi|254780337|r   92 RWGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      +||+||+||||||+...   ..++.|++.++|++.+++|+.++|+++|.+.|.|++  +|+||++||..+.++.|++++|
T Consensus        81 ~~G~iDilVnna~~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~--gG~iv~iss~~~~~~~~~~~~y  158 (254)
T PRK07533         81 EWGRLDFVLHSIAFAPKEDLHGRVVDCSREGFALAMDVSCHSFIRMARLAEPLMTN--GGSLLTMSYYGAEKVVENYNLM  158 (254)
T ss_pred             HHCCCCEEEECCCCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCEEEEEEHHHCCCCCCCCHH
T ss_conf             84997789742212660111476014999999999999859999999998888651--7831567320011467773157


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHH----------HHCCCCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             989999999999999985443869975532883797798----------4414443245888899999999961975-62
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRA----------KAMPAEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~----------~~~~~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      +++|+|+.+|||+||.||+++|||||+|+||+++|+|..          +.....|.+|+++|||||+++.||+|++ +|
T Consensus       159 ~~aKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~P~~R~~~pedvA~~v~fL~Sd~a~~  238 (254)
T PRK07533        159 GPVKAALESSVRYLAAELGPRGIRVHAISPGPLKTRAASGIDDFDALLEDARERAPLHRLVDIDDVGAVAAFLASDAARA  238 (254)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             88999999999999998376687999986577766232068875999999996599899989999999999995883248


Q ss_pred             CCCCEEEECCCCEE
Q ss_conf             66857987687631
Q gi|254780337|r  238 ETGKLFSVPQNRFV  251 (257)
Q Consensus       238 ~tG~~~~vdgG~~~  251 (257)
                      +|||+|.||||+.+
T Consensus       239 iTG~~i~vDGG~~i  252 (254)
T PRK07533        239 LTGNTLYIDGGYHI  252 (254)
T ss_pred             CCCCEEEECCCCCC
T ss_conf             55881787939357


No 130
>PRK12742 oxidoreductase; Provisional
Probab=100.00  E-value=0  Score=393.34  Aligned_cols=224  Identities=22%  Similarity=0.300  Sum_probs=196.2

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             2488999993899868899999999889989999789-899999999998649928999878999999999999999981
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      +|+||++|||||++|||+++|++|+++|++|++++++ ++.++++..+.   +  ...+.+|.+|.+.+.+.+    +++
T Consensus         3 ~l~gK~alITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~---~--~~~~~~d~~~~~~~~~~~----~~~   73 (237)
T PRK12742          3 AFTGKSVLVLGGSRGIGAAIVRRFVTDGANVVFTYAGSKDAAERLAAET---G--ATAVFTDSADRDAVIDVV----RKS   73 (237)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHH---C--CEEEEECCCCHHHHHHHH----HHH
T ss_conf             9899989992788799999999999879999997799989999998863---9--828993545899999999----986


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH-CCCCCCCHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356-47889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA-YKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g-~~~~~~~~~Y~asK  172 (257)
                      |++|+||||||+. ...++.+++.|+|++++++|++++|+++|.+.|.|+  +.|+||+++|..+ +.+.|+..+|++||
T Consensus        74 g~iD~lVnnAg~~-~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~--~~G~ii~i~S~~~~~~~~~~~~~Y~asK  150 (237)
T PRK12742         74 GPLDILVVNAGIA-LFGDALELDADAIDRLFKINIHAPYHASVEAARQMP--EGGRILIIGSVNGDRMPVAGMAAYAASK  150 (237)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCEEEEEEEECCCCCCCCCCHHHHHHH
T ss_conf             9998999899778-999813499999999998750679999999999712--3785999995300236888607889999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH-------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEE
Q ss_conf             9999999999998544386997553288379779844-------14443245888899999999961975-626685798
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA-------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFS  244 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~-------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~  244 (257)
                      +||.+|||+||.||+++|||||+|+||+|+|+|..+.       ....+.+|+++|||||+++.||||++ +|+|||+|.
T Consensus       151 aal~~ltk~lA~ela~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~pl~R~g~p~eia~~v~fL~S~~a~~iTG~~i~  230 (237)
T PRK12742        151 SALQGMARGLARDFGPRGITINVVQPGPIDTDANPANGPMRDLMHSFMAIKRHGRPEEVAGMVAWLAGPEASFVTGAMHT  230 (237)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             99999999999997402979999962788888886771799999825998998789999999999958653575588177


Q ss_pred             ECCCCE
Q ss_conf             768763
Q gi|254780337|r  245 VPQNRF  250 (257)
Q Consensus       245 vdgG~~  250 (257)
                      ||||..
T Consensus       231 VDGG~~  236 (237)
T PRK12742        231 IDGAFG  236 (237)
T ss_pred             ECCCCC
T ss_conf             485969


No 131
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=391.63  Aligned_cols=236  Identities=18%  Similarity=0.234  Sum_probs=205.7

Q ss_pred             CCCCCEEEEECCCC--HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             24889999938998--6889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   15 NLDNRLALVTGSSR--GIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        15 ~l~~K~alVTGas~--GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .|+||++|||||++  |||.++|+.|+++|++|++++|++...+.+++..++.|.+. ..++|++|+++++++++++.++
T Consensus         5 ~L~GK~alVTGaa~g~Gig~aia~~~~~~Ga~V~i~~~~~~~~~~~~~l~~~~g~~~-~~~~Dvt~~~~v~~~~~~~~~~   83 (260)
T PRK06603          5 LLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNF-VSELDVTNPKSISNLFDDIKEK   83 (260)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCE-EEECCCCCHHHHHHHHHHHHHH
T ss_conf             689998999899996689999999999879999996686799999999998438376-9865799999999999999998


Q ss_pred             HCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             1898799876875888---8886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   93 WGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      ||++|+||||||+...   ..++.|.+.++|++++++|++++|+++|++.|+|  +++|+|||++|..+.++.|++++|+
T Consensus        84 ~G~iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~a~~~m--~~~GsIi~iss~~~~~~~p~~~~Y~  161 (260)
T PRK06603         84 WGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALM--HDGGSIVTLTYYGAEKVIPNYNVMG  161 (260)
T ss_pred             HCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             69977899644237776567751029899999999999899999999977874--1797302342210013478642006


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             8999999999999998544386997553288379779844----------14443245888899999999961975-626
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
                      +||+||.+|||+||.||+++|||||+|+||+|+|++....          ....|.+|+++|||||++++||+|++ +|+
T Consensus       162 asKaal~~ltr~lA~ela~~gIRVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~~~FLaSd~s~~i  241 (260)
T PRK06603        162 VAKAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSELSKGV  241 (260)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             65999999999999996634808999732776564222046779999999857998999599999999999966822372


Q ss_pred             CCCEEEECCCCEECC
Q ss_conf             685798768763154
Q gi|254780337|r  239 TGKLFSVPQNRFVNY  253 (257)
Q Consensus       239 tG~~~~vdgG~~~n~  253 (257)
                      |||+|.||||..+..
T Consensus       242 TG~~i~vDGG~si~g  256 (260)
T PRK06603        242 TGEIHYVDCGYNIMG  256 (260)
T ss_pred             CCCEEEECCCCCCCC
T ss_conf             587178897980138


No 132
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=391.10  Aligned_cols=239  Identities=19%  Similarity=0.220  Sum_probs=207.7

Q ss_pred             CCCCCEEEEEC--CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             24889999938--9986889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   15 NLDNRLALVTG--SSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        15 ~l~~K~alVTG--as~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .|+||++||||  +++|||+++|+.|+++|++|+++++.....+++++...+.+ ....++||++++++++++++++.++
T Consensus         3 ~L~gK~~lVTGa~~~~GIG~aia~~la~~Ga~v~~~~~~~~~~~~~~~~~~~~g-~~~~~~~Dv~~~~~v~~~~~~~~~~   81 (261)
T PRK08690          3 FLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELD-SELVFRCDVASDDEINQVFADLGKH   81 (261)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             999988999898786389999999999859999997376155999999998739-8089988999999999999999999


Q ss_pred             HCCCCEEEECCCCCCCC---CC-HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             18987998768758888---88-676599999999999989999999999999986089869997883564788983688
Q gi|254780337|r   93 WGKLDILIANAGILGSI---SP-IWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~---~~-~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      ||+||+||||||+....   .+ +++++.+.|+..+++|+.+.+.++|++.|.|+ ++.|+|||++|.++.++.|++.+|
T Consensus        82 ~G~iD~LVnnaG~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~g~Ii~iss~~~~~~~~~~~~y  160 (261)
T PRK08690         82 WDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMR-GRNSAIVALSYLGAVRAIPNYNVM  160 (261)
T ss_pred             HCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCEEEEEEEEEECCCCCCCHH
T ss_conf             6898789752554763334542475615999999999876778999998768760-578414654333200156631045


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             98999999999999998544386997553288379779844----------14443245888899999999961975-62
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      ++||+|+.+|||++|.||+++|||||+|+||+|+|++....          ....|.+|+++|||||++++||+|++ +|
T Consensus       161 ~~sKaal~~ltr~lA~el~~~gIRVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~peeia~~v~FL~Sd~ss~  240 (261)
T PRK08690        161 GMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSSG  240 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             78899999999999997258968998987778855444247876999999986799899949999999999993855247


Q ss_pred             CCCCEEEECCCCEECCCC
Q ss_conf             668579876876315437
Q gi|254780337|r  238 ETGKLFSVPQNRFVNYLT  255 (257)
Q Consensus       238 ~tG~~~~vdgG~~~n~~~  255 (257)
                      +|||+|.||||..+|+|.
T Consensus       241 iTG~~i~VDGG~ti~~~~  258 (261)
T PRK08690        241 ITGEITYVDGGYSINALS  258 (261)
T ss_pred             CCCCEEEECCCCCCCCCC
T ss_conf             058639979693013428


No 133
>PRK07109 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=388.96  Aligned_cols=222  Identities=23%  Similarity=0.302  Sum_probs=206.8

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |...|+||++||||||+|||+++|++|+++|++|++++|+++.++++.+++++.|.++.++++|++|+++++++++++.+
T Consensus         2 ~~k~l~~KvVvITGASsGIGra~A~~fA~~Ga~Vvl~aR~~~~L~~~a~e~~~~G~~~~~~~~DVsd~~~v~~~~~~~~~   81 (338)
T PRK07109          2 MLKPLGRQVVVITGASAGVGRATARAFARRGAKVVLLARGEEGLEGLAAEIRAAGGEALAVVADVADAEAVQAAADRAEE   81 (338)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             99606989899948434999999999998799899998999999999999996398189998017999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +||+||+||||||+. .++++++++.|+|+++++||++|+++++|.++|+|++++.|+|||++|.+|+++.|+.++||+|
T Consensus        82 ~~G~IDvlVNNAGi~-~~g~~~~~~~e~~~~vi~vNl~G~v~~t~aaLp~m~~~~~G~IInvsSvag~~~~P~~saY~AS  160 (338)
T PRK07109         82 ELGPIDTWVNNAMVT-VFGPFEDVTPEEFRRVTDVTYLGVVHGTLAALRHMRPRDRGAIIQVGSALAYRSIPLQSAYCAA  160 (338)
T ss_pred             HHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCHHHHH
T ss_conf             849988886546667-7876322999999999877518999999999999986799789998895554578998179999


Q ss_pred             HHHHHHHHHHHHHHHHHH--CCEEEEECCCCCCCHHHHHHCC-----CCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999999999985443--8699755328837977984414-----44324588889999999996197
Q gi|254780337|r  172 KAAIEALARTWSKETVNT--ALRVINIDPGPTRTSMRAKAMP-----AEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~--gIrvn~I~PG~v~T~m~~~~~~-----~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      |+||.+||++|+.|+..+  +|+|+.|+||.||||++.....     .+++.-+-+||.+|++|++++..
T Consensus       161 K~Av~GftesLr~EL~~~~s~I~Vt~V~Pg~VdTP~f~~~~n~~~~~~~~~pp~~~pe~vA~ai~~~a~~  230 (338)
T PRK07109        161 KHAIRGFTDSLRCELLHDGSPVSVTMVQPPAVNTPQFDWARSYLPVEPQPVPPIYQPEVVADAILFAAEH  230 (338)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999999999998679981899975798779742444523798888999998989999999999748


No 134
>PRK06924 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=391.06  Aligned_cols=227  Identities=26%  Similarity=0.385  Sum_probs=202.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999999999998189879
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      |+||||||++|||+++|++|+++|++|++++|++++......+  ..+.++.++++|++|.++++.+++.+.+.++..|+
T Consensus         2 K~alITGas~GIG~aiA~~la~~G~~V~~~~r~~~~~~~~~~~--~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~~~~~~   79 (251)
T PRK06924          2 RYVIITGTSKGLGEAIATQLLEKGTSVISISRRENKELTKLAE--QYNSNLTFHSLDLQDLHNLETNFNEILSSIQEDDV   79 (251)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHH--HHCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCC
T ss_conf             9999929874999999999998799999997982278999998--74689369999705899999999999998643156


Q ss_pred             ----EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             ----987687588888867659999999999998999999999999998608-986999788356478898368898999
Q gi|254780337|r   99 ----LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        99 ----lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                          ||||||+..+..++++.+.|+|++++++|++|+|+++|.++|+|++++ .|+|||++|.++..|.|++++|++||+
T Consensus        80 ~~i~LVnNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~~~~~~~~~~g~IvnisS~a~~~~~~~~~~Y~aSKa  159 (251)
T PRK06924         80 SSIHLINNAGMVAPIKPAEKAESEQLITHVHINLLAPMILTSTFMKHTKDWKVDKRVINISSGAAKNPYFGWSAYCSSKA  159 (251)
T ss_pred             CCEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCCCCCCHHHHHHHH
T ss_conf             86489954876455686211999999999987609999999999999998479985499972432589999769999999


Q ss_pred             HHHHHHHHHHHHHHHH--CCEEEEECCCCCCCHHHHHHC--------------CCCCCCCCCCHHHHHHHHHHHHCHHHC
Q ss_conf             9999999999985443--869975532883797798441--------------444324588889999999996197562
Q gi|254780337|r  174 AIEALARTWSKETVNT--ALRVINIDPGPTRTSMRAKAM--------------PAEDPNTVPHPQKVAKIISFLCATQKI  237 (257)
Q Consensus       174 al~~lt~~la~E~~~~--gIrvn~I~PG~v~T~m~~~~~--------------~~~~~~~~~~pediA~~v~fL~s~~~~  237 (257)
                      ||.+|||+||.|++++  +||||+|+||+|+|+|+....              +..+.+|+++|||||++++||+|+++|
T Consensus       160 al~~ltk~lA~E~~~~~~~I~v~av~PG~v~T~m~~~~~~~~~~~~~~~~~~~~~~~~gr~~~PeevA~~v~fL~s~~~f  239 (251)
T PRK06924        160 GLNMFTQTVATEQEEEEYPVKIIAFSPGVMDTNMQAQIRSSSKEDFTNLDRFITLKEEGKLLSPEYVAGALRNLLETEDF  239 (251)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             99999999999837159998999984078847456777430244399999876478789997999999999999778999


Q ss_pred             CCCCEEEECC
Q ss_conf             6685798768
Q gi|254780337|r  238 ETGKLFSVPQ  247 (257)
Q Consensus       238 ~tG~~~~vdg  247 (257)
                      +|||+|.||+
T Consensus       240 itG~vi~vD~  249 (251)
T PRK06924        240 PNGEVYDIKE  249 (251)
T ss_pred             CCCCEEEECC
T ss_conf             9987775178


No 135
>PRK07806 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=389.57  Aligned_cols=228  Identities=23%  Similarity=0.251  Sum_probs=204.5

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789-89999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~-~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .+|+||+||||||++|||+++|++|+++|++|++++|+ .++++++.+++++.|.++.++++|++|+++++++++++.++
T Consensus         2 ~~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~a~~~~~~i~~~g~~a~~~~~Dvtd~~~v~~l~~~~~~~   81 (248)
T PRK07806          2 DDLPGKIALVTGSSRGIGAEVAKYLAGAGAHVVVNYRNKAARAEKVVAEIRAAGGRASAVGADLTDEASVAALMDAIRAE   81 (248)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             89899889993788599999999999879989998389568999999999961983999978999999999999999998


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH-----CCCCCCCHH
Q ss_conf             189879987687588888867659999999999998999999999999998608986999788356-----478898368
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA-----YKCRPLWGA  167 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g-----~~~~~~~~~  167 (257)
                      ||++|+||||||... ..++      +++..+++|+.++|+++|.++|.|.+  +|+|||++|..+     ..+.|.+.+
T Consensus        82 ~G~iDiLVnNAg~~~-~~~~------~~~~~~~~n~~~~~~~~~~~~p~m~~--gg~Ii~isS~~~~~~~~~~~~p~~~~  152 (248)
T PRK07806         82 FGGLDALVLNASGGM-ESGM------DPDYAMRLNRDAQRRLLTLALPLMPA--GSRVVFVTSHQAHFIPTVKTMPEYEA  152 (248)
T ss_pred             CCCCCEEEECCCCCC-CCCC------CHHHHHHHHHHHHHHHHHHHHHHHCC--CCEEEEECCCHHHCCCCCCCCCCCHH
T ss_conf             499989998999987-7899------72268999989999999999977504--97899985516615687777866289


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC----------CCCCCCCCCHHHHHHHHHHHHCHHHC
Q ss_conf             89899999999999999854438699755328837977984414----------44324588889999999996197562
Q gi|254780337|r  168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP----------AEDPNTVPHPQKVAKIISFLCATQKI  237 (257)
Q Consensus       168 Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~----------~~~~~~~~~pediA~~v~fL~s~~~~  237 (257)
                      |++||+|+..++++|+.||+++|||||+|+||+++|++......          ..|.+|+++|||||++|.||+|+ .|
T Consensus       153 y~asK~A~~~~~~~la~ela~~gIrvn~v~pg~i~t~~~~~~~~~~~~~~~~~~~~p~gR~g~pediA~av~fLas~-~~  231 (248)
T PRK07806        153 VAASKRAGEDALRALRPELAHAGIGFVVVSGDMIEGTVTATLLNRLNPGAIDARRAAAGKLYTVSEFAAEVARAVTA-PV  231 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHHHHCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHCC-CC
T ss_conf             99999999999999999977659889997279878514444323724468987506778998989999999999579-98


Q ss_pred             CCCCEEEECCCCEE
Q ss_conf             66857987687631
Q gi|254780337|r  238 ETGKLFSVPQNRFV  251 (257)
Q Consensus       238 ~tG~~~~vdgG~~~  251 (257)
                      +|||+|.||||.++
T Consensus       232 ~TGqti~VdGG~~~  245 (248)
T PRK07806        232 PAGHIVYVGGADYF  245 (248)
T ss_pred             CCCCEEEECCHHHH
T ss_conf             99998998877886


No 136
>PRK05872 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=391.72  Aligned_cols=216  Identities=26%  Similarity=0.326  Sum_probs=198.1

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      .+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++   +.++.++.+|++|+++++++++++.++|
T Consensus         5 ~~L~gKvalITGassGIG~aiA~~la~~Ga~Vvl~dr~~~~l~~~~~~l---g~~~~~~~~DVtd~~~v~~~v~~i~~~~   81 (296)
T PRK05872          5 TSLDGKVVFVTGAARGVGAELARRLHARGAKVALVDLEEAELAALAAEL---GDRVLTVVADVTDLAAMQAAAEEAVERF   81 (296)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH---CCCEEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             8859987999271058999999999987998999989999999999983---8873899982799999999999999971


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ..+++++++.|+|+++++||++|+|+++|+++|+|++++ |+||||||.+|+.+.|+.++||+||+
T Consensus        82 G~iDiLVnNAGi~-~~~~~~~~~~e~~~~v~dVNl~G~~~~~ra~lp~m~~~~-G~IVnisS~ag~~~~p~~~aY~ASKa  159 (296)
T PRK05872         82 GGIDVVVANAGIA-SYGSVLQVDPAAFRRVIDVNLLGVFHTVRATLPAVIERR-GYVLQVSSLAAFAAAPGMAPYCASKA  159 (296)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEECHHHHCCCCCCCHHHHHHH
T ss_conf             9987876556257-997642199899725842445999999999999999779-98999960543245899807999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC------------CCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999999998544386997553288379779844144------------4324588889999999996197
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA------------EDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~------------~~~~~~~~pediA~~v~fL~s~  234 (257)
                      |+.+||++|+.|++++|||||+|+||+|+|||.......            .+..+...||++|++++.-...
T Consensus       160 av~~~t~sLa~Ela~~GIrVn~V~PG~V~T~m~r~a~~~~~~~~~~~~~~p~p~~~~~~~~~~a~~i~~~i~r  232 (296)
T PRK05872        160 GVEAFANALRLEVAHRGVSVGSAYLSWIDTDLVRDADADLPAFRELRARLPWPLNRTTSVEKCAAAFVDGIER  232 (296)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999999984001938999970889775674766457556788612899878865999999999999844


No 137
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=390.35  Aligned_cols=235  Identities=17%  Similarity=0.205  Sum_probs=208.4

Q ss_pred             EEECCCCCEEEEECCC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             2652488999993899--86889999999988998999978989999999999864992899987899999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSS--RGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        12 m~~~l~~K~alVTGas--~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      |.-.|+||++|||||+  +|||+++|+.|+++|++|++++|+++..+++.+.   .+.++.+++||++|+++++++++++
T Consensus         1 M~g~L~gK~~lVTGaag~~GIG~a~A~~la~~Ga~Vv~~~~~~~~~~~~~~~---~~~~~~~~~~Dvs~~~~v~~~~~~~   77 (252)
T PRK06079          1 MSGILSGKKIVVMGVANKRSIAWGCAQAIKDQGATVIYTYQNDRMKKSLQKL---VDEEDLLVECDVASDESIERAFAQI   77 (252)
T ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH---CCCCCEEEEEECCCHHHHHHHHHHH
T ss_conf             9661399889998999987799999999998699999984887999999985---0888659995189999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCH
Q ss_conf             9981898799876875888---8886765999999999999899999999999999860898699978835647889836
Q gi|254780337|r   90 AKRWGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG  166 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~  166 (257)
                      .++||++|+||||||+..+   ..++.+.+.++|+..+++|+.+.+.++|++.|+|+  +.|+|||++|.++.++.|++.
T Consensus        78 ~~~~G~iD~lVnnag~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~--~~g~Iv~iss~~~~~~~p~~~  155 (252)
T PRK06079         78 KERFGKIDGIVHAIAYAKKEELGGNVTDTSRDGYALAQDISAYSLIAVAKYARPLLN--PPASIVTLTYFGSERAIPNYN  155 (252)
T ss_pred             HHHHCCCCEEEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCEEEEEEEEECCCCCCCCC
T ss_conf             998688873443320257310246444388999999998888999999988876403--577067886440345577741


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-
Q ss_conf             8898999999999999998544386997553288379779844----------14443245888899999999961975-
Q gi|254780337|r  167 AYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-  235 (257)
Q Consensus       167 ~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-  235 (257)
                      +|++||+|+.+|||+||.||+++|||||+|+||+|+|++....          ....+.+|+++|||||++++||||++ 
T Consensus       156 ~y~aaKaal~~ltr~lA~ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~p~gr~~~peeia~~v~FL~Sd~a  235 (252)
T PRK06079        156 VMGIAKAALESSVRYLARDLGKKGIRVNAISAGAIKTLAVTGIKGHGDLLKESDSRTVDGVSVTIEEVGNVAAFLLSDLS  235 (252)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHH
T ss_conf             01778999999999999998438989999963778770101566789999999857998999899999999999948541


Q ss_pred             HCCCCCEEEECCCCEE
Q ss_conf             6266857987687631
Q gi|254780337|r  236 KIETGKLFSVPQNRFV  251 (257)
Q Consensus       236 ~~~tG~~~~vdgG~~~  251 (257)
                      +|+|||+|.||||..|
T Consensus       236 ~~iTGq~i~VDGG~~L  251 (252)
T PRK06079        236 TGVTGDIIYVDKGVHL  251 (252)
T ss_pred             CCCCCCEEEECCCHHC
T ss_conf             6825972897949201


No 138
>PRK07201 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=390.04  Aligned_cols=220  Identities=26%  Similarity=0.366  Sum_probs=200.6

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             65248899999389986889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .-.|+||+|||||||+|||+++|++||++|++|++++|++++++++++++++.|+++..++||++|+++++.+++++.++
T Consensus       371 ~g~L~GKvalITGASSGIG~A~A~~LA~~GA~Vvl~AR~~e~Le~v~~ei~~~Gg~a~~~~~DVtd~~~v~~lv~~i~~~  450 (663)
T PRK07201        371 RGPLEGKHVIITGASSGIGRATAIKVAEAGATVFALARDGEKLDELVAEIRARGGQAHAYTCDLTDSASVEHTVKDILGR  450 (663)
T ss_pred             CCCCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             88879947999388759999999999987998999989999999999999955991899996279999999999999996


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCC--HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             189879987687588888867659--999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIK--EKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~--~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      +|++|+||||||+.. ..++.+.+  .+||+++|+||++|+++++|.++|.|++++.|+||||||.+++.+.|.+++|++
T Consensus       451 ~G~IDVLVNNAG~si-~~~~~~~~d~~~d~er~m~vN~~G~v~l~~a~lP~M~~r~~G~IVNISSiag~~~~P~~saYsA  529 (663)
T PRK07201        451 HGHVDYLVNNAGRSI-RRSVVNSTDRFHDYERTMQLNYFGAVRLVLGLLPHMRERRFGHVVNISSIGVQTNAPRFSAYVA  529 (663)
T ss_pred             CCCCCEEEECCCCCC-CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCCCHHHHH
T ss_conf             799888998964467-5750113454999999999974999999999999888539939999755654778998649999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             9999999999999985443869975532883797798441444324588889999999996197
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~  234 (257)
                      ||+||.+||++|+.|++++|||||+|+||.|+|||....- ........+|||+|++|++.+-.
T Consensus       530 SKaAl~aftr~La~Ela~~GVrVttI~PG~V~TpMiapt~-~y~~~p~l~pe~aA~~i~~a~~~  592 (663)
T PRK07201        530 SKAALDAFARVAASETLSDGITFTNIHMPLVRTPMIAPTK-RYNPVPTLSPEEAADMVARALVE  592 (663)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999999999983757828999715971788778752-22789989999999999999851


No 139
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=388.36  Aligned_cols=237  Identities=14%  Similarity=0.182  Sum_probs=212.9

Q ss_pred             ECCCCCEEEEECCC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             52488999993899--86889999999988998999978989999999999864-9928999878999999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSS--RGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        14 ~~l~~K~alVTGas--~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      |+|+||++|||||+  +|||+++|+.|+++|++|++++|+++..+++.+.+++. +.++.+++||++|+++++++++++.
T Consensus         2 ~~L~gK~~lVTGaag~rGIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~   81 (256)
T PRK08594          2 LSLEGKTYVVMGVANKRSIAWGIARSLHNAGAKLVFTYAGERLEKEVRELAETLEQQESLVLPCDVTSDEEITACFETIK   81 (256)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             89999889998999996399999999998799999974880669999999987079947999913899999999999999


Q ss_pred             HHHCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHH
Q ss_conf             981898799876875888---88867659999999999998999999999999998608986999788356478898368
Q gi|254780337|r   91 KRWGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA  167 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~  167 (257)
                      ++||++|+||||||+...   ..++.+.+.++|...+++|..+.+.++|++.|.|.+  .|+|||++|.++..+.|++.+
T Consensus        82 ~~~g~id~lv~na~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~GsIv~iss~~~~~~~~~~~~  159 (256)
T PRK08594         82 KEVGVIHGVAHCIAFANKEDLRGEFLETSRDGFLLAQNISAYSLTAVAREAKKLMTE--GGSIVTLTYLGGERVVQNYNV  159 (256)
T ss_pred             HHHCCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCEEEEEEEECCEECCCCCCH
T ss_conf             985886746653210234444553001889999998855436777888888765357--866998520011112687413


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH----------HCCCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             89899999999999999854438699755328837977984----------414443245888899999999961975-6
Q gi|254780337|r  168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK----------AMPAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       168 Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~----------~~~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      |++||+|+.+|||+||.||+++|||||+|+||+|+|++.+.          .....|.+|+++|||||++++||||++ +
T Consensus       160 y~asKaal~~ltr~lA~ela~~gIRVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fL~Sd~s~  239 (256)
T PRK08594        160 MGVAKASLEASVKYLANDLGKDGIRVNAISAGPIRTLSAKGVGGFNSILKEIEERAPLRRTTTQEEVGDTAAFLFSDLSR  239 (256)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             57789999999999999853888399998637787712331557399999999679999996999999999999584524


Q ss_pred             CCCCCEEEECCCCEEC
Q ss_conf             2668579876876315
Q gi|254780337|r  237 IETGKLFSVPQNRFVN  252 (257)
Q Consensus       237 ~~tG~~~~vdgG~~~n  252 (257)
                      |+|||+|.||||..+.
T Consensus       240 ~iTGq~i~VDGG~~i~  255 (256)
T PRK08594        240 GVTGENIHVDSGYHII  255 (256)
T ss_pred             CCCCCEEEECCCCCCC
T ss_conf             8558728979598577


No 140
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=388.31  Aligned_cols=238  Identities=18%  Similarity=0.229  Sum_probs=207.3

Q ss_pred             CCCCCEEEEECCC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             2488999993899--86889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   15 NLDNRLALVTGSS--RGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        15 ~l~~K~alVTGas--~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      -|+||++||||++  +|||+++|+.|+++|++|++++|+++..+++.+...+.+ ....++||++|+++++++++++.++
T Consensus         7 ~L~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g-~~~~~~~Dvtd~~~v~~~v~~~~~~   85 (272)
T PRK08159          7 LMQGKRGLILGVANNRSIAWGIAKACRAAGAELAFTYQGDALKKRVEPLAAELG-AFVVGHCDVTDEASIDAVFETLEKK   85 (272)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCC-CEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             358999999889998689999999999869999997486689999999998649-8189983789999999999999998


Q ss_pred             HCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             1898799876875888---8886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   93 WGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      ||++|+||||||+...   ..++.|+++++|++++++|+.+.+.++|++.|.|.+  +|+||++||..+..+.|++.+|+
T Consensus        86 ~G~iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~--ggsIv~iss~~~~~~~p~~~~y~  163 (272)
T PRK08159         86 WGKLDFVVHAIGFSDKDELTGRYVDTSEDNFSMTMLISVYSLTAVAQRAEKLMTD--GGSILTLTYYGAEKVMPHYNVMG  163 (272)
T ss_pred             HCCCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCEEEEEEECCCCCCCCCCHHH
T ss_conf             6997889853544666445665432889999999988868999999887654047--87034787541233477520256


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             8999999999999998544386997553288379779844----------14443245888899999999961975-626
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
                      +||+|+.+|||+||.||+++|||||+|+||+++|++....          ....|.+|+++|||||++++||||++ +|+
T Consensus       164 ~sKaAl~~ltr~lA~elg~~gIRVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~pl~R~g~pedvA~av~fL~Sd~s~~i  243 (272)
T PRK08159        164 VAKAALEASVRYLAVDLGPKNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIEEVGDSALYLLSDLSRGV  243 (272)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             78999999999999975789989999863777771000487789999868737997898499999999999958621585


Q ss_pred             CCCEEEECCCCEECCCC
Q ss_conf             68579876876315437
Q gi|254780337|r  239 TGKLFSVPQNRFVNYLT  255 (257)
Q Consensus       239 tG~~~~vdgG~~~n~~~  255 (257)
                      |||+|.||||+.++.-.
T Consensus       244 TGq~l~VDGG~~~~g~~  260 (272)
T PRK08159        244 TGEVHHVDSGYHVVGMK  260 (272)
T ss_pred             CCCEEEECCCHHHHCCC
T ss_conf             48708879692621888


No 141
>PRK06181 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=387.64  Aligned_cols=215  Identities=27%  Similarity=0.376  Sum_probs=197.2

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             89999938998688999999998899899997898999999999986499289998789999999999999999818987
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      ||++||||||+|||+++|++|+++|++|++++|++++++++.+++++.|.++..++||++|+++++++++++.++||++|
T Consensus         1 GKv~lITGassGIG~a~A~~la~~Ga~vvl~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvs~~~~~~~~~~~~~~~~G~iD   80 (263)
T PRK06181          1 GKVVIITGASEGIGRALAVRLARAGARLVLAARNEERLASLAQELANYGAEALVVATDVSDAEACERLIEAAVAHFGGID   80 (263)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             99999958101999999999998799899998899999999999995499679998079999999999999999829964


Q ss_pred             EEEECCCCCCCCCCHHHCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             99876875888888676599-99999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKE-KSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~-e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      +||||||+. ..+++.+.++ ++|+++++||++|+|+++|+++|+|++++ |+||||+|.+|+.+.|+.++|++||+|+.
T Consensus        81 iLVNNAGi~-~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~-G~IvnisS~ag~~~~p~~~~Y~aSK~av~  158 (263)
T PRK06181         81 ILVNNAGMT-MWSRFDELTDLSVLEDVMRVNYLGAVYCTHAALPHLKASQ-GQIVVVSSLAGLTGVPTRSGYAASKHALH  158 (263)
T ss_pred             EEEECCCCC-CCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEECHHHCCCCCCCHHHHHHHHHHH
T ss_conf             899878567-8887232686999999999982999999999999986389-37999947555277899735999999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC---------CCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999998544386997553288379779844144---------4324588889999999996197
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA---------EDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~---------~~~~~~~~pediA~~v~fL~s~  234 (257)
                      +||++|+.|++++|||||+|+||+|+|+|..+....         .+..++..||++|+.++.-+..
T Consensus       159 ~~t~~la~El~~~gIrVn~v~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~pe~vA~~i~~ai~~  225 (263)
T PRK06181        159 GFFDSLRIELADTGVAVTVVCPGFVATDIRKRALDGDGKPLGKSPMQEGKIMSAEECAEMMLPAIAR  225 (263)
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999984755939999972889897470014445552346744356789999999999999966


No 142
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=388.90  Aligned_cols=245  Identities=21%  Similarity=0.308  Sum_probs=201.7

Q ss_pred             CEEECCCCCEEEEECC--CCHHHHHHHHHHHHCCCEEEEEECCH--------HHHHHHHHHHH-HCC-----CCEEEEEC
Q ss_conf             3265248899999389--98688999999998899899997898--------99999999998-649-----92899987
Q gi|254780337|r   11 EIHVNLDNRLALVTGS--SRGIGYYTALELARSGAYVIACGRSI--------SQLEKLKNALQ-KIN-----KKIDIFAF   74 (257)
Q Consensus        11 ~m~~~l~~K~alVTGa--s~GIG~a~a~~la~~G~~Vi~~~r~~--------~~l~~~~~~~~-~~g-----~~~~~~~~   74 (257)
                      +|+++|+||+|||||+  ++|||+++|+.|+++|++|++.+|..        .++.+.....+ ..+     .++....+
T Consensus         1 mm~l~L~GKvAlVTGaGgs~GIG~aiA~~lA~~GA~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (298)
T PRK06300          1 MLKIDLTGKVAFIAGIGDDQGYGWGIAKMLAEAGATIIVGTWVPIYKIFSQSWELGKFNESRKLSNGELLTIAKIYPMDA   80 (298)
T ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHCEEEEECC
T ss_conf             99889999979990879986299999999998299999923753024555688765568888750563000034653003


Q ss_pred             C----------CCCHH--------HHHHHHHHHHHHHCCCCEEEECCCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             8----------99999--------9999999999981898799876875888-888676599999999999989999999
Q gi|254780337|r   75 D----------LRDSN--------ALELTKTYIAKRWGKLDILIANAGILGS-ISPIWQIKEKSFADVISVNVMANWNIM  135 (257)
Q Consensus        75 D----------v~d~~--------~v~~~~~~~~~~~g~iDilVNNAGi~~~-~~~~~~~~~e~~~~~~~vNl~g~~~l~  135 (257)
                      |          +++.+        +++++++++.++||+|||||||||.... ..|+.|++.++|...+++|+++++.++
T Consensus        81 ~~~~~~~v~~di~~~~~~~~l~~~~v~~~v~~~~~~fG~iDiLVnna~~~~~~~~~~~e~~~~~~~~~~~~n~~~~~~~~  160 (298)
T PRK06300         81 SFDKPEDVPEDIAENKRYKGISGYTISEVVEQVKKDFGHIDILVHSLANSPEISKPLLETSRKGYLAALSTSSYSFVSLL  160 (298)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHH
T ss_conf             45743230577765665410015799999999998779977899899888756778455899999999989849999999


Q ss_pred             HHHHHHHHHCCCCEEEEECCHHHCCCCCCC-HHHHHHHHHHHHHHHHHHHHHHHH-CCEEEEECCCCCCCHHHHHH----
Q ss_conf             999999986089869997883564788983-688989999999999999985443-86997553288379779844----
Q gi|254780337|r  136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLW-GAYSASKAAIEALARTWSKETVNT-ALRVINIDPGPTRTSMRAKA----  209 (257)
Q Consensus       136 ~~~~~~m~~~~~G~IInisS~~g~~~~~~~-~~Y~asKaal~~lt~~la~E~~~~-gIrvn~I~PG~v~T~m~~~~----  209 (257)
                      |++.|.|.+  +|+|||++|.++.++.|++ ++|++||+||.+|||+||.||+++ |||||+|+||+++|+|....    
T Consensus       161 ~~~~p~m~~--~G~ii~i~s~~~~~~~p~~~~~ysasKaal~~lTr~lA~E~g~~ygIRVNaI~PG~i~T~~~~~~~~~e  238 (298)
T PRK06300        161 SHFGPIMNA--GGSTISLTYLASMRAVPGYGGGMSAAKAALESDTKTLAWEAGRRWGIRVNTISAGPLASRAGKAIGFIE  238 (298)
T ss_pred             HHHHHHHHC--CCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCH
T ss_conf             999999763--894477543001344677403679999999865999999857011808999854864471232146629


Q ss_pred             ------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCCCEECCCCCC
Q ss_conf             ------14443245888899999999961975-6266857987687631543799
Q gi|254780337|r  210 ------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNRFVNYLTPN  257 (257)
Q Consensus       210 ------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG~~~n~~~p~  257 (257)
                            ....|.+|+++|||||++++||||++ +|+|||+|.||||..+...-|+
T Consensus       239 ~~~~~~~~~~Pl~R~g~peeiA~~v~FLaSd~as~ITG~~i~VDGG~si~G~~~~  293 (298)
T PRK06300        239 RMVDYYQDWAPLPEPMEAEQVGAVAAFLVSPLASAITGETLYVDHGANVMGIGPE  293 (298)
T ss_pred             HHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCCCCCCHH
T ss_conf             9999998579989998999999999998084006957887878959634548833


No 143
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=386.36  Aligned_cols=233  Identities=20%  Similarity=0.220  Sum_probs=206.2

Q ss_pred             CCCCCEEEEEC--CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             24889999938--9986889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   15 NLDNRLALVTG--SSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        15 ~l~~K~alVTG--as~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .|+||++||||  +++|||+++|+.|+++|++|++++++++..+++.+...+.+.. ..++||++|+++++++++++.++
T Consensus         3 ~L~GK~~lVTG~a~~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~-~~~~~Dv~~~~~v~~~v~~~~~~   81 (260)
T PRK06997          3 FLAGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSD-LVFPCDVADDAQIDALFASLGTR   81 (260)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCC-EEEECCCCCHHHHHHHHHHHHHH
T ss_conf             89998899989988728999999999985999999808806699999999862984-79983799999999999999998


Q ss_pred             HCCCCEEEECCCCCCC---CCC-HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             1898799876875888---888-676599999999999989999999999999986089869997883564788983688
Q gi|254780337|r   93 WGKLDILIANAGILGS---ISP-IWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~---~~~-~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      ||++|+||||||+...   ..+ +++++.++|+..+++|+.+++.++|+++|+|  ++.|+||+++|..+.++.|++.+|
T Consensus        82 ~g~iD~LVnNAG~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~k~~~~~~--~~~g~iv~iss~~~~~~~p~~~~y  159 (260)
T PRK06997         82 WDGLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPML--SDDASLLTLSYLGAERVVPNYNTM  159 (260)
T ss_pred             HCCCCEEEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCCCCCCCEEEECEECCCCCCHH
T ss_conf             499898964477677322353346655899999999988899999999998763--167763230122010036874223


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             98999999999999998544386997553288379779844----------14443245888899999999961975-62
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      ++||+|+.+|||+||.||+++|||||+|+||+++|++....          ....|.+|+++|||||++++||+|++ +|
T Consensus       160 ~asKaal~~ltr~lA~elg~~gIRVNaV~PG~i~t~~~~~~~~~~~~~~~~~~~~Pl~R~g~peeiA~~v~FL~Sd~as~  239 (260)
T PRK06997        160 GLAKASLEASVRYLAVSLGPKGIRVNAISAGPIKTLAASGIKDFGKILDFVESNAPLRRNVTIEQVGNVAAFLLSDLASG  239 (260)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             77889999999999998611797898873375335665268975999999985799899959999999999995835337


Q ss_pred             CCCCEEEECCCCE
Q ss_conf             6685798768763
Q gi|254780337|r  238 ETGKLFSVPQNRF  250 (257)
Q Consensus       238 ~tG~~~~vdgG~~  250 (257)
                      +|||+|.||||..
T Consensus       240 iTGq~i~VDGG~s  252 (260)
T PRK06997        240 VTGEITHVDSGFN  252 (260)
T ss_pred             CCCCEEEECCCHH
T ss_conf             0587268797852


No 144
>PRK05866 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=387.07  Aligned_cols=220  Identities=25%  Similarity=0.311  Sum_probs=195.0

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      +-.++|+||+|||||||+|||+++|++|+++|++|++++|++++++++.+++.+.|+++..++||++|+++++++++++.
T Consensus        33 ~~P~dL~GKvaLITGassGIG~aiA~~la~~Ga~Vvl~~R~~~~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~  112 (290)
T PRK05866         33 RTPVDLTGKRILLTGASSGIGEAAAEKFARRGATVVAVARRKDLLDAVADRITAAGGDAMAIPCDLSDLDAVDALVADVE  112 (290)
T ss_pred             CCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             94978999989990813099999999999869989999899999999999999649908999778898999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCH--HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-CCCCCHH
Q ss_conf             981898799876875888888676599--9999999999899999999999999860898699978835647-8898368
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKE--KSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK-CRPLWGA  167 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~--e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~-~~~~~~~  167 (257)
                      ++||++|+||||||+. ...++.+..+  +||++++++|+.|+|+++|+++|+|++++.|+||||+|..+.. +.|.+++
T Consensus       113 ~~~G~iDiLVNNAG~~-~~~~~~~~~~~~~d~~~~~~vN~~g~~~l~~~~lp~M~~~~~G~IVnisS~~~~~~~~p~~~~  191 (290)
T PRK05866        113 ERIGGVDILINNAGRS-IRRPLAESLDRWHDVERTMVLNYYAPLRLIRGLAPGMIERGDGHIINVATWGVLSEASPLFSV  191 (290)
T ss_pred             HHHCCCCEEEECCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCCCH
T ss_conf             9859988899757666-787422215779999999999839999999875099996699649999272432788988641


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             89899999999999999854438699755328837977984414443245888899999999961
Q gi|254780337|r  168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       168 Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~  232 (257)
                      |++||+|+.+||++|+.||+++|||||+|+||+|+|||...... .......+||++|+.++--.
T Consensus       192 Y~ASKaAl~~lt~sLa~El~~~gIrVn~V~PG~V~Tpm~a~~~~-~~~~~~~~pe~~A~~iv~a~  255 (290)
T PRK05866        192 YNASKAALSAVSRVIETEWGDRGVHSTTLYYPLVATPMIAPTKA-YDGLPALTADEAAEWMVTAA  255 (290)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCC-CCCCCCCCHHHHHHHHHHHH
T ss_conf             89999999999999999852619699999768898756798877-67888899999999999998


No 145
>PRK06194 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=387.24  Aligned_cols=218  Identities=21%  Similarity=0.275  Sum_probs=197.1

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      .+|+|||+|||||++|||+++|+.|+++|++|++++|+++.++++.++++..|.++.++.|||+|+++++++++++.++|
T Consensus         2 ~~l~gKvavITGassGIG~a~A~~la~~Ga~Vvl~d~~~~~l~~~~~~l~~~g~~v~~~~~DVsd~~~v~~l~~~~~~~f   81 (301)
T PRK06194          2 KDFAGKVAVITGAASGFGREFARIGARLGMKLVLADVQQDALDRAVAELRAQGAEVLGVRTDVSDAAQVEALADAALERF   81 (301)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             89899989992737799999999999879989999798899999999998459849999656899999999999999983


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC------CCEEEEECCHHHCCCCCCCHH
Q ss_conf             89879987687588888867659999999999998999999999999998608------986999788356478898368
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH------CGRAIILSSGAAYKCRPLWGA  167 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~------~G~IInisS~~g~~~~~~~~~  167 (257)
                      |++|+||||||+. ..++++|++.++|+++++||++|+|+++|+++|.|++++      .|+|||++|++|+.+.|+.++
T Consensus        82 G~iDiLVNNAGi~-~~~~~~e~~~edw~~v~~VNl~G~~~~~r~~lP~M~~~~~~~~~~~G~IVNisSiaG~~~~p~~~~  160 (301)
T PRK06194         82 GAVHLLFNNAGVG-AGGLLWENSLADWEWVLGVNLMGVIHGVRIFTPLMLAAAEKDPAYEGHIVNTASMAGLLAPPAMGV  160 (301)
T ss_pred             CCEEEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCCCCCCCCH
T ss_conf             9937999557667-888734499999999999981999999999999999768878898649999454232358999707


Q ss_pred             HHHHHHHHHHHHHHHHHHHH--HHCCEEEEECCCCCCCHHHHHHC--CCC-----CC----------------CCCCCHH
Q ss_conf             89899999999999999854--43869975532883797798441--444-----32----------------4588889
Q gi|254780337|r  168 YSASKAAIEALARTWSKETV--NTALRVINIDPGPTRTSMRAKAM--PAE-----DP----------------NTVPHPQ  222 (257)
Q Consensus       168 Y~asKaal~~lt~~la~E~~--~~gIrvn~I~PG~v~T~m~~~~~--~~~-----~~----------------~~~~~pe  222 (257)
                      |++||+||.+||++|+.|+.  +++||||+||||+|+|+|++...  |.+     ++                .....|+
T Consensus       161 Y~ASK~AV~glT~sLa~EL~~~~~~IrV~~lcPG~V~T~i~~s~r~rp~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~  240 (301)
T PRK06194        161 YNVSKHAVVSLTETLYQDLRLVTDQVGASVLCPYFVPTGIWQSHRNRPADLANDAPPTRSQLVAQAMSDKAVGSGKVSAA  240 (301)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCHH
T ss_conf             89999999999999999997569797999997288878867456558222056788763377899999989874899999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999961
Q gi|254780337|r  223 KVAKIISFLC  232 (257)
Q Consensus       223 diA~~v~fL~  232 (257)
                      |||+.|.--.
T Consensus       241 ~va~~v~~~i  250 (301)
T PRK06194        241 DVAQLVFDAI  250 (301)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999999


No 146
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR011286   This entry describes 2-deoxy-D-gluconate 3-dehydrogenase (also called 2-keto-3-deoxygluconate oxidoreductase), a member of the family of short-chain-alcohol dehydrogenases (IPR002198 from INTERPRO). This protein has been characterised in Erwinia chrysanthemi as an enzyme of pectin degradation .; GO: 0008678 2-deoxy-D-gluconate 3-dehydrogenase activity, 0051287 NAD binding.
Probab=100.00  E-value=0  Score=391.65  Aligned_cols=232  Identities=24%  Similarity=0.372  Sum_probs=219.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             524889999938998688999999998899899997-8989999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~-r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      ++|+||++||||+..|||..+|..||+.|+.|+-.+ +.  ..+++.+.+++.|.+...+.+|+.+++.++.+++++.++
T Consensus         1 FsL~GK~alvTGa~tGlGQG~a~gLA~AGadi~g~~~~~--~~~ET~~~v~~~Gr~f~~~~~Dl~~~~~~~~~~~~~~~~   78 (249)
T TIGR01832         1 FSLEGKVALVTGANTGLGQGIAVGLAEAGADIVGVGHIS--EPSETQQQVEALGRRFLSLTADLSDIEAIKALVDSAVEE   78 (249)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEECCCC--CHHHHHHHHHHHCCCEEHHHHHHHCHHHHHHHHHHHHHH
T ss_conf             987877688825988736899999985774178514312--638889999982521000212122321378999999986


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             189879987687588888867659999999999998999999999999998608-9869997883564788983688989
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +|++||||||||+.+. .+..|++++||+++|+|||+..|++||.+.++|++++ .|+||||+|+..++|--..++|++|
T Consensus        79 ~g~~DiLVNNAGIIrR-~da~~f~e~dWd~V~nvNlk~vF~l~q~~a~~~l~~G~~GkiiNIAS~LSFQGGirVPsYTAS  157 (249)
T TIGR01832        79 FGKIDILVNNAGIIRR-EDAVEFSEKDWDDVMNVNLKSVFFLTQAAAKQFLKQGRGGKIINIASLLSFQGGIRVPSYTAS  157 (249)
T ss_pred             HCCCCEEEECCCHHHH-HHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEHHHHHHCCCCCCHHHHHH
T ss_conf             1886567607422104-577515614457999866899999999999999964899505751423442267551246666


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCH----------HHHHHCCCCCCCCCCCHHHHHHHHHHHHCHHH-CCCC
Q ss_conf             999999999999985443869975532883797----------79844144432458888999999999619756-2668
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTS----------MRAKAMPAEDPNTVPHPQKVAKIISFLCATQK-IETG  240 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~----------m~~~~~~~~~~~~~~~pediA~~v~fL~s~~~-~~tG  240 (257)
                      |++|.++||.||.||+.+||.||+|+||++.|.          ..+..+...|.+||++|+|+...++||+|.++ |++|
T Consensus       158 K~~v~GlTk~lAnEWa~~ginVNAIAPGY~~T~NT~~lRaD~~Rn~~Il~RIPaGrWG~p~D~~G~aVFLaS~ASdYv~G  237 (249)
T TIGR01832       158 KHGVAGLTKLLANEWAAKGINVNAIAPGYMETNNTQALRADEDRNAAILERIPAGRWGTPEDLGGAAVFLASSASDYVNG  237 (249)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             77777789999989987388153115887664551542031777899973178999848400030688887755434365


Q ss_pred             CEEEECCC
Q ss_conf             57987687
Q gi|254780337|r  241 KLFSVPQN  248 (257)
Q Consensus       241 ~~~~vdgG  248 (257)
                      .++.||||
T Consensus       238 ~~l~VDGG  245 (249)
T TIGR01832       238 AILAVDGG  245 (249)
T ss_pred             EEEEECCC
T ss_conf             06620773


No 147
>PRK05876 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=381.62  Aligned_cols=217  Identities=23%  Similarity=0.276  Sum_probs=198.1

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      .+|+||+||||||++|||+++|++|+++|++|++++|+++.++++.++++..+.++..+.||++++++++++++++.++|
T Consensus         2 ~~~~gKvavITGaasGIG~a~A~~la~~Ga~Vvi~d~~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~v~~l~~~~~~~~   81 (275)
T PRK05876          2 DGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRLL   81 (275)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             59899879992826699999999999879989999798899999999998269847999788899999999999999984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608-98699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |+||+||||||+.. .++++++++++|+++++||++|+|+++|.++|+|++++ +|+|||++|.+|+.+.|+.++|++||
T Consensus        82 G~iDilvnNAGi~~-~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~lP~m~~~g~~G~IvntsS~agl~~~~~~~~Y~asK  160 (275)
T PRK05876         82 GHVDVVFSNAGIVV-GGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAK  160 (275)
T ss_pred             CCCCEEECCCCCCC-CCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
T ss_conf             89885121574468-98723299999999876413899999999999999819994999968677538999974699999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---CCCC--------------CCCCCCCHHHHHHHHHHH
Q ss_conf             9999999999998544386997553288379779844---1444--------------324588889999999996
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---MPAE--------------DPNTVPHPQKVAKIISFL  231 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---~~~~--------------~~~~~~~pediA~~v~fL  231 (257)
                      +|+.+||++|+.||+++|||||+||||+|+|+|....   .+..              .......|++||+.+.--
T Consensus       161 ~av~~lte~La~El~~~gI~V~~l~Pg~V~T~m~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~d~vA~~v~~~  236 (275)
T PRK05876        161 YGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSSTTGSPGPLPLQDDNLGVDDIAQLTADA  236 (275)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCHHHHHHHHHHH
T ss_conf             9999999999998511293899997188994346686523675345444334543201102699999999999999


No 148
>PRK08267 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=381.37  Aligned_cols=212  Identities=27%  Similarity=0.259  Sum_probs=192.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH-HHHHCCCC
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999999999-99818987
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI-AKRWGKLD   97 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~-~~~~g~iD   97 (257)
                      |++|||||++|||+++|++|+++|++|++++|+++.++++.+++.  +.++.++++|++|++++++.++++ .+.+|++|
T Consensus         2 K~vlITGassGIG~a~A~~~a~~G~~V~~~~r~~~~l~~~~~~l~--~~~~~~~~~Dvtd~~~v~~~~~~~~~~~~G~iD   79 (258)
T PRK08267          2 KSIFITGAASGIGRATARLFAARGWRVGAYDINEDGLAALAAELG--AERAWTGALDVTDRAAWDAALADFCAATGGRLD   79 (258)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC--CCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             989990722689999999999879999999888999999999836--996799991179999999999999999589986


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             99876875888888676599999999999989999999999999986089869997883564788983688989999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      +||||||+. ..++|+|+++|+|+++++||++|+|+++|+++|+|+++++|+||||||.+|..+.|+.++|++||+|+.+
T Consensus        80 iLVNNAGi~-~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~g~IvnisS~~g~~~~p~~~~Y~aSK~av~~  158 (258)
T PRK08267         80 VLFNNAGIL-RGGPFEDIPLEAHDRVIDINVKGVLNGAYAALPYLKATPGARVINTSSASAIYGQPQLAVYSATKFAVRG  158 (258)
T ss_pred             EEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             899888779-9988244999999999999739999999999999997799279999065446799998669999999999


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC-----CCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             9999999854438699755328837977984414-----4432458888999999999619
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTSMRAKAMP-----AEDPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~-----~~~~~~~~~pediA~~v~fL~s  233 (257)
                      ||++|+.|++++|||||+|+||+|+|||+.....     .....++..||++|+.+...+.
T Consensus       159 lt~sla~El~~~gIrVn~v~PG~v~T~m~~~~~~~~~~~~~~~~~~~~pe~vA~~i~~a~~  219 (258)
T PRK08267        159 LTEALDLEWRRHGIRVADVMPLFVDTPMLGSNGVRAGSPKRLGVRLTPVEDVAEAVWAAAH  219 (258)
T ss_pred             HHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             9999999843019189999718898766898877675300158989999999999999972


No 149
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=379.78  Aligned_cols=236  Identities=19%  Similarity=0.253  Sum_probs=204.8

Q ss_pred             EEECCCCCEEEEEC--CCCHHHHHHHHHHHHCCCEEEEEECCHHHH-HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             26524889999938--998688999999998899899997898999-999999986499289998789999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTG--SSRGIGYYTALELARSGAYVIACGRSISQL-EKLKNALQKINKKIDIFAFDLRDSNALELTKTY   88 (257)
Q Consensus        12 m~~~l~~K~alVTG--as~GIG~a~a~~la~~G~~Vi~~~r~~~~l-~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~   88 (257)
                      |.-.|+||++||||  +++|||+++|+.|+++|++|++++|+.+++ +++.+   ..+.+...+++|++|++++++++++
T Consensus         1 M~g~L~GK~~lVTG~~~~~GIG~a~A~~la~~GA~Vvi~~~~~~~~~~~~~~---~~~~~~~~i~~Dv~~~~~v~~~~~~   77 (256)
T PRK07889          1 MSGLLEGKRILVTGVITDSSIAFHIARVAQEQGAEVVLTGFRRLRLTERIAK---RLPEPAPVLELDVTNEEHLASLADR   77 (256)
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHH---HCCCCCEEEEEECCCHHHHHHHHHH
T ss_conf             9671499979998998856899999999998799999983893589999998---6588875999428899999999999


Q ss_pred             HHHHHCCCCEEEECCCCCCC----CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCC
Q ss_conf             99981898799876875888----88867659999999999998999999999999998608986999788356478898
Q gi|254780337|r   89 IAKRWGKLDILIANAGILGS----ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL  164 (257)
Q Consensus        89 ~~~~~g~iDilVNNAGi~~~----~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~  164 (257)
                      +.++||+||+||||||+...    ..+|.+.+.++|++.+++|+.+++.++|++.|.|.  +.|+||++++. +..+.|.
T Consensus        78 ~~~~~G~lD~lVnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~gg~Iv~~s~~-~~~~~p~  154 (256)
T PRK07889         78 VREHIGGLDGVVHSIGFAPQTALGGNPFLDAPWEDVATALHISAYSLASLAKALLPLMN--PGGSIVGLDFD-ATVAWPA  154 (256)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCEEEECCC-CCCCCCC
T ss_conf             99986897879742134774434676520035888888998999999999999765421--68874674575-5545674


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC----------CCCCCC-CCCCHHHHHHHHHHHHC
Q ss_conf             3688989999999999999985443869975532883797798441----------444324-58888999999999619
Q gi|254780337|r  165 WGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM----------PAEDPN-TVPHPQKVAKIISFLCA  233 (257)
Q Consensus       165 ~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~----------~~~~~~-~~~~pediA~~v~fL~s  233 (257)
                      +..|++||+||.+|||++|.||+++|||||+|+||+++|++.+...          ...|.+ |+++|||||++++||+|
T Consensus       155 ~~~y~asKaal~~ltr~lA~el~~~gIRVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~pl~~r~~~pediA~~v~fL~S  234 (256)
T PRK07889        155 YDWMGVAKAALESTNRYLARELGPRGVRSNLVAAGPIRTLAAKAIPGFELLEEGWDQRAPLGWDMKDPTPVAKTVVALLS  234 (256)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             24677789999999999999973409799999747887734433798699999998669988789899999999999967


Q ss_pred             HH-HCCCCCEEEECCCCEECC
Q ss_conf             75-626685798768763154
Q gi|254780337|r  234 TQ-KIETGKLFSVPQNRFVNY  253 (257)
Q Consensus       234 ~~-~~~tG~~~~vdgG~~~n~  253 (257)
                      ++ +|+|||+|.||||..++.
T Consensus       235 d~s~~iTG~~l~VDGG~~a~G  255 (256)
T PRK07889        235 DWFPATTGEIIHVDGGAHAQG  255 (256)
T ss_pred             CHHCCCCCCEEEECCCCCCCC
T ss_conf             822371688588795901158


No 150
>PRK06914 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=378.60  Aligned_cols=217  Identities=25%  Similarity=0.409  Sum_probs=197.4

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCC--CEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             4889999938998688999999998899899997898999999999986499--28999878999999999999999981
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK--KIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~--~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |++|+|||||||+|||+++|++|+++|++|++++|+.++++++.+++.+.+.  .+.++.+|++|+++++. ++++.+++
T Consensus         1 l~~K~alITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~Dvtd~~~v~~-~~~~~~~~   79 (280)
T PRK06914          1 MNKKIAIITGASSGFGLLTTLELAKKDYLVIATMRNLEKQENLISQAAQLNLSQNIKVQQLDVTDQNSIHN-FQLFLKEY   79 (280)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHH-HHHHHHHH
T ss_conf             95198999073449999999999987998999989889999999999964999766999688999999999-99999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ..+++++++.|+|+++|+||++|+++++|+++|+|++++.|+||||||++|+.+.|+.++||+||+
T Consensus        80 g~iDvLVNNAG~~-~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~~g~~~~p~~~~Y~aSK~  158 (280)
T PRK06914         80 GRIDLLVNNAGYA-NGGFVEEIPVEEYRKQFETNVFGAISVTQAVLPYMRKQKSGKIINISSISGQVGFPALSPYVSSKY  158 (280)
T ss_pred             CCCCEEEECCCCC-CCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
T ss_conf             9987899788667-787421177999999998712899989999978777569958999834133268998737999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC--------C---------------CCCCCCCHHHHHHHHHH
Q ss_conf             999999999998544386997553288379779844144--------4---------------32458888999999999
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA--------E---------------DPNTVPHPQKVAKIISF  230 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~--------~---------------~~~~~~~pediA~~v~f  230 (257)
                      |+.+|+++|+.|++++||+||+|+||+|+|+|+......        .               ...+...||++|+.++.
T Consensus       159 Al~~~t~sL~~El~~~gI~V~~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pe~vA~~i~~  238 (280)
T PRK06914        159 ALEGWSESLRLEVKPFGIDVALIEPGSYNTNIWEVGKQLAENQSETTSPYKEYMDKIQKHINSGSDTFGNPIDVAELIVR  238 (280)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             99999999999843109389999728987651134220001367767708999999999998356568999999999999


Q ss_pred             HHCH
Q ss_conf             6197
Q gi|254780337|r  231 LCAT  234 (257)
Q Consensus       231 L~s~  234 (257)
                      ++..
T Consensus       239 a~~~  242 (280)
T PRK06914        239 IAES  242 (280)
T ss_pred             HHHC
T ss_conf             9828


No 151
>PRK09072 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=378.81  Aligned_cols=217  Identities=25%  Similarity=0.365  Sum_probs=196.9

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++||||||+|||+++|++|+++|++|++++|++++++++++++.  +.++.++.+|++|+++++.+.+.+ +++
T Consensus         1 M~l~~K~vlITGassGIG~a~A~~la~~G~~vil~~R~~~~L~~~~~~l~--~~~~~~~~~Dls~~~~~~~~~~~~-~~~   77 (262)
T PRK09072          1 MDLKDKRVLLTGASGGIGEALAEALCAAGARLLLVGRNAEKLEALAARPY--PGRVRWVVADLTSEAGREAVLARA-REM   77 (262)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC--CCCEEEEEEECCCHHHHHHHHHHH-HHH
T ss_conf             99899889994862399999999999879989999898999999999845--897699997179999999999999-984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|+||||||+. ..+++++++.|+|+++++||++|+++++|.++|+|++++.|+||||+|.+|..+.|++++||+||+
T Consensus        78 g~iDiLInNAG~~-~~~~~~~~~~~~~~~~~~vN~~g~~~lt~~~lp~m~~~~~G~IvnisS~ag~~~~p~~~~Y~ASKa  156 (262)
T PRK09072         78 GGINVLINNAGVN-HFALLDQQDPEAIDRLLALNLTAPMQLTRALLPLLRAQPSAAVVNVGSTFGSIGYPGYASYCASKF  156 (262)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHCCCCCCHHHHHHHH
T ss_conf             9998999899778-898635499999999999956899999999999998769948999668666257899817999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC---CCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999999998544386997553288379779844144---4324588889999999996197
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA---EDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~---~~~~~~~~pediA~~v~fL~s~  234 (257)
                      |+.+|+++|+.|++++||+||+|+||+++|+|.......   .....+.+||++|+.++--+..
T Consensus       157 al~~~s~sL~~El~~~gI~V~~v~Pg~v~T~~~~~~~~~~~~~~~~~~~~pe~vA~~i~~~i~~  220 (262)
T PRK09072        157 ALRGFSEALRRELADTGVRVLYLAPRATRTAMNSAAVTALNAALGNAMDSPEDVAAAVLQAIEQ  220 (262)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999999984622908999972899988885023454554166789999999999999946


No 152
>PRK08263 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=379.52  Aligned_cols=215  Identities=24%  Similarity=0.346  Sum_probs=194.6

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             48899999389986889999999988998999978989999999999864992899987899999999999999998189
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      +.|||+||||||+|||+++|+.|+++|++|++++|+.++++++.++   .+.++.++++|++|+++++++++++.++||+
T Consensus         1 m~gKv~lITGassGIG~a~A~~la~~G~~Vv~~~R~~~~l~~l~~~---~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~   77 (275)
T PRK08263          1 MMGKVWFITGASRGFGREWTEAALERGDRVVATARDTATLADLAER---YGDALLPLALDVTDRAAVFAAVEQAVKHFGR   77 (275)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHCC
T ss_conf             9899899946743999999999998799899997989999999997---5996799996489999999999999998499


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             87998768758888886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      ||+||||||+. ..++++++++++|+++|++|++|+|+++|+++|+|+++++|+||||||.+|+.+.|+.++|++||+||
T Consensus        78 iDiLVNNAG~~-~~~~~~e~~~~~~~~~~~vNl~g~~~~~~a~lp~m~~~~~G~IvnisS~ag~~~~p~~~~Y~ASK~Al  156 (275)
T PRK08263         78 LDIVVNNAGYG-LFGMIEEVTESEARAQIDTNVFGALWVTQAVLPYLRAQRSGHIIQISSIGGISAFPMVGIYHASKWAL  156 (275)
T ss_pred             CCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCEEEEECCHHHCCCCCCCCHHHHHHHHH
T ss_conf             87899888667-88874769999999999986199999876426133516997799945701056799970799999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC------------------CCCCCCCHHHHHHHHHHHHCH
Q ss_conf             99999999985443869975532883797798441444------------------324588889999999996197
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE------------------DPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~------------------~~~~~~~pediA~~v~fL~s~  234 (257)
                      .+||++|+.|++++|||||+|+||+++|+|........                  ....-+.|+++|+++.-++..
T Consensus       157 ~~lt~sLa~El~~~gIrVn~V~PG~v~T~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~gdP~~~a~~i~~~~~~  233 (275)
T PRK08263        157 EGFSEALAQEVAHFGIKVTLVEPGGYSTDWAGTSAKRATPLPAYDTLREELAEARSDRSVDGDPEAAAEALLKLVDA  233 (275)
T ss_pred             HHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCC
T ss_conf             99999999984033968999970887578788877668987202899999998754568899999999999999748


No 153
>PRK06483 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=379.02  Aligned_cols=226  Identities=19%  Similarity=0.209  Sum_probs=201.5

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             89999938998688999999998899899997898999999999986499289998789999999999999999818987
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      +|++|||||++|||+++|++|+++|++|++++|++++.   .+++++.+  +..+++|++|+++++++++++.++||++|
T Consensus         2 ~ktVlVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~---~~~l~~~~--~~~~~~Dv~~~~~v~~~~~~~~~~~g~id   76 (236)
T PRK06483          2 SAPILITGAGQRIGLALAKHLLAQGQPVIVSYRSHYPA---IDELRQAG--ATCIQADFSTNAGIMAFIDELKQHTDGLR   76 (236)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHH---HHHHHHCC--CEEEEECCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             98799978998899999999998899899995984799---99998569--98999227999999999999999839975


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCE--EEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             9987687588888867659999999999998999999999999998608986--99978835647889836889899999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGR--AIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~--IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      +||||||.... .+..+.+.|+|++++++|++++|+++|.+.|.|++++.|.  |||++|..+.++.++..+|++||+|+
T Consensus        77 ~lVnNAg~~~~-~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~l~~~~~~~~~Ii~isS~~~~~g~~~~~~Y~asKaal  155 (236)
T PRK06483         77 AIIHNASDWLA-ESPGAPLADVLARMMQIHVNAPYLLNLALEDLLRGHGHAASDIIHITDYVVEKGSDKHIAYAASKAAL  155 (236)
T ss_pred             EEEECCCCCCC-CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCHHHHHHHHHH
T ss_conf             99977744678-88343889999999997335899999998999997588866776542265642488847899999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCH------HHHHHCCCCCCCCCCCHHHHHHHHHHHHCHHHCCCCCEEEECCCC
Q ss_conf             99999999985443869975532883797------798441444324588889999999996197562668579876876
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTS------MRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNR  249 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~------m~~~~~~~~~~~~~~~pediA~~v~fL~s~~~~~tG~~~~vdgG~  249 (257)
                      .+|||+||.||+++ ||||+|+||+|.|+      ..++.....+.+|+++|||||+++.||+| ++|+|||+|.||||+
T Consensus       156 ~~ltr~lA~ela~~-IrVN~V~PG~i~~~~~~~~~~~~~~~~~~~~~r~~~p~eia~~v~fL~s-s~~iTG~~i~VDGG~  233 (236)
T PRK06483        156 DNMTLSFAAKLAPE-VKVNSIAPALILFNEGDDAAYRQKALAKSLLKIEPGEEEIIQLVDYLLD-SCYVTGRSLPVDGGR  233 (236)
T ss_pred             HHHHHHHHHHHCCC-CEEEEEEECEEECCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH-CCCCCCCEEEECCCC
T ss_conf             99999999997589-9899996070621899989999999861888899898999999999993-899889818879461


Q ss_pred             EE
Q ss_conf             31
Q gi|254780337|r  250 FV  251 (257)
Q Consensus       250 ~~  251 (257)
                      .|
T Consensus       234 ~L  235 (236)
T PRK06483        234 HL  235 (236)
T ss_pred             CC
T ss_conf             03


No 154
>PRK05650 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=374.61  Aligned_cols=223  Identities=21%  Similarity=0.273  Sum_probs=200.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      .|||||||+|||+++|++|+++|++|++++|++++++++.+++++.|.++.++.||++|+++++.+++++.++||++|+|
T Consensus         2 rVlITGassGIG~alA~~la~~G~~V~l~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~~~~~~~~v~~~~g~iDiL   81 (270)
T PRK05650          2 RVMITGAASGLGRAIALRWAREGWRLALADVNEEGGEETLKELREAGGDGFYQRCDVRDYSQLTALAQACEEKWGGIDVI   81 (270)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79998876499999999999889989999798899999999998449928999845899999999999999983997789


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             87687588888867659999999999998999999999999998608986999788356478898368898999999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALA  179 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt  179 (257)
                      |||||+. ..++|+|++.|+|+++|+||++|+++++|.++|+|++++.|+||||+|.+|+.+.|+.++|++||+|+.+||
T Consensus        82 VNNAGi~-~~g~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~G~IvnisS~ag~~~~p~~~~Y~asK~av~~~t  160 (270)
T PRK05650         82 VNNAGVA-SGGFFEELSLEDWDWQIAINLMGVVKGCKAFLPLFKEQGKGRIVNIASMAGLMQGPAMSSYNVAKAGVVALS  160 (270)
T ss_pred             EECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             6247667-998620199999999999965999999999997675569958999858555289999667999999999999


Q ss_pred             HHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCC----------CCCCCCHHHHHHHHHHHHCHHHCCCCCEEEECCC
Q ss_conf             99999854438699755328837977984414443----------2458888999999999619756266857987687
Q gi|254780337|r  180 RTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED----------PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQN  248 (257)
Q Consensus       180 ~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~----------~~~~~~pediA~~v~fL~s~~~~~tG~~~~vdgG  248 (257)
                      ++|+.|++++||+||+|+||+|+|+|........+          ......||++|+.+.--.     ..|+.+.+.|.
T Consensus       161 esL~~El~~~gI~V~~v~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~vA~~i~~~i-----~~~~~~i~~g~  234 (270)
T PRK05650        161 ETLLVELADDEIGVHVVCPSFFQTNLLDSFRGPNPAMKAQVGKLLEKSPITAADIADYIYQQV-----AKGEFLILPHE  234 (270)
T ss_pred             HHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHH-----HCCCEEEECCH
T ss_conf             999998532196899997388986656577888804678887664148999999999999999-----75995998498


No 155
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional
Probab=100.00  E-value=0  Score=371.71  Aligned_cols=239  Identities=18%  Similarity=0.201  Sum_probs=205.9

Q ss_pred             CCCCCEEEEECCCC--HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             24889999938998--6889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   15 NLDNRLALVTGSSR--GIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        15 ~l~~K~alVTGas~--GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .|+||++||||+++  |||+++|+.|+++|++|++++|++ ++++..+++....++...++||++|+++++++++++.+.
T Consensus         3 ~L~GK~alVTGaa~~~GiG~aiA~~la~~GA~V~i~~~~~-~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~   81 (262)
T PRK07984          3 FLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQND-KLKGRVEEFAAQLGSDIVLQCDVAEDASIDAMFAELGKV   81 (262)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             8899879998999972599999999998799999982777-899999999975498289988899999999999999998


Q ss_pred             HCCCCEEEECCCCCCCC----CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             18987998768758888----88676599999999999989999999999999986089869997883564788983688
Q gi|254780337|r   93 WGKLDILIANAGILGSI----SPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~----~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      ||++|+||||||+....    .++.+++.++|+..+++|..+++.+.|.+.+.|  ++.++||+++|..+.++.|++++|
T Consensus        82 ~g~iD~lVnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~iv~iss~~~~~~~p~~~~y  159 (262)
T PRK07984         82 WPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSML--NPGSALLTLSYLGAERAIPNYNVM  159 (262)
T ss_pred             HCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCCEEEEEECHHHCCCCCCCHHH
T ss_conf             387788999502276322463178886099999999887899999999888751--479759999504432667872088


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HC
Q ss_conf             98999999999999998544386997553288379779844----------14443245888899999999961975-62
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KI  237 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~  237 (257)
                      ++||+|+.+|||+||.||+++|||||+|+||+|+|++....          ....|.+|+++|||||++++||||++ +|
T Consensus       160 ~~sKaal~~ltr~lA~el~~~gIRVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fL~Sd~s~~  239 (262)
T PRK07984        160 GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAG  239 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             88888999999999999485887999986477655200148677999999986799899959999999999996864258


Q ss_pred             CCCCEEEECCCCEECCCCC
Q ss_conf             6685798768763154379
Q gi|254780337|r  238 ETGKLFSVPQNRFVNYLTP  256 (257)
Q Consensus       238 ~tG~~~~vdgG~~~n~~~p  256 (257)
                      +|||+|.||||..+....|
T Consensus       240 iTG~~i~VDGG~tl~~~~~  258 (262)
T PRK07984        240 ISGEVVHVDGGFSIAAMNE  258 (262)
T ss_pred             CCCCEEEECCCHHHHCCCH
T ss_conf             4387389694976656684


No 156
>PRK07832 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=373.42  Aligned_cols=215  Identities=22%  Similarity=0.301  Sum_probs=194.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCC-EEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999389986889999999988998999978989999999999864992-89998789999999999999999818987
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK-IDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~-~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      |+|||||||+|||+++|++|+++|++|++++|++++++++.+++++.|.+ +.++.+|++|+++++++++++.++||++|
T Consensus         1 K~alITGassGIG~a~A~~la~~Ga~v~l~~r~~~~l~~~~~~l~~~g~~~~~~~~~Dvsd~~~v~~~~~~~~~~~g~iD   80 (272)
T PRK07832          1 KRCFVTGAASGIGRATALRLAAQGAELFLTDRDADGLAQTVADARALGGTVPEHRALDISDYDAVAAFAADIHAAHPSMD   80 (272)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             97999472019999999999988998999989889999999999845897147885668999999999999999729988


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             9987687588888867659999999999998999999999999998608-986999788356478898368898999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      +||||||+. ..+++++++.|+|+++|+||+.|+++++|+++|+|++++ .|+||||+|.+|..+.|+.++|++||+|+.
T Consensus        81 iLiNNAGi~-~~g~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~~G~IVnisS~ag~~~~p~~~~Y~ASK~av~  159 (272)
T PRK07832         81 VVMNIAGIS-AWGTVDRLTHEQWRRMVDINLMGPIHVIETFVPPMVAAGRGGHLVNVSSAAGLVGLPWHAAYSASKYGLR  159 (272)
T ss_pred             EEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCHHHHHHHHHH
T ss_conf             899878768-8887345899999999998728999999999999998389968999757775568999802999999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC----CC----------CCCCCCCHHHHHHHHHHHHCH
Q ss_conf             99999999854438699755328837977984414----44----------324588889999999996197
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP----AE----------DPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~----~~----------~~~~~~~pediA~~v~fL~s~  234 (257)
                      +|+++|+.|++++||+||+|+||+|+|+|......    ..          .......||++|+.++--...
T Consensus       160 g~~esL~~El~~~gI~V~~v~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~spe~vA~~i~~ai~~  231 (272)
T PRK07832        160 GLSEVLRFDLARHGIGVSVVVPGAVKTPLVNTVEIAGVDRDDPRVQKWVDRFRGHAVTPEKAADKILAGVER  231 (272)
T ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHC
T ss_conf             999999998521097899997488988878885634667664457888764025699999999999999965


No 157
>PRK06182 short chain dehydrogenase; Validated
Probab=100.00  E-value=0  Score=372.78  Aligned_cols=211  Identities=27%  Similarity=0.367  Sum_probs=189.8

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             48899999389986889999999988998999978989999999999864992899987899999999999999998189
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      |++|++||||||+|||+++|++|+++|++|++++|+.++++++.+    .+  +..+++|++|+++++++++++.+++|+
T Consensus         1 mk~Kv~lITGassGIG~a~a~~la~~G~~V~~~~r~~~~l~~l~~----~~--~~~~~~Dvt~~~~v~~~~~~i~~~~g~   74 (273)
T PRK06182          1 MKKKVALVTGASSGIGKATARKLIAEGFTVYGAARRVDKMEDLAS----LG--IHPLALDVTDEASMKAAVATILAEEGR   74 (273)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----CC--CEEEEEECCCHHHHHHHHHHHHHHHCC
T ss_conf             946989990632099999999999879989999798999999996----79--979998589999999999999998399


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             87998768758888886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      +|+||||||+. ..+++++++.|+|+++++||++|+|+++|+++|+|++++.|+||||+|.+|+.+.|+.++|++||+|+
T Consensus        75 iDiLVNNAG~~-~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~ag~~~~p~~~~Y~asK~av  153 (273)
T PRK06182         75 IDVLVNNAGYG-SYGAIEDVPIDEARAQFEVNLFGAARLTQLVLPHMRAQRSGRIINITSMGGKIYTPLGAWYHATKFAL  153 (273)
T ss_pred             CCEEEECCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCCCCHHHHHHHHH
T ss_conf             88775058677-78748873199999999988699999999853342148995899986844407799975799999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC------------------------CCCCCCCCHHHHHHHHHHH
Q ss_conf             9999999998544386997553288379779844144------------------------4324588889999999996
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA------------------------EDPNTVPHPQKVAKIISFL  231 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~------------------------~~~~~~~~pediA~~v~fL  231 (257)
                      .+||++|+.|++++|||||+|+||+|+|+|+......                        ........|+++|+.+...
T Consensus       154 ~~~t~~La~El~~~gI~V~~v~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~vA~~i~~a  233 (273)
T PRK06182        154 EGLSDALRLEVAPFGIDVVVIEPGGIKTEWGDIAAEHLLKTSGGGPYAEQAQAVAASMRSTYGSGMSSPPQVIADAISKA  233 (273)
T ss_pred             HHHHHHHHHHHCHHCCEEEEEECCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             99999999984403878999973898688640234554421356735999999999999763356789999999999999


Q ss_pred             HC
Q ss_conf             19
Q gi|254780337|r  232 CA  233 (257)
Q Consensus       232 ~s  233 (257)
                      +.
T Consensus       234 ~~  235 (273)
T PRK06182        234 VT  235 (273)
T ss_pred             HH
T ss_conf             82


No 158
>PRK06180 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=371.58  Aligned_cols=212  Identities=21%  Similarity=0.255  Sum_probs=191.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      +.||+||||||+|||+++|+.|+++|++|++++|++++++++.+   ..+.++..+.+|++|+++++++++++.++||+|
T Consensus         3 ~~KvvlITGassGIG~aiA~~l~~~G~~Vi~~~R~~~~l~~l~~---~~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~i   79 (277)
T PRK06180          3 SMKTWLITGVSSGFGRALAQAALAAGHRVVGTVRSAAARRDFEA---LHPGRALARVLDVTDFDAIDGVVADAEATVGPI   79 (277)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH---HCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             99889991787399999999999879999999899999999998---679957999983799999999999999981998


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      |+||||||+. ..++++++++++|+++|++|++|+|+++|+++|+|++++.|+||||+|.+|+.+.|+.++|++||+||.
T Consensus        80 DvLVNNAG~~-~~~~~e~~~~~~~~~~~~vN~~g~~~~~~a~lp~m~~~~~G~IvnisS~ag~~~~p~~~~Y~aSK~Al~  158 (277)
T PRK06180         80 DVLVNNAGYG-HEGAIEESPLAEMRRQFEVNVFGAVAMIKAVLPGMRARRRGHIVNITSMGGLITMPGIAYYCGSKFALE  158 (277)
T ss_pred             CEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
T ss_conf             6999899778-888633399999999998853776544200488889658965775354665257999827999999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC---------------------CCCCCCCCHHHHHHHHHHHH
Q ss_conf             999999998544386997553288379779844144---------------------43245888899999999961
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA---------------------EDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~---------------------~~~~~~~~pediA~~v~fL~  232 (257)
                      +||++||.|++++|||||+|+||+++|+|..+.+..                     ......+.|+++|+.+.-++
T Consensus       159 ~lt~sLa~El~~~gIrVn~V~PG~v~T~f~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~gdP~k~A~~i~~~~  235 (277)
T PRK06180        159 GISEALAKEVAPFGIHVTAVEPGSFRTDWAGRSMVRSPRSIADYDALFDPIRQAREAKSGKQPGDPAKAAQAILAAI  235 (277)
T ss_pred             HHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999843238689999707872686887664578886004778999999998725898999999999999998


No 159
>PRK06179 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=374.25  Aligned_cols=208  Identities=26%  Similarity=0.387  Sum_probs=188.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      ++|||||||||+|||+++|++|+++|++|++++|+.++++++        ..+.++.||++|+++++++++++.++||++
T Consensus         3 ~~KvalITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~~--------~~~~~~~~Dvtd~~~v~~~~~~~~~~~g~i   74 (270)
T PRK06179          3 NKKVALVTGASSGIGRATAEALARAGYRVFGTSRNPARATPI--------PGVELLELDVTDDASVQAAVQEVIARAGRI   74 (270)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHCC--------CCCEEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             995899907246999999999998799999996897773054--------897899910799999999999999983998


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      |+||||||+. ..+++++++.|+|+++++||++|+|+++|+++|+|++++.|+||||+|.+|+.+.|+.++|++||+||.
T Consensus        75 DiLVNNAGi~-~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~~g~~~~p~~~~Y~aSK~al~  153 (270)
T PRK06179         75 DVLVNNAGVG-LLGAAEETSIAQAQALFDTNVFGILRMTNAVLPHMRAQGSGRIINISSVLGFLPAPYMALYAASKHAVE  153 (270)
T ss_pred             CEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHCCCCCCCHHHHHHHHHH
T ss_conf             8899898666-788757598999999988744899999987420220179958999868566277899707999999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC-------------------CCCCCCCHHHHHHHHHHHHC
Q ss_conf             9999999985443869975532883797798441444-------------------32458888999999999619
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE-------------------DPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~-------------------~~~~~~~pediA~~v~fL~s  233 (257)
                      +||++|+.|++++|||||+|+||+|+|+|+.......                   ......+||++|+.+.-.+.
T Consensus       154 ~~t~sla~El~~~gIrVn~v~PG~v~T~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~Pe~vA~~i~~a~~  229 (270)
T PRK06179        154 GYSESLDHEVRQFGIRVSLVEPAYTRTSFDANAPEPDSPLAAYDRERAVVSRAVAKAVKTADEPEVVAATVVKAAL  229 (270)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             9999999985012968999984789171332667655652037999999999998742149999999999999995


No 160
>KOG0725 consensus
Probab=100.00  E-value=0  Score=370.87  Aligned_cols=243  Identities=33%  Similarity=0.425  Sum_probs=215.7

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCC---CEEEEECCCCCHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499---289998789999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK---KIDIFAFDLRDSNALELTKTY   88 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~---~~~~~~~Dv~d~~~v~~~~~~   88 (257)
                      +.+.|++|++||||+++|||+++|++|++.|++|++++|++++++++..++...+.   ++..+.||+++++++++++++
T Consensus         2 ~~~~l~gkvalVTG~s~GIG~aia~~la~~Ga~v~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~l~~~   81 (270)
T KOG0725           2 SGGRLAGKVALVTGGSSGIGKAIALLLAKAGAKVVITGRSEERLEETAQELGGLGYTGGKVLAIVCDVSKEVDVEKLVEF   81 (270)
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             86556887899979998158999999998799899984545666778999874367776148997555767889999999


Q ss_pred             HHHH-HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCC-
Q ss_conf             9998-18987998768758888886765999999999999899-99999999999986089869997883564788983-
Q gi|254780337|r   89 IAKR-WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA-NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLW-  165 (257)
Q Consensus        89 ~~~~-~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g-~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~-  165 (257)
                      +.++ ||++|+||||||+.....+++|+++|+|++++++|+.| +|.+++.+.|++++++.|+|++++|.++..+.+.. 
T Consensus        82 ~~~~~~GkidiLvnnag~~~~~~~~~~~s~e~~d~~~~~Nl~G~~~~~~~~a~~~~~~~~gg~I~~~ss~~~~~~~~~~~  161 (270)
T KOG0725          82 AVEKFFGKIDILVNNAGALGLTGSILDLSEEVFDKIMATNLRGSAFCLKQAARPMLKKSKGGSIVNISSVAGVGPGPGSG  161 (270)
T ss_pred             HHHHHCCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCC
T ss_conf             99984788877987266467887442199999988886403127899999999999853894699966644556677765


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH---------------CCCCCCCCCCCHHHHHHHHHH
Q ss_conf             68898999999999999998544386997553288379779844---------------144432458888999999999
Q gi|254780337|r  166 GAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA---------------MPAEDPNTVPHPQKVAKIISF  230 (257)
Q Consensus       166 ~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~---------------~~~~~~~~~~~pediA~~v~f  230 (257)
                      .+|++||+|+.+|||++|.||+++|||||+|+||.+.|++....               ....+.+|+++|+|+|+.+.|
T Consensus       162 ~~Y~~sK~al~~ltr~lA~El~~~gIRvN~v~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~p~gr~g~~~eva~~~~f  241 (270)
T KOG0725         162 VAYGVSKAALLQLTRSLAKELAKHGIRVNSVSPGLVKTSLRAAGLDDGEMEEFKEATDSKGAVPLGRVGTPEEVAEAAAF  241 (270)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHCCCCCCCHHHHHHHHHCCCCCCCCCEECCHHHHHHHHH
T ss_conf             20011499999989999999986393688834686704402125664202677764302366645652062788875786


Q ss_pred             HHCHH-HCCCCCEEEECCCCEECCC
Q ss_conf             61975-6266857987687631543
Q gi|254780337|r  231 LCATQ-KIETGKLFSVPQNRFVNYL  254 (257)
Q Consensus       231 L~s~~-~~~tG~~~~vdgG~~~n~~  254 (257)
                      |++++ +|+||+++.+|||..++..
T Consensus       242 la~~~asyitG~~i~vdgG~~~~~~  266 (270)
T KOG0725         242 LASDDASYITGQTIIVDGGFTVVGP  266 (270)
T ss_pred             HCCCCCCEECCCEEEECCCEEEECC
T ss_conf             3075543151988985398887325


No 161
>PRK08219 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=366.58  Aligned_cols=214  Identities=30%  Similarity=0.482  Sum_probs=190.9

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             89999938998688999999998899899997898999999999986499289998789999999999999999818987
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      -|||||||||+|||+++|+.|++.| .|++++|+.++++++.+++.     +..+.+|++|++++++++    +++|++|
T Consensus         3 mKvalITGas~GIG~aia~~la~~g-~vv~~~r~~~~l~~l~~~~~-----~~~~~~Dlt~~~~i~~~~----~~~~~iD   72 (226)
T PRK08219          3 MPTALITGASRGIGAAIARALARTH-TLLLAGRPSERLDAVAARLG-----ATTWPADLTDPEAIAAAV----EPLDRLD   72 (226)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHHHC-----CCEEEECCCCHHHHHHHH----HHCCCCC
T ss_conf             8999992846499999999999699-89999898899999999709-----937860579999999999----9659988


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             99876875888888676599999999999989999999999999986089869997883564788983688989999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      +||||||+. ..+++.+.+.|+|+++|++|++|+|+++|+++|+|++++ |+||||+|.+|+.+.|++++|++||+|+.+
T Consensus        73 ~lVnnAG~~-~~~~~~~~~~~~~~~~~~vNl~~~~~l~~~~lp~m~~~~-G~IV~isS~~g~~~~~~~~~Y~aSKaAl~~  150 (226)
T PRK08219         73 VLVHNAGVA-ELGPVAESTVDEWRATLDVNVVAPAELTRLLLPALRAAR-GHVVFINSGAGLNASPGWASYAASKFALRA  150 (226)
T ss_pred             EEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEECHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             999899689-998737699999999999866999999999999999739-849999476764889997479999999999


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC----CCCCCCCCHHHHHHHHHHHHCH-H-HCCCCCEEE
Q ss_conf             99999998544386997553288379779844144----4324588889999999996197-5-626685798
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA----EDPNTVPHPQKVAKIISFLCAT-Q-KIETGKLFS  244 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~----~~~~~~~~pediA~~v~fL~s~-~-~~~tG~~~~  244 (257)
                      |+++|+.|+. .+||||+|+||+|+|+|+++....    .+++|+++|||||++|.||++. + .+++|+++.
T Consensus       151 l~~~L~~e~~-~~IrVn~I~PG~v~T~m~~~~~~~~~~~~~~~r~~~PedVA~~v~fll~~p~~~~i~~~~i~  222 (226)
T PRK08219        151 LADALREEEA-GNVRVTSVHPGRTATDMQRELVAQEGREYDPARFLRPETVAAAVRFAVDAPRDAHITEVVVR  222 (226)
T ss_pred             HHHHHHHHCC-CCEEEEEEEECCCCCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEE
T ss_conf             9999998669-98499999708997865355676543037876796999999999999869987518876995


No 162
>KOG1200 consensus
Probab=100.00  E-value=0  Score=373.76  Aligned_cols=235  Identities=23%  Similarity=0.255  Sum_probs=217.0

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      ++..|+++|||+++|||+++++.|+++|++|+.++++.+.+++++..+..+| .+..+.||++++++++.++++..+.+|
T Consensus        11 r~~sk~~~vtGg~sGIGrAia~~la~~Garv~v~dl~~~~A~ata~~L~g~~-~h~aF~~DVS~a~~v~~~l~e~~k~~g   89 (256)
T KOG1200          11 RLMSKVAAVTGGSSGIGRAIAQLLAKKGARVAVADLDSAAAEATAGDLGGYG-DHSAFSCDVSKAHDVQNTLEEMEKSLG   89 (256)
T ss_pred             HHHCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC-CCCEEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             8746224873487507799999997469679975032244799986268877-652353046757889999999998429


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             9879987687588888867659999999999998999999999999998--60898699978835647889836889899
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLK--KSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~--~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      ++++|||||||+.+ ..+..++.|+|+.++.+||+|.|+++|++.+.|.  .++.++||||||+-|..+..++..|++||
T Consensus        90 ~psvlVncAGItrD-~~Llrmkq~qwd~vi~vNL~gvfl~tqaa~r~~~~~~~~~~sIiNvsSIVGkiGN~GQtnYAAsK  168 (256)
T KOG1200          90 TPSVLVNCAGITRD-GLLLRMKQEQWDSVIAVNLTGVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKIGNFGQTNYAASK  168 (256)
T ss_pred             CCCEEEECCCCCCC-CCEEECCHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCEEEEEHHHHCCCCCCCCHHHHHHC
T ss_conf             97289975764653-02013248888889975121367888999999997167984388644521024565522344532


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEE
Q ss_conf             9999999999998544386997553288379779844--------14443245888899999999961975-62668579
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA--------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF  243 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~--------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~  243 (257)
                      +|+++|||+.|+|++.++||||.++||+|.|||.++.        ....|.+|+++|||||+.|.||+|+. +|+||+.+
T Consensus       169 ~GvIgftktaArEla~knIrvN~VlPGFI~tpMT~~mp~~v~~ki~~~iPmgr~G~~EevA~~V~fLAS~~ssYiTG~t~  248 (256)
T KOG1200         169 GGVIGFTKTAARELARKNIRVNVVLPGFIATPMTEAMPPKVLDKILGMIPMGRLGEAEEVANLVLFLASDASSYITGTTL  248 (256)
T ss_pred             CCEEEEEHHHHHHHHHCCCEEEEECCCCCCCHHHHHCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             75553009889988654824767614311681254438789999975587644588899878999881544233215169


Q ss_pred             EECCCCEE
Q ss_conf             87687631
Q gi|254780337|r  244 SVPQNRFV  251 (257)
Q Consensus       244 ~vdgG~~~  251 (257)
                      .|+||.++
T Consensus       249 evtGGl~m  256 (256)
T KOG1200         249 EVTGGLAM  256 (256)
T ss_pred             EEECCCCC
T ss_conf             98346349


No 163
>PRK07023 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=365.78  Aligned_cols=221  Identities=26%  Similarity=0.342  Sum_probs=193.5

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH-H---HH
Q ss_conf             8999993899868899999999889989999789899999999998649928999878999999999999999-9---81
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA-K---RW   93 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~-~---~~   93 (257)
                      ++.|||||||+|||+++|++|+++|++|++++|+.++..     ....+.++..+.+|++|+++++.+++... +   ..
T Consensus         1 ~~rAlITGas~GIG~aiA~~la~~G~~Vi~~~r~~~~~l-----~~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~~~~~~~   75 (243)
T PRK07023          1 DVRAIVTGHSRGLGAALAEQLLQPGIAVLGVSRSRHPSL-----AARAGERLAEVELDLSDPAAAAAWLAGDTLRAFVDG   75 (243)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHH-----HHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             999999287629999999999987999999979978999-----986799757999505778999999999999975413


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      ..+|+||||||+..+.+++++++.++|++++++|++|+++++|+++|+|++++.|+||||||.+++.+.|++++|++||+
T Consensus        76 ~~~~ilinNAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~l~~~~~~~~~~~~~g~IInisS~a~~~~~~~~~~Y~aSKa  155 (243)
T PRK07023         76 ASRVLLINNAGTVEPIGPLDTQDAAAIARAVGLNVAAPLMLTAALAQAASDAAERRILHISSGAARNAYAGWSVYCATKA  155 (243)
T ss_pred             CCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECHHHCCCCCCCHHHHHHHH
T ss_conf             77589997798788887510099999999999975999999999999999727986057833111678999668999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC--------------CCCCCCCCCCHHHHHH-HHHHHHCHHH-C
Q ss_conf             9999999999985443869975532883797798441--------------4443245888899999-9999619756-2
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM--------------PAEDPNTVPHPQKVAK-IISFLCATQK-I  237 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~--------------~~~~~~~~~~pediA~-~v~fL~s~~~-~  237 (257)
                      ||.+|||+||.| +++|||||+|+||+|+|+|++...              +..+.+|+++|||||+ +|.||+|+++ |
T Consensus       156 al~~~t~sla~E-~~~~IrVn~V~PG~v~T~m~~~~~~~~~~~~~~~~~~~~~~p~GR~g~PedVA~~~vafL~Sd~~g~  234 (243)
T PRK07023        156 ALDHHARAVALE-ANRALRIVSLAPGVVDTGMQATIRATDEERFPMRERFRQLKASGALSTPEDAARRLIAYLLSDDFGS  234 (243)
T ss_pred             HHHHHHHHHHHH-CCCCCEEEEEECCCCCCHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             999999999986-7999889999637797746678754583007999998706888997689999999999949644379


Q ss_pred             CCCCEEE
Q ss_conf             6685798
Q gi|254780337|r  238 ETGKLFS  244 (257)
Q Consensus       238 ~tG~~~~  244 (257)
                      .||..|.
T Consensus       235 ~t~~di~  241 (243)
T PRK07023        235 TPTADIR  241 (243)
T ss_pred             CCHHHHH
T ss_conf             8458652


No 164
>PRK09291 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=359.59  Aligned_cols=215  Identities=25%  Similarity=0.337  Sum_probs=194.4

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             89999938998688999999998899899997898999999999986499289998789999999999999999818987
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      ||++||||||+|||+++|++|+++|++|++++|+.++++++.+++...+.++....+|++++.++...      ..+.+|
T Consensus         2 gK~vLITGAssGIGraiA~~la~~G~~Vi~~~r~~~~l~~l~~~~~~~g~~~~~~~lDv~~~~~~~~~------~~~~iD   75 (257)
T PRK09291          2 SKTILITGAGSGFGREVALRLARKGHRVIAGVQIAPQVTELRAEAARRGLALRVEKLDLTDAIDRARA------AEWDVD   75 (257)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHH------CCCCCC
T ss_conf             99899968985899999999998799899996878999999999985299559998988999999998------089999


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             99876875888888676599999999999989999999999999986089869997883564788983688989999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      +||||||+. ..+++++++.++|+++|+||++|+|+++|+++|+|++++.|+|||+||.+|+.+.|+.++||+||+||.+
T Consensus        76 vLVNNAGi~-~~g~i~e~~~~~~~~~~~vNv~g~~~ltq~~lp~M~~~~~G~IV~isS~ag~~~~p~~~~Y~aSK~Al~~  154 (257)
T PRK09291         76 VLLNNAGIG-EAGALVDIPVELVRELFETNVFGPLELTQGVVRKMVARGKGKIVFVSSIAGLITGPFTGAYCASKHALEA  154 (257)
T ss_pred             EEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             999898568-9977344999999999999979999999997899987699689998787766899998419999999999


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC------------------CCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             99999998544386997553288379779844144------------------43245888899999999961975-626
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA------------------EDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~------------------~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
                      |+++||.|++++|||||+|+||+++|+|..+.+..                  .+.++...||+++.++.+|.|+. .|.
T Consensus       155 ~t~sLa~El~~~GIrVn~I~PG~v~T~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dp~~~~~~~~~~~~~d~~~~~  234 (257)
T PRK09291        155 IAEAMHAELAPFGIQVATVNPGPYRTGFNDRMMETPRRWYDPARHFVTPEDLRFPLEQFDPQEMIDKMVEVIPADTGLFR  234 (257)
T ss_pred             HHHHHHHHHCCCCCEEEEEEECCCCCCCCHHHHHCHHHHCCCHHHHCCHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCHH
T ss_conf             99999998430095899998479998600333339687649455404777651724457979999999988526884001


Q ss_pred             C
Q ss_conf             6
Q gi|254780337|r  239 T  239 (257)
Q Consensus       239 t  239 (257)
                      +
T Consensus       235 ~  235 (257)
T PRK09291        235 N  235 (257)
T ss_pred             C
T ss_conf             2


No 165
>PRK08862 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=359.64  Aligned_cols=224  Identities=15%  Similarity=0.203  Sum_probs=202.5

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++|||||++|||+++|++|+++|++|++++|++++++++.+++.+.+.++..+.+|++|+++++.+++++.++|
T Consensus         1 Mdlk~Kv~lITGas~GIG~aiA~~~A~~Ga~Vii~~r~~~~l~~~~~~i~~~g~~~~~~~~d~~~~~~v~~~~~~i~~~~   80 (227)
T PRK08862          1 MDIKNSIILITSAGSVLGRTISCHFARLGATLILCDQDQSALNDTYEQCSALTDNVYSYQLKDFSQESIRHLFDAIEQQF   80 (227)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             99999999997988799999999999879999999699999999999999758974899951661999999999999995


Q ss_pred             CC-CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             89-879987687588888867659999999999998999999999999998608-9869997883564788983688989
Q gi|254780337|r   94 GK-LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        94 g~-iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      |+ +|+||||||.......+.+.+.++|++.+++|+.+.|.++|.+.|.|++++ .|+|||++|..+   .+..+.|++|
T Consensus        81 g~~iDvLVNNa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~~~~~~G~IINi~S~~~---~~~~~~y~as  157 (227)
T PRK08862         81 NRAPDVLVNNWTSSPLPSLFDEQPSESFIQQLTSLASTLFTYGQVAAERMRKRKKKGVIVNVISHDD---HQDLTGVESS  157 (227)
T ss_pred             CCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECC---CCCCHHHHHH
T ss_conf             8997499856645778863345889999999998656999999999999996699879999976876---6882789999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHHHCCCCCEEEEC
Q ss_conf             999999999999985443869975532883797798441444324588889999999996197562668579876
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP  246 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~~~~tG~~~~vd  246 (257)
                      |+|+.+|||+||.||+++|||||+|+||+++|+|.-..+     .....|||+++.+.|+.+ ..|.||+++.||
T Consensus       158 Kaav~~lTkslA~Ela~~gIRVNaVaPG~i~Te~~~~~~-----~~~~~~~e~~~~~~~~~~-~~~~~~~~~~~~  226 (227)
T PRK08862        158 TALVSGFTHSWAKELTPFNIRVGGVVPSIFNAEGDLDAV-----HWAQIQDELIRNTEYIVA-NEYFSGRVVEAE  226 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEECCEECCCCCCCCC-----CCHHHHHHHHHHHHHHHH-CCCCCCEEEEEE
T ss_conf             999999999999997674989999943808879877653-----632208999996079972-677364699974


No 166
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]
Probab=100.00  E-value=0  Score=359.54  Aligned_cols=219  Identities=29%  Similarity=0.378  Sum_probs=201.6

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      ++++|+++|||||+|||.++|++|+++|++|++++|+.++|+++++++.+  .++.+..+||+|+++++++++...++||
T Consensus         3 ~~~~kv~lITGASSGiG~A~A~~l~~~G~~vvl~aRR~drL~~la~~~~~--~~~~~~~~DVtD~~~~~~~i~~~~~~~g   80 (246)
T COG4221           3 TLKGKVALITGASSGIGEATARALAEAGAKVVLAARREERLEALADEIGA--GAALALALDVTDRAAVEAAIEALPEEFG   80 (246)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC--CCEEEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             77786899946865688999999997899699986368899999986256--7437896136788999999999997517


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      ++|+||||||.... .|+.+.+.+||++|+|+|++|.++.+|+++|.|.+++.|+|||++|.+|..++|+.+.||+||++
T Consensus        81 ~iDiLvNNAGl~~g-~~~~~~~~~dw~~Mid~Ni~G~l~~~~avLP~m~~r~~G~IiN~~SiAG~~~y~~~~vY~ATK~a  159 (246)
T COG4221          81 RIDILVNNAGLALG-DPLDEADLDDWDRMIDTNVKGLLNGTRAVLPGMVERKSGHIINLGSIAGRYPYPGGAVYGATKAA  159 (246)
T ss_pred             CCCEEEECCCCCCC-CHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHHH
T ss_conf             60589966877768-70354899999999998889999999886668886479639995351333667998600236999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC---------CCCCCCCHHHHHHHHHHHHCHHH
Q ss_conf             999999999985443869975532883797798441444---------32458888999999999619756
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE---------DPNTVPHPQKVAKIISFLCATQK  236 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~---------~~~~~~~pediA~~v~fL~s~~~  236 (257)
                      +..|+++|+.|+.+++|||.+|+||.+.|..........         ......+|+|||++|.|..+...
T Consensus       160 V~~fs~~LR~e~~g~~IRVt~I~PG~v~~~~~s~v~~~g~~~~~~~~y~~~~~l~p~dIA~~V~~~~~~P~  230 (246)
T COG4221         160 VRAFSLGLRQELAGTGIRVTVISPGLVETTEFSTVRFEGDDERADKVYKGGTALTPEDIAEAVLFAATQPQ  230 (246)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCEECCEECCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             99999999987337984699863760210003434687406667777605877998999999999985998


No 167
>PRK06482 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=353.61  Aligned_cols=211  Identities=24%  Similarity=0.348  Sum_probs=190.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999999999998189879
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      ||+||||+|+|||+++|+.|+++|++|++++|+.++++++..   ..+.++..+++|++|+++++++++++.++||+||+
T Consensus         3 Kv~lITGaSsGiG~ala~~l~~~G~~Vi~t~R~~~~l~~l~~---~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDv   79 (276)
T PRK06482          3 KTWFITGASSGFGRGLTERLLARGDRVAATVRRPDALDDLKA---RYGERLWVLQLDVTDTAAVRAVVDRAFAELGRIDV   79 (276)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH---HCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             789991586599999999999889989999789899999998---66995799995379999999999999998099878


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             98768758888886765999999999999899999999999999860898699978835647889836889899999999
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEAL  178 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~l  178 (257)
                      ||||||+ ...++++|+++++|+++|++|++|+++++|+++|+|++++.|+||||||++|..+.|++++|++||+||.+|
T Consensus        80 LVNNAG~-~~~g~~ee~~~~~~~~~~~vN~~g~~~~~ra~lP~mr~~~~G~IinisS~~g~~~~p~~~~Y~AsK~Al~g~  158 (276)
T PRK06482         80 VVSNAGY-GLFGAAEELSDAQIRRQIDTNLTGSIQVIRAALPHLRRQGGGRIVQVSSEGGQIAYPGFSLYHASKWGIEGF  158 (276)
T ss_pred             EEECCCC-CCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             8746877-788876767757799998874177999999857355755897799954524346899976899999999999


Q ss_pred             HHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC--------------------CCCCCCCHHHHHHHHHHHHC
Q ss_conf             99999985443869975532883797798441444--------------------32458888999999999619
Q gi|254780337|r  179 ARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE--------------------DPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       179 t~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~--------------------~~~~~~~pediA~~v~fL~s  233 (257)
                      +++|+.|+++.|||||+|+||+++|+|........                    .....+.|+..|+++.-++.
T Consensus       159 tesLa~El~~~gI~V~~V~PG~~~T~f~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~gdp~k~a~~i~~~~~  233 (276)
T PRK06482        159 VESVRQEVAPFGIGFTIVEPGPTRTNFGAGLDRAAPLDAYDDTPVGALRRALADGSFAIPGDPQKMVDAMIASAD  233 (276)
T ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHC
T ss_conf             999999844319389999718985898776666788831013629999999982479999999999999999975


No 168
>PRK06940 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=352.16  Aligned_cols=228  Identities=18%  Similarity=0.224  Sum_probs=192.1

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +|++|+++|||++ |||+++|++|+ +|++|++++|++++++++.+++++.|.++.++++|++|+++++++++.+ ++||
T Consensus         2 rL~~kV~v~tGa~-GIG~aiA~~la-~Ga~vvi~~~~~~~l~~~~~~l~~~g~~~~~~~~Dvs~~~~v~~l~~~~-~~~G   78 (277)
T PRK06940          2 NMSKEVVVVIGAG-GMGQAIARRVG-SGKTVLLADYNEENLQAVARTLREAGFDVITQQVDVSSRESVKALAQTA-ATLG   78 (277)
T ss_pred             CCCCCEEEECCCC-HHHHHHHHHHH-HCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHH-HHHC
T ss_conf             9899299997816-99999999998-1998999989889999999998722882999982579989999999999-9869


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC---------------------------
Q ss_conf             98799876875888888676599999999999989999999999999986089---------------------------
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHC---------------------------  147 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~---------------------------  147 (257)
                      ++|+||||||+...        ...|+.++++|+.+++.+.+.+.+.|..+..                           
T Consensus        79 ~idiLVnnAG~~~~--------~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~  150 (277)
T PRK06940         79 AVTGLVHTAGVSPS--------QASPEAILKVDLYGTALVLEEFGKVIAPGGAGVVIASMSGHRLPALTAEQEQALATTP  150 (277)
T ss_pred             CCCEEEECCCCCCC--------CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECHHHHHHHHHHHHHHHHHHCCC
T ss_conf             98799988867866--------5789999988668899999999999984982899860444311144566654540267


Q ss_pred             -CEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC------------CCCC
Q ss_conf             -869997883564788983688989999999999999985443869975532883797798441------------4443
Q gi|254780337|r  148 -GRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM------------PAED  214 (257)
Q Consensus       148 -G~IInisS~~g~~~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~------------~~~~  214 (257)
                       +.++++++..+....+...+|++||+|+.+|||++|.||+++|||||+|+||+|+|||..+.+            ...|
T Consensus       151 ~~~i~~~~~~~~~~~~~~~~aY~~sK~a~~~ltk~lA~e~a~~gIRVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~P  230 (277)
T PRK06940        151 TEELLSLPFLQPDSIEDPLHAYQFAKRANVLRVRAAAVKWGARGARINSISPGIISTPMGQDELAGPRGDGYRAMIAKSG  230 (277)
T ss_pred             CCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCEECCHHHHHHCCCCHHHHHHHHHCCC
T ss_conf             65266410002333563239999999999999999999998649657787557672735687753665899999985699


Q ss_pred             CCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCCCEECC
Q ss_conf             245888899999999961975-626685798768763154
Q gi|254780337|r  215 PNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNRFVNY  253 (257)
Q Consensus       215 ~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG~~~n~  253 (257)
                      .+|+++|||||++++||+|++ +|+|||+|.||||....+
T Consensus       231 ~gR~g~peeia~~v~FL~Sd~as~iTG~~i~VDGG~tA~~  270 (277)
T PRK06940        231 TGRIGTPDDIAAAAEFLMGPEGSFITGADLLVDGGVTAAY  270 (277)
T ss_pred             CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCCCC
T ss_conf             8998789999999999958443694484389585710186


No 169
>PRK08251 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=351.49  Aligned_cols=212  Identities=26%  Similarity=0.293  Sum_probs=194.9

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             8899999389986889999999988998999978989999999999864--99289998789999999999999999818
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +.|++||||||+|||+++|++|+++|++|++++|+.++++++++++.+.  +.++.++++|++|+++++++++++.+++|
T Consensus         1 t~K~vlITGAssGIG~alA~~la~~G~~v~l~~r~~~~l~~~~~el~~~~~~~~v~~~~~Dvsd~~~v~~~~~~~~~~~g   80 (248)
T PRK08251          1 TRQKILITGASSGLGAGMAREFAAKGRDLALCARRTDRLEELKAELLARYPGIKVAVAALDVNDHDQVFEVFAEFSDELG   80 (248)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             99989994786399999999999879989999898889999999998737997399997867868999999999999809


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCC-CHHHHHHHH
Q ss_conf             9879987687588888867659999999999998999999999999998608986999788356478898-368898999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL-WGAYSASKA  173 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~-~~~Y~asKa  173 (257)
                      ++|+||||||+. ...++.+.+.|+|++++++|+.|++.+++.++|.|++++.|+|||+||++|.++.|+ .++|++||+
T Consensus        81 ~iD~lvnNAGi~-~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~l~~m~~~~~G~Iv~isS~ag~~~~p~~~~~Y~aSKa  159 (248)
T PRK08251         81 GLDRVIVNAGIG-KGARLGTGKFWANKATAETNFVAALAQCEAAMEIFREQGSGHLVLISSVSAVRGLPGAKTAYAASKA  159 (248)
T ss_pred             CCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCCCCCHHHHHHHH
T ss_conf             998999857657-8866555999999999999829999999999876554058729999574442678997478999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             99999999999854438699755328837977984414443245888899999999961
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~  232 (257)
                      |+.+|+++|+.|++++||+||+|+||+|+|+|.++.-   +..-+.+||++|+.+.--.
T Consensus       160 al~~~~~~L~~El~~~gI~V~~i~PG~v~T~m~~~~~---~~~~~~~~e~~A~~i~~ai  215 (248)
T PRK08251        160 GLASLGEGLRAEYAKTPIKVSTIEPGYIRSEMNEKAK---STPFMVDTETGVKAMVKAI  215 (248)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCC---CCCCCCCHHHHHHHHHHHH
T ss_conf             9999999999984666929999986899852244888---7998789999999999999


No 170
>PRK07024 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=351.75  Aligned_cols=210  Identities=27%  Similarity=0.288  Sum_probs=188.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999999999998189879
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      |++||||||+|||+++|++|+++|++|++++|+++.++++.+++.  +.++.++.+|++|+++++++++++.+++|.+|+
T Consensus         3 ~~VlITGassGIG~a~A~~la~~G~~v~l~~R~~~~L~~~~~~~~--~~~~~~~~~Dv~d~~~~~~~~~~~~~~~g~iDi   80 (256)
T PRK07024          3 LKVFITGASSGIGQALAREYARQGATLGLVARRTDALQAFAARLP--KARVSVYAADVRDADALAAAAADFIAAHGCPDV   80 (256)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC--CCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             989998460299999999999889989999898899999999767--997699981179999999999999998399879


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             98768758888886765999999999999899999999999999860898699978835647889836889899999999
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEAL  178 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~l  178 (257)
                      ||||||+.......++.+.|.|+++++||++|+++++|.++|.|++++.|+||||+|.+|..+.|+.++|++||+|+.+|
T Consensus        81 linNAGi~~~~~~~~~~d~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~Iv~isS~ag~~g~p~~~~Y~ASKaal~~~  160 (256)
T PRK07024         81 VIANAGISVGTLTGEGEDLAVFREVMDTNYYGMVATFEPFIAPMRAARRGTLVGIASVAGVRGLPGAGAYSASKAAAIKY  160 (256)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             99888556788644537899999999999999999999876875026893499843545416899970799999999999


Q ss_pred             HHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             999999854438699755328837977984414443245888899999999961
Q gi|254780337|r  179 ARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       179 t~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~  232 (257)
                      +++|+.|++++||+|++|+||+|+|+|.+...  .+...+.+||++|+.+.--.
T Consensus       161 ~esL~~el~~~gI~V~~i~PG~v~T~m~~~~~--~~~p~~~~pe~vA~~i~~ai  212 (256)
T PRK07024        161 LESLRVELRPAGVRVVTIAPGYIRTPMTAHNP--YPMPFLMDADRFAARAARAI  212 (256)
T ss_pred             HHHHHHHHCCCCEEEEEEEECCCCCCCCCCCC--CCCCCCCCHHHHHHHHHHHH
T ss_conf             99999986577948999971899588777799--99987689999999999999


No 171
>PRK08264 short chain dehydrogenase; Validated
Probab=100.00  E-value=0  Score=352.65  Aligned_cols=209  Identities=25%  Similarity=0.334  Sum_probs=182.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             5248899999389986889999999988998-999978989999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAY-VIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      |+|+||++||||||+|||+++|++|+++|++ |++..|+.+.++         ..++..+++|++|+++++++++    +
T Consensus         1 m~l~gK~alITGassGIG~aiA~~la~~Ga~~V~~~~r~~~~~~---------~~~~~~~~~Dv~d~~~v~~~~~----~   67 (235)
T PRK08264          1 MDIKGKVVLVTGANRGIGRAFVEELLARGAAKVYAAARDPESVD---------LPRVVPLQLDVTDPASVAAAAE----Q   67 (235)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHCC---------CCCEEEEEECCCCHHHHHHHHH----H
T ss_conf             92799889992675499999999999869977999727840355---------5987999806899999999999----7


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      .+.+|+||||||+.....++++.+.|+|++++++|++|+++++|.++|+|++++.|+||||+|.+|+.+.|++++|++||
T Consensus        68 ~~~idvlVnNAGi~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~p~m~~~~~G~IvnisS~~g~~~~p~~~~Y~aSK  147 (235)
T PRK08264         68 ASDVTILINNAGISRPGSLLAEGDLDALRAEMETNVFGPLRMARAFAPVLAANGGGAIVNVLSVLSWVNFPNLGAYSASK  147 (235)
T ss_pred             CCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHH
T ss_conf             39986999888557789864559999999999997299999998726999857998599992754448999976799999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC-CC-------------CCC-CCCCHHHHHHHHHHHHCHH
Q ss_conf             999999999999854438699755328837977984414-44-------------324-5888899999999961975
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP-AE-------------DPN-TVPHPQKVAKIISFLCATQ  235 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~-~~-------------~~~-~~~~pediA~~v~fL~s~~  235 (257)
                      +|+.+|+++|+.|++++|||||+|+||+|+|+|.+.... ..             +.+ +...|+|+|++|.||.|..
T Consensus       148 aal~~~~~~La~El~~~gI~V~~i~PG~v~T~m~~~~~~~~~~p~~va~~i~~~~~~g~~~v~p~~~ar~v~~~~~~~  225 (235)
T PRK08264        148 AAAWSLTQALREELAPQGTRVLGVHPGYIDTDMTAGLDVPKASPADVARQILDALEAGDEEVLPDDMTRQVKAALSAD  225 (235)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEECCCHHHHHHHHHHHCC
T ss_conf             999999999999850329389999728999676799998989999999999999986997887509999999997439


No 172
>PRK05993 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=350.96  Aligned_cols=213  Identities=26%  Similarity=0.354  Sum_probs=187.9

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |.|+   |++||||||+|||+++|++|+++|++|++++|++++++++..+      .+..+.+|++|+++++.+++++.+
T Consensus         1 M~m~---K~vlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~------~~~~~~~Dv~d~~~v~~~v~~~~~   71 (277)
T PRK05993          1 MDMK---RSILITGCSSGIGAYCAHALQKRGWRVFATCRKPEDIAALEAE------GLEAFYLDYAEPESIAALVAQVLE   71 (277)
T ss_pred             CCCC---CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC------CCEEEEEECCCHHHHHHHHHHHHH
T ss_conf             9998---6899925686999999999998799999997999999999848------981999726677999999999999


Q ss_pred             HH-CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             81-89879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   92 RW-GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        92 ~~-g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      .+ |++|+||||||+. ..+++++++.|+|+++|+||++|+++++|+++|+|++++.|+|||+||.+|+.+.|+.++||+
T Consensus        72 ~~~g~id~lvNnAg~~-~~g~~e~~~~~~~~~~~~vN~~g~~~~~~~~lP~m~~~~~G~IVnisSi~g~~~~p~~~~Y~a  150 (277)
T PRK05993         72 LSGGKLDALFNNGAYG-QPGAVEDLPVEALRAQFEANFFGWHDLTRRIIPVMRKQGHGRIVQCSSILGLVPMKYRGAYNA  150 (277)
T ss_pred             HHCCCEEEEEECCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCCCCHHHH
T ss_conf             8089706999666435-677088867999999988701899999999723313489838999888444888999838999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC---------C------------------CCCCCCCHHH
Q ss_conf             999999999999998544386997553288379779844144---------4------------------3245888899
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA---------E------------------DPNTVPHPQK  223 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~---------~------------------~~~~~~~ped  223 (257)
                      ||+||.+|+++|+.|++++||+|++|+||+|+|+|.......         .                  .......||+
T Consensus       151 SK~Av~~~~~sLr~El~~~gI~V~~i~PG~v~T~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pe~  230 (277)
T PRK05993        151 SKFAIEGLSDTLRMELQGSGIHVSLIEPGPIATRFRANALAAFKAWIDVENSVHRAAYQQQMARLEGGGSKSRFKLGPEA  230 (277)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHH
T ss_conf             99999999999999856328689999648887875303467776424533570288999999999702555666799999


Q ss_pred             HHHHHHHHHCH
Q ss_conf             99999996197
Q gi|254780337|r  224 VAKIISFLCAT  234 (257)
Q Consensus       224 iA~~v~fL~s~  234 (257)
                      +|+.+...+..
T Consensus       231 va~~i~~a~~~  241 (277)
T PRK05993        231 VYSVLLHALTA  241 (277)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999817


No 173
>PRK05693 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=345.75  Aligned_cols=207  Identities=25%  Similarity=0.346  Sum_probs=184.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999999999998189879
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      |||||||||+|||+++|++|+++|++|++++|+.++++++++      ..+..+.+|++|+++++++++++.+++|++|+
T Consensus         2 KvvlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~------~~~~~~~~Dvtd~~~i~~~~~~~~~~~g~iDi   75 (274)
T PRK05693          2 PVVLITGCSSGIGRALADAFKAAGYEVWATARKAEDVEALAA------AGFTAVQLDVNDGAALARLAEELEAEHQGLDV   75 (274)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH------CCCCEEEEECCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             989994888589999999999879999999799999999984------89918998469989999999999997299768


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             98768758888886765999999999999899999999999999860898699978835647889836889899999999
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEAL  178 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~l  178 (257)
                      ||||||+. ..+++++++.|+|+++++||++|+++++|+++|.|+++ .|+||||+|.+|..+.|+.++||+||+|+.+|
T Consensus        76 LVNNAG~~-~~g~~~~~~~~~~~~~~~vN~~g~~~~~~~~lP~m~~~-~G~IVnisS~ag~~~~p~~~~Y~aSK~Al~~~  153 (274)
T PRK05693         76 LINNAGYG-AMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPLLRRS-RGLVVNIGSVSGVLVTPFAGAYCASKAAVHAL  153 (274)
T ss_pred             EEECCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCEEEEEECCHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             99888677-88758987689999999998199999999999999758-96799981405326899973799999999999


Q ss_pred             HHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC-------CCC----------------CCCCCCCHHHHHHHHHHHHC
Q ss_conf             99999985443869975532883797798441-------444----------------32458888999999999619
Q gi|254780337|r  179 ARTWSKETVNTALRVINIDPGPTRTSMRAKAM-------PAE----------------DPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       179 t~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~-------~~~----------------~~~~~~~pediA~~v~fL~s  233 (257)
                      +++|+.|++++||+|++|+||+|+|+|.....       +..                ..++...|+++|+.++..+.
T Consensus       154 s~sLr~El~~~gI~V~~v~PG~i~T~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~va~~iv~ai~  231 (274)
T PRK05693        154 SDALRLELAPFGVQVMEVQPGAIASQFASNASREAEQLLAEQSPWWPLREHIQARARASQDNPTPAAEFARQLLAAVQ  231 (274)
T ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             999999842028789999718887864465454342147767820568999999997524489999999999999996


No 174
>PRK09009 C factor cell-cell signaling protein; Provisional
Probab=100.00  E-value=0  Score=345.72  Aligned_cols=221  Identities=21%  Similarity=0.282  Sum_probs=191.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      .+||||||+|||++++++|+++|+.+.+.++......      +....++.++++|++|+++++++.    ++++++|+|
T Consensus         2 nVLITGas~GIG~aia~~l~~~~~~~~v~~~~~~~~~------~~~~~~v~~~~~Dvt~~~~i~~~~----~~~~~iD~l   71 (235)
T PRK09009          2 NILIVGGSGGIGKAMVKQLLETYPDATVHATYRHHKP------DFRHDNVQWHALDVTDEAEIKQLS----EQFTQLDWL   71 (235)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCCC------CCCCCCEEEEECCCCCHHHHHHHH----HHHCCCCEE
T ss_conf             7999755639999999999856998099997377654------445798389987479999999999----870877899


Q ss_pred             EECCCCCC-----CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC---CCCCCHHHHHH
Q ss_conf             87687588-----88886765999999999999899999999999999860898699978835647---88983688989
Q gi|254780337|r  100 IANAGILG-----SISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK---CRPLWGAYSAS  171 (257)
Q Consensus       100 VNNAGi~~-----~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~---~~~~~~~Y~as  171 (257)
                      |||||+..     +..++.+++.|+|++++++|+.++|+++|+++|.|++++.|+|+++||..|..   +.+++.+|++|
T Consensus        72 innAGi~~~~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~l~~~~~~~iv~isS~~g~i~~~~~~g~~~Y~aS  151 (235)
T PRK09009         72 INCVGMLHTQDKGPEKSLQSLDSDFFLQNITLNTLPSLLLAKHFTPLLKQSESARFAVISAKVGSISDNRLGGWYSYRAS  151 (235)
T ss_pred             EECCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCHHHHHH
T ss_conf             97675244677776468677899999999988619999999999999986078764012223415778888862366999


Q ss_pred             HHHHHHHHHHHHHHHHHH--CCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCC
Q ss_conf             999999999999985443--8699755328837977984414443245888899999999961975-6266857987687
Q gi|254780337|r  172 KAAIEALARTWSKETVNT--ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN  248 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~--gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG  248 (257)
                      |+|+++|||+||.||++.  +|+||+|+||+|+|+|.++.....|.+|+++|||+|++++||+|++ +|+||+.+.||||
T Consensus       152 KaAl~~lt~~la~E~~~~~~~i~V~~i~PG~v~T~m~~~~~~~~p~~r~~~PeeiA~~i~~L~s~~s~~~tG~~i~vdG~  231 (235)
T PRK09009        152 KAALNMFLKTLSIEWQRSLKHGVVLALHPGTTDTPLSKPFQQNVPKGKLFTPEYVAQCLLGIIANATPAQSGSFLAYDGE  231 (235)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEECCC
T ss_conf             99999999999999764269968999814865671230678579988882999999999999716972369888978977


Q ss_pred             CE
Q ss_conf             63
Q gi|254780337|r  249 RF  250 (257)
Q Consensus       249 ~~  250 (257)
                      ..
T Consensus       232 ~~  233 (235)
T PRK09009        232 EL  233 (235)
T ss_pred             CC
T ss_conf             87


No 175
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]
Probab=100.00  E-value=0  Score=337.16  Aligned_cols=226  Identities=29%  Similarity=0.427  Sum_probs=203.8

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             4889999938998688999999998899899997898999999999986-499289998789999999999999999818
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK-INKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~-~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      ..+|++||||||+|||+++|++||++|++|++++|++++|++++++++. .+.++..+++|++++++++++.+++.++++
T Consensus         4 ~~~~~~lITGASsGIG~~~A~~lA~~g~~liLvaR~~~kL~~la~~l~~~~~v~v~vi~~DLs~~~~~~~l~~~l~~~~~   83 (265)
T COG0300           4 MKGKTALITGASSGIGAELAKQLARRGYNLILVARREDKLEALAKELEDKTGVEVEVIPADLSDPEALERLEDELKERGG   83 (265)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHCCC
T ss_conf             77867999778864899999999977997999967699999999999873086279997767883679999999982488


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      .||+||||||. +..++|.+++.++-.+++++|+.++..+++.++|.|.+++.|+||||+|.+|+.|.|..+.|++||++
T Consensus        84 ~IdvLVNNAG~-g~~g~f~~~~~~~~~~mi~lN~~a~~~LT~~~lp~m~~~~~G~IiNI~S~ag~~p~p~~avY~ATKa~  162 (265)
T COG0300          84 PIDVLVNNAGF-GTFGPFLELSLDEEEEMIQLNILALTRLTKAVLPGMVERGAGHIINIGSAAGLIPTPYMAVYSATKAF  162 (265)
T ss_pred             CCCEEEECCCC-CCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCHHHHHHHHHH
T ss_conf             52389977874-77665421885899999999999999999999999986589669998434532888632799999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHH-HHCCC---CCCCCCCCHHHHHHHHHHHHCHHHCCCCCEEEECC
Q ss_conf             999999999985443869975532883797798-44144---43245888899999999961975626685798768
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRA-KAMPA---EDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQ  247 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~-~~~~~---~~~~~~~~pediA~~v~fL~s~~~~~tG~~~~vdg  247 (257)
                      |.+|+++|+.|+.++||+|.+++||+|.|+|++ +....   .+...+.+|+++|+...+.+.     +++...+.|
T Consensus       163 v~~fSeaL~~EL~~~gV~V~~v~PG~~~T~f~~~~~~~~~~~~~~~~~~~~~~va~~~~~~l~-----~~k~~ii~~  234 (265)
T COG0300         163 VLSFSEALREELKGTGVKVTAVCPGPTRTEFFDAKGSDVYLLSPGELVLSPEDVAEAALKALE-----KGKREIIPG  234 (265)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHH-----CCCCEEECC
T ss_conf             999999999983589849999965733355333444432112321230699999999999985-----098368237


No 176
>PRK07102 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=337.76  Aligned_cols=208  Identities=19%  Similarity=0.210  Sum_probs=189.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999389986889999999988998999978989999999999864-99289998789999999999999999818987
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      |++||||||+|||+++|++|+++|++|++++|+.++++++.++++.. +.++.++.+|++|.++++++++++.   +.+|
T Consensus         2 K~vlITGassGIG~a~A~~la~~G~~v~l~~R~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~---~~~d   78 (243)
T PRK07102          2 KKILIIGATSDIARACARRYAAAGARLYLAARDTERLERIAADLEARGAVAVATHELDILDTARHAAFLDNLP---ALPD   78 (243)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHH---HHCC
T ss_conf             9799915745999999999998799899998988999999999985358628998434036999999999987---5379


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             99876875888888676599999999999989999999999999986089869997883564788983688989999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      +++||||+.. ..++.+.+.++|++++++|+.|++++++.++|+|++++.|+||||||.+|..+.|+.++|++||+|+.+
T Consensus        79 ~~v~~aG~~~-~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~~~~m~~~~~G~Iv~isS~ag~~g~p~~~~Y~aSKaal~~  157 (243)
T PRK07102         79 TVLIAVGTLG-DQAACEADPALALREFRTNFEGPIALLTLLANRFEARGSGTIVGISSVAGDRGRASNYVYGSAKAALTA  157 (243)
T ss_pred             EEEEEEECCC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             7999730367-873023999999999999989999999999999887239749998256647789998269999999999


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9999999854438699755328837977984414443245888899999999961
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~  232 (257)
                      |+++|+.|++++|||||+|+||+|+|||.+..-  .+.....+||++|+.+.--.
T Consensus       158 ~~~sL~~El~~~gI~V~~v~PG~v~T~m~~~~~--~~~~~~~~pe~vA~~i~~ai  210 (243)
T PRK07102        158 FLSGLRNRLFKSGVHVLTVKPGFVDTPMTAGLK--LPGPLTAQPEEVAKDIFRAI  210 (243)
T ss_pred             HHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCC--CCCCCCCCHHHHHHHHHHHH
T ss_conf             999999985020919999971889675666899--98877699999999999999


No 177
>PRK08017 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=339.47  Aligned_cols=209  Identities=25%  Similarity=0.349  Sum_probs=184.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH-CCCC
Q ss_conf             999993899868899999999889989999789899999999998649928999878999999999999999981-8987
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW-GKLD   97 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~-g~iD   97 (257)
                      |++||||||+|||+++|++|+++|++|++++|++++++++.    +.+  ...+.+|++|+++++++++++.+.. |++|
T Consensus         3 K~vlITGassGIG~a~A~~la~~G~~V~~~~r~~~~l~~~~----~~~--~~~~~~D~~~~~~~~~~~~~~~~~~~g~id   76 (256)
T PRK08017          3 KSVLITGCSSGIGLESALELKRQGFRVLAGCRKPDDVARMN----SMG--FTGVLIDLDSPESVDRAADEVIALTDNRLY   76 (256)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCC--CCEEEEECCCHHHHHHHHHHHHHHHCCCEE
T ss_conf             78999658768999999999987999999969989999998----569--946998358989999999999998489748


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             99876875888888676599999999999989999999999999986089869997883564788983688989999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      +||||||+. ..+++++++.++|++++++|+.|+++++|.++|.|++++.|+|||+||.+|+.+.|+.++|++||+|+.+
T Consensus        77 ~linnAG~~-~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IV~isS~ag~~~~p~~~~Y~asKaal~~  155 (256)
T PRK08017         77 GIFNNAGFG-VYGPLSTISRQQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEA  155 (256)
T ss_pred             EEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             999889667-7888587664533467632113320276641712210489449999576664889997489999999999


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC---CC---C----CCCCCHHHHHHHHHHHHCH
Q ss_conf             99999998544386997553288379779844144---43---2----4588889999999996197
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA---ED---P----NTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~---~~---~----~~~~~pediA~~v~fL~s~  234 (257)
                      |+++|+.|++++|||||+|+||+|+|+|.+.....   .+   +    .....||++|+.+...+..
T Consensus       156 ~~~sL~~El~~~gI~V~~V~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~pe~vA~~i~~ai~~  222 (256)
T PRK08017        156 WSDALRMELRHSGIKVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGPEAVVDKVRHAFES  222 (256)
T ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCHHHCCCCCCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999846219289999728997720105251133354435102311479999999999999956


No 178
>PRK07578 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=340.17  Aligned_cols=196  Identities=21%  Similarity=0.275  Sum_probs=178.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             99938998688999999998899899997898999999999986499289998789999999999999999818987998
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILI  100 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDilV  100 (257)
                      +||||||+|||+++|++|+++ +.|+.++|+..+                 +++|++|++++++++++    +|++|+||
T Consensus         3 VlVTGas~GIG~aia~~la~~-~~vv~~~r~~~~-----------------~~~Dvtd~~~v~~~~~~----~G~iD~lV   60 (199)
T PRK07578          3 ILVIGASGTIGRAVVAELSAR-HEVITAGRSSGD-----------------VQVDITDPASIRALFEK----VGKVDAVV   60 (199)
T ss_pred             EEEECCCCHHHHHHHHHHHCC-CCEEEEECCCCC-----------------EEEECCCHHHHHHHHHH----HCCCCEEE
T ss_conf             999998748999999999679-998998368677-----------------56858899999999996----29998999


Q ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             76875888888676599999999999989999999999999986089869997883564788983688989999999999
Q gi|254780337|r  101 ANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR  180 (257)
Q Consensus       101 NNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt~  180 (257)
                      ||||+. ..+|++++++|+|++++++|++|+|+++|++.|+|++  .|+||++||.+++.|.|+.++|++||+|+.+|||
T Consensus        61 nnAG~~-~~~~~~~~~~e~~~~~~~~nl~g~~~l~~~~~~~l~~--gGsIv~isS~~~~~~~~~~~~Y~asKaal~~ltr  137 (199)
T PRK07578         61 SAAGKV-HFAPLTEMTDEDFQLGLQSKLMGQINLVLIGQEYLND--GGSFTLTSGILSEEPIPGGASAATVNGALEGFVK  137 (199)
T ss_pred             ECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCEEEEEHHEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             887226-7989487999897778720013899999999998760--8985688313000768881899999999999999


Q ss_pred             HHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHHHCCCCCEEEE
Q ss_conf             99998544386997553288379779844144432458888999999999619756266857987
Q gi|254780337|r  181 TWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSV  245 (257)
Q Consensus       181 ~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~~~~tG~~~~v  245 (257)
                      +||.|+ ++|||||+|+||+|+|+| ++..+..+..+..+|||+|.+  ||.|.+.|+|||+|.|
T Consensus       138 ~lA~El-~~gIRVN~VaPG~V~T~m-~~~~~~~~~~~~~~~~~~A~a--~l~~~~~~~tgqv~~v  198 (199)
T PRK07578        138 AAALEL-PRGIRINVVSPTVLTESL-DKYGPFFPGFEPVPAADVALA--YLRSVEGAQTGEVYKV  198 (199)
T ss_pred             HHHHHC-CCCCEEEEEECCCCCCHH-HHCCCCCCCCCCCCHHHHHHH--HHHHHCCCCCCEEEEC
T ss_conf             999974-879799998568655656-655554899998799999999--9974225577437855


No 179
>KOG1205 consensus
Probab=100.00  E-value=0  Score=338.17  Aligned_cols=233  Identities=25%  Similarity=0.413  Sum_probs=201.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCC-C-EEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             524889999938998688999999998899899997898999999999986499-2-89998789999999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-K-IDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~-~-~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      ++++||||+|||||+|||+++|.+|++.|+++++++|+.++++.+++++++.+. . ++.+++|++|+++++++++++.+
T Consensus         8 e~~~~kvVvITGASsGIG~~lA~~la~~G~~l~lvar~~rrl~~v~~~l~~~~~~~~v~~~~~Dvs~~~~~~~~~~~~~~   87 (282)
T KOG1205           8 ERLAGKVVLITGASSGIGEALAYELAKRGAKLVLVARRARRLERVAEELRKLGSLEKVLVLQLDVSDEESVKKFVEWAIR   87 (282)
T ss_pred             HHHCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH
T ss_conf             87389889995787178899999998677734774243202899999999747867647996765887889999999998


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      .||++|+||||||+.. ..+.++.+.+++..+||+|++|+.+++|+++|+|++++.|+||+|+|++|+.+.|..+.||+|
T Consensus        88 ~fg~vDvLVNNAG~~~-~~~~~~~~~~~~~~~mdtN~~G~V~~Tk~alp~m~~r~~GhIVvisSiaG~~~~P~~~~Y~AS  166 (282)
T KOG1205          88 HFGRVDVLVNNAGISL-VGFLEDTDIEDVRNVMDTNVFGTVYLTKAALPSMKKRNDGHIVVISSIAGKMPLPFRSIYSAS  166 (282)
T ss_pred             HCCCCCEEEECCCCCC-CCCCCCCCHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHH
T ss_conf             6588888984686565-553344768988877100040248999999887663289749998061015578865541567


Q ss_pred             HHHHHHHHHHHHHHHHHHC--CEEEEECCCCCCCHHHHHHCCCCCC----CCCCCHHHHHH--HHHHHHCHH-HCCCCCE
Q ss_conf             9999999999999854438--6997553288379779844144432----45888899999--999961975-6266857
Q gi|254780337|r  172 KAAIEALARTWSKETVNTA--LRVINIDPGPTRTSMRAKAMPAEDP----NTVPHPQKVAK--IISFLCATQ-KIETGKL  242 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~g--Irvn~I~PG~v~T~m~~~~~~~~~~----~~~~~pediA~--~v~fL~s~~-~~~tG~~  242 (257)
                      |+||.+|+++|+.|+.+++  |++ .|+||+|+|++..........    ....+++|++.  .+.+..+.. ......+
T Consensus       167 K~Al~~f~etLR~El~~~~~~i~i-~V~PG~V~Te~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~  245 (282)
T KOG1205         167 KHALEGFFETLRQELIPLGTIIII-LVSPGPIETEFTGKELLGEEGKSQQGPFLRTEDVADPEAVAYAISTPPCRQVEDI  245 (282)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEE-EEECCCEEECCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHE
T ss_conf             999999999999996405845999-9845815524502543365542224631346654208999999835854364451


Q ss_pred             EEECCC
Q ss_conf             987687
Q gi|254780337|r  243 FSVPQN  248 (257)
Q Consensus       243 ~~vdgG  248 (257)
                      +.-+-+
T Consensus       246 ~~~p~~  251 (282)
T KOG1205         246 IIAPSW  251 (282)
T ss_pred             EECCCC
T ss_conf             555666


No 180
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase; InterPro: IPR013454    Rhamnose is a methyl-pentose sugar which is found as a constituent of pectin within the cell walls of dicotyledonous plants and has also been found in the mucilage of a number of legume plants . RhaD from Rhizobium leguminosarum bv. trifolii is encoded by a gene occurring in a rhamnose utilisation cluster, and is necessary for growth on this compound . This protein is predicted to be a bifunctional NAD-dependent aldolase/dehydrogenase..
Probab=100.00  E-value=0  Score=340.87  Aligned_cols=238  Identities=25%  Similarity=0.324  Sum_probs=210.7

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHH-HCCC-CEEE------------EECCCCC
Q ss_conf             652488999993899868899999999889989999789899999999998-6499-2899------------9878999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINK-KIDI------------FAFDLRD   78 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~-~~g~-~~~~------------~~~Dv~d   78 (257)
                      ...|..||++||||++|||+++|.+|+.+||.|++.|.|.+.++++.+++. ++|. ++..            +..||||
T Consensus       419 ek~LA~~Va~VtGGasGIG~~~A~rL~~eGAhvV~aD~d~~~a~~va~~~~~~fG~d~a~AGsdisaCGPaiGl~~DvT~  498 (709)
T TIGR02632       419 EKELARRVAFVTGGASGIGRETARRLVDEGAHVVLADLDAEAAEAVAAEIVDKFGADKAVAGSDISACGPAIGLKLDVTD  498 (709)
T ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEECCCCHHCCCCCEEEEEEECC
T ss_conf             96715706889738865268999999736977999623657899999998631388812114320004671002763175


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCH
Q ss_conf             99999999999998189879987687588888867659-999999999998999999999999998608-9869997883
Q gi|254780337|r   79 SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIK-EKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSG  156 (257)
Q Consensus        79 ~~~v~~~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~-~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~  156 (257)
                      +++|...|+++.-.||.+|++|||||+... +|+++++ .++|+..+||+.+|+|+.+|++...|++|+ +|.||+|+|.
T Consensus       499 e~~v~~~f~~v~~~yGGvD~vv~nAGi~~S-~p~~~t~r~~~W~l~~di~atG~FLVareA~r~~~~Q~lGG~~VfiaSk  577 (709)
T TIGR02632       499 EEAVKAAFAEVALAYGGVDIVVNNAGIAVS-SPLEETERLEEWDLNLDILATGYFLVAREAARLMRKQGLGGNIVFIASK  577 (709)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEECCCHHCC-CCCHHHHHHHHHHHCCEEEEECCHHHHHHHHHHHHHCCCCCCEEEECCE
T ss_conf             899999999999974984787652530105-7702322155432012010120035888999999731798556776110


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCC--CHHHHHH----------CC-------------
Q ss_conf             5647889836889899999999999999854438699755328837--9779844----------14-------------
Q gi|254780337|r  157 AAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTR--TSMRAKA----------MP-------------  211 (257)
Q Consensus       157 ~g~~~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~--T~m~~~~----------~~-------------  211 (257)
                      -+....|+..|||+|||+-.++.|+||.|++++|||||+|.|-.|-  +.|+...          ++             
T Consensus       578 Nav~A~kn~~AY~aaKA~~~Hl~R~LA~Ela~~GiRVNtV~PdaVl~GS~if~~~W~~~raA~ygi~ftadePtdvl~d~  657 (709)
T TIGR02632       578 NAVVAGKNASAYSAAKAAEAHLARCLAAELAELGIRVNTVNPDAVLRGSGIFDGEWREERAAAYGIPFTADEPTDVLADK  657 (709)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHH
T ss_conf             00111788405558999999899999981478864640106500110552153367888887707743468723578888


Q ss_pred             --CC-----CCCCCCCHHHHHHHHHHHHCHHH-CCCCCEEEECCCCEE
Q ss_conf             --44-----32458888999999999619756-266857987687631
Q gi|254780337|r  212 --AE-----DPNTVPHPQKVAKIISFLCATQK-IETGKLFSVPQNRFV  251 (257)
Q Consensus       212 --~~-----~~~~~~~pediA~~v~fL~s~~~-~~tG~~~~vdgG~~~  251 (257)
                        ..     ..++-.-|+|||++|.||+|..+ ..||++|+||||-.-
T Consensus       658 L~~fY~~RslLk~~v~p~d~AeAvf~L~S~~~~~tTG~~i~VDaG~~~  705 (709)
T TIGR02632       658 LEEFYAKRSLLKREVLPADIAEAVFFLASDKLEKTTGLIITVDAGVAA  705 (709)
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCEECCCCCCCC
T ss_conf             988987543237766808899999997345101027866403777522


No 181
>PRK05884 short chain dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=331.04  Aligned_cols=216  Identities=18%  Similarity=0.215  Sum_probs=183.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      .+|||||++|||+++|++|+++|++|++++|++++++.+.++++     ...+.||++|+++++++.+.+.+.   +|+|
T Consensus         2 ~VlVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~el~-----~~~~~~d~~d~~~~~~~~~~~~~~---~d~l   73 (223)
T PRK05884          2 EVLVTGGDTDLGRTIAEGFRNDGHKVTLVGARRDDLEVAAKELD-----VDAIVCDNTDPASLEEARGLFPHH---LDTI   73 (223)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC-----CCEEEEECCCHHHHHHHHHHHHHH---HCCE
T ss_conf             39998788799999999999879999999598789999985348-----768998527889999999999986---1947


Q ss_pred             EECCCCCCCC----CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             8768758888----886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r  100 IANAGILGSI----SPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus       100 VNNAGi~~~~----~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      +|+++.....    ....+.+.++|++++++|++++|+++|.+.|+|+  ++|+|||++|..+    |..++|+++|+|+
T Consensus        74 vn~~~~~~~~~~~~~~~~~d~~~~w~~~~~~nl~~~~~~~~~~~~~m~--~~G~Iini~s~~~----~~~~~~~asKaal  147 (223)
T PRK05884         74 VNVPAPSWDAGDPRTYSLADTANAWRNALDATVLSAVLTVQSVGDHLR--SGGSIINVVPENP----PAGSADAAIKAAL  147 (223)
T ss_pred             EEEEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCEEEEEECCCC----CCCCHHHHHHHHH
T ss_conf             884123024787555621215999999999997999999999998615--8987999945767----8875899999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCCCEECC
Q ss_conf             999999999854438699755328837977984414443245888899999999961975-626685798768763154
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNRFVNY  253 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG~~~n~  253 (257)
                      .+|||+||.||+++|||||+|+||.+.|++.+... ..   ..+.|+|||++++||||++ +|+|||+|.||||.+.++
T Consensus       148 ~~~t~~lA~e~~~~gIrVN~IaPG~~~~~~~~~~~-~~---~~~~~~evA~~~~FLaS~~as~iTGq~i~VDGG~~a~~  222 (223)
T PRK05884        148 SNWTAGQAEVFGTRGITINAVACGRSVQPGYDGLS-RT---PPPVAAEIARLALFLTTPAARHITGQTLHVSHGALAHF  222 (223)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHH-CC---CCCCHHHHHHHHHHHCCCHHCCEECCEEEECCCCCCCC
T ss_conf             99999999996765979979807998883156871-68---99978999999999809431874274789586813448


No 182
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=333.17  Aligned_cols=214  Identities=24%  Similarity=0.275  Sum_probs=181.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+|+||++||||+++|||+++|++|+++|++|++++|+++.++           ...++++|++|+++++++++++   .
T Consensus         1 ~~L~gK~alVTG~s~GIG~aia~~la~~GA~V~~~d~~~~~~~-----------~~~~~~~D~~~~~~v~~~v~~~---~   66 (261)
T PRK12428          1 MRLDGKTIVVTGVASGIGAEVARLLRFLGARVIGLDRRPPGMT-----------LDGFHQADLGDPASIDAAVAAL---P   66 (261)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCC-----------CCCEEECCCCCHHHHHHHHHHH---C
T ss_conf             9899988999785779999999999986999999968855456-----------1317673789999999999983---7


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC--------------
Q ss_conf             898799876875888888676599999999999989999999999999986089869997883564--------------
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAY--------------  159 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~--------------  159 (257)
                      |++|+||||||+.. ..        +++.++++|+.+.+++++.+.|.|.+  .|+|||++|..+.              
T Consensus        67 g~id~lvn~Ag~~~-~~--------~~~~~~~vn~~g~~~~~~~~~~~~~~--~~~ivn~~s~~~~~~~~~~~~~~~~~~  135 (261)
T PRK12428         67 GRIDALFNVAGVPG-TG--------PPELVARVNFLGLRHLTEALLPRLAP--GGAIVNVSSLAGAGWPERLELHKALAA  135 (261)
T ss_pred             CCCCEEEECCCCCC-CC--------CHHHHHHHHHHHHHHHHHHHHHHHHC--CCEEEEEECHHHHCCCCCHHHHHHHHH
T ss_conf             98878998677787-54--------28899989889999999999998652--875999601233112110145655530


Q ss_pred             -------------CCCCCCHHHHHHHHHHHHHHHHHHHH-HHHHCCEEEEECCCCCCCHHHHHHCC----------CCCC
Q ss_conf             -------------78898368898999999999999998-54438699755328837977984414----------4432
Q gi|254780337|r  160 -------------KCRPLWGAYSASKAAIEALARTWSKE-TVNTALRVINIDPGPTRTSMRAKAMP----------AEDP  215 (257)
Q Consensus       160 -------------~~~~~~~~Y~asKaal~~lt~~la~E-~~~~gIrvn~I~PG~v~T~m~~~~~~----------~~~~  215 (257)
                                   .+.+...+|++||+|+..||+.++.| ++++|||||+|+||+|+|||..+...          ..|.
T Consensus       136 ~~~~~~~~~~~~~~~~~~~~~Y~asK~al~~~t~~~a~~~l~~~gIRvNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl  215 (261)
T PRK12428        136 TASFDEGLAWLAEHPVALGTGYQLSKEALILWTMRQAQPWFGARGIRVNCVAPGPVETPILGQFRSMLGQERVDSDAKRL  215 (261)
T ss_pred             CCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHCCHHHHHHCCCCC
T ss_conf             02124567888634776535899999999999999999997464977988740657775579888653398997430676


Q ss_pred             CCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCCCEEC
Q ss_conf             45888899999999961975-62668579876876315
Q gi|254780337|r  216 NTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNRFVN  252 (257)
Q Consensus       216 ~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG~~~n  252 (257)
                      +|+++|||||+++.||||++ +|+|||+|.||||....
T Consensus       216 gR~g~peeiA~~v~fLaSd~as~iTG~~i~VDGG~sA~  253 (261)
T PRK12428        216 GRPATADEQAAVLVFLCSDAARWINGVNLPVDGGLAAT  253 (261)
T ss_pred             CCCCCHHHHHHHHHHHHCCHHCCCCCCEEECCCCHHHH
T ss_conf             89809999999999994963257368428829168889


No 183
>PRK05599 hypothetical protein; Provisional
Probab=100.00  E-value=1.4e-45  Score=326.62  Aligned_cols=208  Identities=19%  Similarity=0.247  Sum_probs=190.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             999938998688999999998899899997898999999999986499-2899987899999999999999998189879
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~-~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      |+||||||+|||+++|++|+ +|++|++++|+.++++++.+++++.|. .+..+.+|++|+++++++++++.+.+|++|+
T Consensus         2 tvlITGASsGIG~a~A~~lA-~G~~vvl~~R~~e~l~~l~~~l~~~g~~~v~~~~~Dvtd~~~~~~~v~~~~~~~g~id~   80 (246)
T PRK05599          2 SILILGGTSDIAGEIATLLA-HGEDVVLAARRPEAAGGLAEDLRQLGATSVHVLSFDATDLDSHRELVKQTQELAGEISL   80 (246)
T ss_pred             EEEEECCCHHHHHHHHHHHH-CCCCEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             89998886899999999998-59949999999999999999998625971899728999999999999999986198439


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             987687588888867659999999999998999999999999998608-9869997883564788983688989999999
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      +|||||+... .++.+.++++|++++++|+.+++.+++.+.|.|++++ .|+|||+||.+|.+|.|..++|++||+|+.+
T Consensus        81 lv~naGi~~~-~~~~~~d~~~~~~~~~vN~~~~~~~~~~~~~~~~~~~~~G~Iv~iSSvag~~~~~~~~~Y~ASKaal~~  159 (246)
T PRK05599         81 AVVAFGILGD-QERAETDEAHAVEIATVDYTAQVSMLTVLADELRAQTTPSTIVAFSSIAGWRARRANYVYGSTKAGLDA  159 (246)
T ss_pred             EEECCCCCCC-CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             9987766787-320118999999999988699999999999999854699479999676757878888508699999999


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9999999854438699755328837977984414443245888899999999961
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~  232 (257)
                      |+++|+.|+.++||+||+|+||+|+|+|.....   +..-...||++|+.+.--.
T Consensus       160 ~~~~L~~el~~~gI~V~~v~PG~V~T~mt~~~~---~~p~~~spe~~A~~i~~~i  211 (246)
T PRK05599        160 FCQGLADSLHGSHVRLIIARPGFVIGSMTTGMK---PAPMSVYPRDVAAAVVSAI  211 (246)
T ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCC---CCCCCCCHHHHHHHHHHHH
T ss_conf             999999995377968999844988362007999---8987589999999999999


No 184
>KOG1201 consensus
Probab=100.00  E-value=2.8e-45  Score=323.27  Aligned_cols=214  Identities=23%  Similarity=0.320  Sum_probs=197.7

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      .+.+|++||||||++||||++|.+||+.|+++++.|.+.+..+++.+++++.| ++..+.||+++++++.+..+++++++
T Consensus        34 k~v~g~~vLITGgg~GlGr~ialefa~rg~~~vl~Din~~~~~etv~~~~~~g-~~~~y~cdis~~eei~~~a~~Vk~e~  112 (300)
T KOG1201          34 KSVSGEIVLITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNEETVKEIRKIG-EAKAYTCDISDREEIYRLAKKVKKEV  112 (300)
T ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHCC-CEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             44069889996898607899999999707848999556512399999998448-52589955898899999999999861


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |.+||||||||+. ...++.+.++|+.+++++||+.|+|+++|+|+|.|.+++.|+||+|+|.+|..+.++.++||+||+
T Consensus       113 G~V~ILVNNAGI~-~~~~ll~~~d~ei~k~~~vN~~~~f~t~kaFLP~M~~~~~GHIV~IaS~aG~~g~~gl~~YcaSK~  191 (300)
T KOG1201         113 GDVDILVNNAGIV-TGKKLLDCSDEEIQKTFDVNTIAHFWTTKAFLPKMLENNNGHIVTIASVAGLFGPAGLADYCASKF  191 (300)
T ss_pred             CCCEEEEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHHCCCCCCCCHHHHHHHH
T ss_conf             9954998366424-488756799899999998766899999998738887457963998355331357765323565189


Q ss_pred             HHHHHHHHHHHHHHH---HCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHH
Q ss_conf             999999999998544---38699755328837977984414443245888899999999
Q gi|254780337|r  174 AIEALARTWSKETVN---TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIIS  229 (257)
Q Consensus       174 al~~lt~~la~E~~~---~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~  229 (257)
                      |+.+|.++|..|+..   +||+...++|+.++|+|.....+....-.+.+|+++|+.+.
T Consensus       192 a~vGfhesL~~EL~~~~~~~IktTlv~P~~i~Tgmf~~~~~~~~l~P~L~p~~va~~Iv  250 (300)
T KOG1201         192 AAVGFHESLSMELRALGKDGIKTTLVCPYFINTGMFDGATPFPTLAPLLEPEYVAKRIV  250 (300)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             99999999999998538987269998432213554478988864368779799999999


No 185
>PRK07904 short chain dehydrogenase; Provisional
Probab=100.00  E-value=1.8e-44  Score=317.62  Aligned_cols=212  Identities=18%  Similarity=0.233  Sum_probs=186.2

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCC-CEEEEEECCH-HHHHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             488999993899868899999999889-9899997898-999999999986499-2899987899999999999999998
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSG-AYVIACGRSI-SQLEKLKNALQKINK-KIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G-~~Vi~~~r~~-~~l~~~~~~~~~~g~-~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      -++||+||||||+|||+++|++|+++| ++|++++|+. ..++++.+++++.+. ++..+.+|++|.++++++++++.+.
T Consensus         6 gn~KtvlITGassGIG~a~a~~~~~~g~~~v~l~~r~~~~~~~~~~~~~~~~~~~~v~~~~~D~~d~~~~~~~i~~~~~~   85 (253)
T PRK07904          6 GNPQTILLLGGTSEIGLAICERYLRNAPARVVLAALPDDPRRDAAVAQMKAAGASSVEVIDFDALDTDSHPKVIDAAFAG   85 (253)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             99998999356509999999999974989899997897326999999998549971899955667989999999999854


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                       |.+|++|||||+..+. +....+.+++.++++||+++++.+++.++|+|++++.|+|||+||.+|.++.|+.++|++||
T Consensus        86 -~~idv~i~~aG~~~~~-~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~~~G~Iv~isSvag~~~~~~~~~Y~ASK  163 (253)
T PRK07904         86 -GDVDVAIVAFGLLGDA-EELWQNQRKAVQIAEINYTAAVSVGVLLGEKMRAQGFGQIIAMSSAAGERVRRSNFVYGSTK  163 (253)
T ss_pred             -CCEEEEEECCCCCCCC-HHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHH
T ss_conf             -9935999624456782-55402299999999899499999999999999754998699966600036799972688999


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             999999999999854438699755328837977984414443245888899999999961
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~  232 (257)
                      +|+.+|+++|+.|++++|||||+|+||+|+|+|.+...+   .....+||++|+.+.--+
T Consensus       164 aal~~f~~~L~~el~~~gIrV~~V~PG~V~T~mt~~~~~---~p~~~~~e~vA~~i~~ai  220 (253)
T PRK07904        164 AGLDGFYLGLGEALREYGVRVLVIRPGQVRTRMSADVKE---APLTVDKEDVANLAVTAV  220 (253)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCC---CCCCCCHHHHHHHHHHHH
T ss_conf             999999999999847728889999727886765689998---997689999999999999


No 186
>PRK06101 short chain dehydrogenase; Provisional
Probab=100.00  E-value=2.4e-44  Score=316.96  Aligned_cols=202  Identities=28%  Similarity=0.346  Sum_probs=178.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999999999998189879
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      |++||||||+|||+++|++|+++|++|++++|+++.++++.++    +.++..+.+|++|.+++++.++++.   +.+|+
T Consensus         2 ktvlITGassGIG~a~A~~la~~G~~Vi~~~R~~~~l~~~~~~----~~~~~~~~~Dvtd~~~~~~~~~~~~---~~~d~   74 (241)
T PRK06101          2 TSVLITGATSGIGKQLALDYAKAGWKVIACGRNEAVLDELHDQ----SSNIFTLAFDVTDYEETKAALSQLP---FIPEL   74 (241)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH----CCCEEEEEEECCCHHHHHHHHHHHC---CCCCE
T ss_conf             9899922404999999999998799899998999999999973----2880489852267999999999718---77778


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             98768758888886765999999999999899999999999999860898699978835647889836889899999999
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEAL  178 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~l  178 (257)
                      +|||||.. ...+..+.+.++|++++++|+.|+++++|.++|+|++  +++||++||.+|..+.|+.++|++||+|+.+|
T Consensus        75 ~i~naG~~-~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~~p~m~~--~~~iv~isS~a~~~~~p~~~~Y~ASKaal~~~  151 (241)
T PRK06101         75 WIFNAGDC-EYMDDGIVDAQLMARVFNVNVVGVANCIEACQPHFQR--GHRVVIVGSIASELALPRAEAYGASKAAVSYF  151 (241)
T ss_pred             EEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCEEEECCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99988666-7687344899999999999889999999999999873--89505775401056889846889999999999


Q ss_pred             HHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             999999854438699755328837977984414443245888899999999961
Q gi|254780337|r  179 ARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       179 t~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~  232 (257)
                      +++|+.|++++|||||+|+||+|+|||..+.....|  .+.+||++|+.+.--.
T Consensus       152 ~~sLa~el~~~gI~V~~V~PG~v~T~m~~~~~~~~p--~~~~~e~~A~~i~~~i  203 (241)
T PRK06101        152 ARTLALDLKKKGIKVVTVFPGFVATPLTDKNTFAMP--MIITVEQASQAIRKQL  203 (241)
T ss_pred             HHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCC--CCCCHHHHHHHHHHHH
T ss_conf             999999852549589999718993888778998898--7579999999999999


No 187
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]
Probab=100.00  E-value=5.3e-43  Score=307.86  Aligned_cols=232  Identities=32%  Similarity=0.474  Sum_probs=201.4

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH--HHHHHHHHHHCC-CCEEEEECCCCC-HHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899--999999998649-928999878999-99999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQ--LEKLKNALQKIN-KKIDIFAFDLRD-SNALELTKTYI   89 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~--l~~~~~~~~~~g-~~~~~~~~Dv~d-~~~v~~~~~~~   89 (257)
                      +++++|++||||+++|||+++|+.|+++|++|+++.|+.+.  ++++.+.....+ ..+.++++|+++ +++++.+++.+
T Consensus         1 ~~~~~k~vlITGas~GiG~aia~~l~~~G~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~v~~~~~~~   80 (251)
T COG1028           1 MDLSGKVALVTGASSGIGRAIARALAREGARVVVAARRSEEEAAEALAAAIKEAGGGRAAAVAADVSDDEESVEALVAAA   80 (251)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHH
T ss_conf             99999889998988718999999999889979999679735169999999754578727999720899999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCC-CHHH
Q ss_conf             998189879987687588888867659999999999998999999999999998608986999788356478898-3688
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL-WGAY  168 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~-~~~Y  168 (257)
                      .+++|++|+||||||+.....++.+.+.++|++++++|+.|+++++|.+.|.|+++   +|||++|.++. +.+. +++|
T Consensus        81 ~~~~g~idvlvnnAg~~~~~~~~~~~~~~~~~~~~~~n~~g~~~~~~~~~~~~~~~---~Iv~isS~~~~-~~~~~~~~Y  156 (251)
T COG1028          81 EEEFGRIDILVNNAGIAGPDAPLEELTEEDWDRVIDVNLLGAFLLTRAALPLMKKQ---RIVNISSVAGL-GGPPGQAAY  156 (251)
T ss_pred             HHHCCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---EEEEECCCCCC-CCCCCCHHH
T ss_conf             99719987999998676457872337999999999998399999999863662335---89998852103-788773079


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC-----------CCCCCCCHHHHHHHHHHHHCHH--
Q ss_conf             989999999999999985443869975532883797798441444-----------3245888899999999961975--
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE-----------DPNTVPHPQKVAKIISFLCATQ--  235 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~-----------~~~~~~~pediA~~v~fL~s~~--  235 (257)
                      ++||+|+.+|+++++.|++++|||||+|+||+++|+|........           +.++++.|+|+++.+.||++..  
T Consensus       157 ~~sK~al~~~~~~la~el~~~gI~v~~v~PG~~~t~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~l~~~~~~  236 (251)
T COG1028         157 AASKAALIGLTKALALELAPRGIRVNAVAPGYIDTPMTAALESAELEALKRLAARIPLGRLGTPEEVAAAVAFLASDEAA  236 (251)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCHHH
T ss_conf             99999999999999998241687999996498687302232000235678887417522467999999999986381322


Q ss_pred             HCCCCCEEEECCCC
Q ss_conf             62668579876876
Q gi|254780337|r  236 KIETGKLFSVPQNR  249 (257)
Q Consensus       236 ~~~tG~~~~vdgG~  249 (257)
                      .+++|+.+.+|||.
T Consensus       237 ~~~~g~~~~~~gg~  250 (251)
T COG1028         237 SYITGQTLPVDGGL  250 (251)
T ss_pred             HHHCCCEEEECCCC
T ss_conf             02208768834887


No 188
>PRK08177 short chain dehydrogenase; Provisional
Probab=100.00  E-value=1.7e-43  Score=311.26  Aligned_cols=214  Identities=22%  Similarity=0.255  Sum_probs=178.7

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             89999938998688999999998899899997898999999999986499289998789999999999999999818987
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      .|++||||||+|||+++|++|+++|++|++++|+.++++.+.+.     ..+...++|++|+++++.+++.+.+.  ++|
T Consensus         1 KK~~lITGas~GIG~aia~~l~~~G~~V~~~~R~~~~~~~~~~~-----~~~~~~~~D~~~~~~i~~~~~~~~~~--~iD   73 (225)
T PRK08177          1 KRTALIIGASRGLGLGLVDRLLERGWQVTATVRGPQQDTALQAL-----PGVHIERLDMNDPASLDQLLQRLQGQ--RFD   73 (225)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-----CCCCEEEEECCCHHHHHHHHHHHHCC--CCC
T ss_conf             99899927342999999999998869999997988778998725-----48728998458889999999996067--788


Q ss_pred             EEEECCCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CCCCHHHHHHHH
Q ss_conf             99876875888-88867659999999999998999999999999998608986999788356478---898368898999
Q gi|254780337|r   98 ILIANAGILGS-ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC---RPLWGAYSASKA  173 (257)
Q Consensus        98 ilVNNAGi~~~-~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~---~~~~~~Y~asKa  173 (257)
                      +||||||+..+ ..++.+.+.++|++++++|+.++++++|+++|.|++ +.|+|++++|.+|...   .+++++|++||+
T Consensus        74 vlinNAGi~~~~~~~~~~~~~~~~~~~~~~N~~~~~~l~~~~~~~l~~-~~g~iv~isS~~g~~~~~~~~~~~~Y~aSKa  152 (225)
T PRK08177         74 LLFVNAGISGPAHQSAADATAAEIGQLFLTNAIAPIRLARRLLGQVRP-GQGVLAFMSSQLGSVELPDGGEMPLYKASKA  152 (225)
T ss_pred             EEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCEEEEECCCCCCCCHHHHHHHH
T ss_conf             899878436767678465999999999999878999999999888631-6787753330133201489886367799999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHHH-CCCCCEEEEC
Q ss_conf             999999999998544386997553288379779844144432458888999999999619756-2668579876
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQK-IETGKLFSVP  246 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~~-~~tG~~~~vd  246 (257)
                      ||.+||++||.|++++|||||+|+||+|+|+|..+..       ..+|||-|+-++-...... --+|..+..|
T Consensus       153 Al~~lt~sla~El~~~gI~Vn~i~PG~v~T~M~~~~a-------~~~~e~~a~~~~~~i~~~~~~~~g~f~~~~  219 (225)
T PRK08177        153 ALNSMTRSFVAELGEPDLTVLSMHPGWVKTDMGGDAA-------PLDVETSTKGLVEQIEAASGKGGHRFIDYQ  219 (225)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCC-------CCCHHHHHHHHHHHHHCCCCCCCCEEECCC
T ss_conf             9999999999984657829999971888169999999-------979999999999999727988897489989


No 189
>PRK06953 short chain dehydrogenase; Provisional
Probab=100.00  E-value=1.2e-41  Score=298.69  Aligned_cols=213  Identities=24%  Similarity=0.316  Sum_probs=176.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999999999998189879
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      |++||||||+|||+++|++|+++|++|++++|+++.++++.    ..+  ...+++|++|+++++.+.+++..  .++|+
T Consensus         2 K~~LVTGas~GIG~a~a~~la~~G~~V~~~~R~~~~l~~l~----~~~--~~~~~~Dv~d~~~v~~~~~~~~~--~~ldi   73 (222)
T PRK06953          2 KTVLIVGASRGIGLEFVRQYRADGWRVIATARDAAGLAALR----ALG--AEALALDVADPESIAGLGWKLDG--EALDA   73 (222)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCC--CCEEEEECCCHHHHHHHHHHHCC--CCCCE
T ss_conf             99999475729999999999988899999968888899988----421--51777405899999999986236--77678


Q ss_pred             EEECCCCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CCCCHHHHHHHHH
Q ss_conf             9876875888-88867659999999999998999999999999998608986999788356478---8983688989999
Q gi|254780337|r   99 LIANAGILGS-ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC---RPLWGAYSASKAA  174 (257)
Q Consensus        99 lVNNAGi~~~-~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~---~~~~~~Y~asKaa  174 (257)
                      +|||||+..+ ...+++.+.|+|+++++||+.|+|+++|+++|.|++++ |+||++||..+..+   .+...+|++||+|
T Consensus        74 li~nAGi~~~~~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~lP~l~~~~-g~ii~iSS~~gs~~~~~~~~~~~Y~aSKaA  152 (222)
T PRK06953         74 AVYVAGVYGPRTEGVEPITREDFDAVMHTNVLGPMQLLPILLPLVEAAG-GVLAVLSSRMGSIGEATGTTGWLYRASKAA  152 (222)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCEECCCEEEECCCCCCCHHHHHHHHHH
T ss_conf             9981665567876546689999999998711999999999999998579-985245677643137888632878999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCH-HHCCCCCEEEECCCC
Q ss_conf             999999999985443869975532883797798441444324588889999999996197-562668579876876
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCAT-QKIETGKLFSVPQNR  249 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~-~~~~tG~~~~vdgG~  249 (257)
                      |++|+++++.|+  ++|+||+|+||+|+|+|...       +....|||.|.-++-+... ....+|+.|+.||-+
T Consensus       153 l~~~~~~la~e~--~~i~v~ai~PG~v~T~m~~~-------~a~~~~e~~a~~~~~~~~~~~~~~~G~f~~~~g~~  219 (222)
T PRK06953        153 LNDALRIASLQA--RHAACIALHPGWVRTDMGGA-------QAALDPQQSVAGMRRVIAGDTRRDNGRFFQYDGVE  219 (222)
T ss_pred             HHHHHHHHHHHC--CCCEEEEEECCCCCCCCCCC-------CCCCCHHHHHHHHHHHHHCCCCCCCCEEECCCCCC
T ss_conf             999999998654--79889999467825799999-------98949999999999999639989995499999987


No 190
>PRK06196 oxidoreductase; Provisional
Probab=100.00  E-value=1.7e-41  Score=297.78  Aligned_cols=224  Identities=23%  Similarity=0.331  Sum_probs=191.0

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             65248899999389986889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      +.||+|||+|||||++|||+++|+.|++.|++|++++|++++++++.++++    ++.++.+|++|.++|+++.+++.++
T Consensus        21 ~~dL~GK~~vITGa~sGIG~~tA~~La~~Ga~Vil~~R~~~k~~~a~~~i~----~~~~~~lDLs~~~sVr~~a~~~~~~   96 (316)
T PRK06196         21 GLDLSGKTAIVTGGYSGLGLETTRALAQAGAHVVVPARRPDAAREALAGID----GVEVVALDLADLASVRAFAERFLDS   96 (316)
T ss_pred             CCCCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC----CCCEEECCCCCHHHHHHHHHHHHHH
T ss_conf             879999989991799679999999999789989999499999999998741----7857983688999999999999975


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC------------
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647------------
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK------------  160 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~------------  160 (257)
                      +++||+||||||++..  |. ..+.|.|+.+|.||..|+|++++.++|.|++...+||||+||.+.+.            
T Consensus        97 ~~~lDvLInNAGi~~~--~~-~~t~dG~E~~~~vN~lg~flLt~lLlp~L~~~~~~RIV~vSS~~h~~~~i~~~d~~~~~  173 (316)
T PRK06196         97 GRRIDILINNAGVMAC--PE-TRVGDGWEAQFATNHLGHFALVNLLWPALAAGAGARVVAVSSLGHRRSPIRWDDVHFER  173 (316)
T ss_pred             CCCCEEEEECCCCCCC--CC-EEECCCHHHHHHHHHCCHHHHHHHHHHHHHCCCCCEEEEEECHHHHCCCCCCCCCCCCC
T ss_conf             7983299957876788--75-35345557766554122878999988997536897799971377643887644546567


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC--------------CCCCCCCHHHHHH
Q ss_conf             88983688989999999999999985443869975532883797798441444--------------3245888899999
Q gi|254780337|r  161 CRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE--------------DPNTVPHPQKVAK  226 (257)
Q Consensus       161 ~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~--------------~~~~~~~pediA~  226 (257)
                      ++..+.+|+.||.|...|++.|++++.++||+||+++||.|+|+++.......              ...-+..|++-|.
T Consensus       174 ~y~~~~aY~~SKlanilft~~La~rl~~~gI~v~avhPG~v~T~l~r~~~~~~~~~~~~~~~~~~~~~~~~~ks~~qGA~  253 (316)
T PRK06196        174 GYDKWLAYGQSKTANALFAVHLDKLGADQGVRAFSVHPGGIATPLQRHLPREEMIALGWVDEHGNPIDPDTFKTPAQGAA  253 (316)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             89827999998999999999999983689948999737731576232467678777689998667877653278999999


Q ss_pred             HHHHHHCHHH--CCCCCEE
Q ss_conf             9999619756--2668579
Q gi|254780337|r  227 IISFLCATQK--IETGKLF  243 (257)
Q Consensus       227 ~v~fL~s~~~--~~tG~~~  243 (257)
                      ..+|++.+..  -.+|.-+
T Consensus       254 t~l~~A~~p~~~~~~G~Y~  272 (316)
T PRK06196        254 TQVWAATSPQLAGMGGLYC  272 (316)
T ss_pred             HHHHHEECCHHCCCCCCCC
T ss_conf             9898736932106996117


No 191
>KOG1207 consensus
Probab=100.00  E-value=4e-42  Score=301.97  Aligned_cols=233  Identities=26%  Similarity=0.268  Sum_probs=207.9

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |..+|.|+++++||+..|||+++++.|++.|++|+..+|+++.+..+..+..   .-+.+++.|+++++.+.+.+.    
T Consensus         1 M~t~laG~~vlvTgagaGIG~~~v~~La~aGA~ViAvaR~~a~L~sLV~e~p---~~I~Pi~~Dls~wea~~~~l~----   73 (245)
T KOG1207           1 MKTSLAGVIVLVTGAGAGIGKEIVLSLAKAGAQVIAVARNEANLLSLVKETP---SLIIPIVGDLSAWEALFKLLV----   73 (245)
T ss_pred             CCCCCCCEEEEEECCCCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC---CCEEEEEECCCHHHHHHHHHC----
T ss_conf             9434466199960566641499999998668879999569889999985297---642455751338999997614----


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             818987998768758888886765999999999999899999999999999860-8986999788356478898368898
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS-HCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~-~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ..+++|.||||||+. -..||.|++.++||+.|+||++++|+.+|.+.+.+..+ ..|.|||+||.++.++..+..+||+
T Consensus        74 ~v~pidgLVNNAgvA-~~~pf~eiT~q~fDr~F~VNvravi~v~Q~var~lv~R~~~GaIVNvSSqas~R~~~nHtvYca  152 (245)
T KOG1207          74 PVFPIDGLVNNAGVA-TNHPFGEITQQSFDRTFAVNVRAVILVAQLVARNLVDRQIKGAIVNVSSQASIRPLDNHTVYCA  152 (245)
T ss_pred             CCCCHHHHHCCCHHH-HCCHHHHHHHHHHCCEEEEEEEEEEEHHHHHHHHHHHCCCCCEEEEECCHHCCCCCCCCEEEEE
T ss_conf             657513430350144-3163788868763000454212221089998876664058860897402110366688347751


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC----------CCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             99999999999999854438699755328837977984414----------443245888899999999961975-6266
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP----------AEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~----------~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
                      +|+|+.++||+||.|+++++||||++.|-.+.|+|-...++          ..|.+|+.+-+|+.+++.||+|+. ++.|
T Consensus       153 tKaALDmlTk~lAlELGp~kIRVNsVNPTVVmT~MG~dnWSDP~K~k~mL~riPl~rFaEV~eVVnA~lfLLSd~ssmtt  232 (245)
T KOG1207         153 TKAALDMLTKCLALELGPQKIRVNSVNPTVVMTDMGRDNWSDPDKKKKMLDRIPLKRFAEVDEVVNAVLFLLSDNSSMTT  232 (245)
T ss_pred             CHHHHHHHHHHHHHHHCCCEEEEECCCCEEEEECCCCCCCCCCHHCCCHHHHCCHHHHHHHHHHHHHHEEEEECCCCCCC
T ss_conf             38789999999887518641574055871888114644468910105355437655555799997563256525767635


Q ss_pred             CCEEEECCCCEEC
Q ss_conf             8579876876315
Q gi|254780337|r  240 GKLFSVPQNRFVN  252 (257)
Q Consensus       240 G~~~~vdgG~~~n  252 (257)
                      |..++++||+..|
T Consensus       233 GstlpveGGfs~~  245 (245)
T KOG1207         233 GSTLPVEGGFSNN  245 (245)
T ss_pred             CCEEEECCCCCCC
T ss_conf             8523425774679


No 192
>pfam08659 KR KR domain. This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=100.00  E-value=3.7e-39  Score=282.15  Aligned_cols=174  Identities=26%  Similarity=0.292  Sum_probs=156.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCE-EEEEECCHH---HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             9999389986889999999988998-999978989---999999999864992899987899999999999999998189
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAY-VIACGRSIS---QLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~~~---~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      |+|||||++|||+++|++|+++|++ |++++|+.+   ++++..+++++.|.++.++++|++|+++++++++++.++||+
T Consensus         2 tvlITGas~GIG~aia~~la~~Ga~~vvl~~r~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   81 (181)
T pfam08659         2 TYLVTGGLGGLGLELARWLAERGARHLVLLSRSGAPDPEAEALLAELEARGAEVTVVACDVSDRDAVAALLAEIRADGPP   81 (181)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             89996878789999999999879978999868976629999999999965996999975689999999888657987398


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             87998768758888886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      +|+||||||+.. ..++.+++.|+|+++|++|++++++++|.+.+.    ..|+|||+||+++..+.|++++|++||+++
T Consensus        82 id~lvnnAG~~~-~~~~~~~~~~~~~~~~~vnv~g~~~l~~~~~~~----~~~~IV~iSS~ag~~g~~~~~~Y~AsKa~l  156 (181)
T pfam08659        82 LRGVIHAAGVLR-DALLANMTAEDFARVLAPKVTGAWNLHEATRDR----PLDFFVLFSSIAGVLGSPGQANYAAANAFL  156 (181)
T ss_pred             EEEEEEECCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH----CCCCCCEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             489995446678-856888289999999999989999999996510----344000230076647899948999999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCC
Q ss_conf             999999999854438699755328837
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTR  202 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~  202 (257)
                      .+|++    |++++|||||+|+||++.
T Consensus       157 ~~la~----~l~~~Girvn~iapG~ia  179 (181)
T pfam08659       157 DALAH----YRRAQGLPATSINWGPWA  179 (181)
T ss_pred             HHHHH----HHHHCCCCEEEEECCCCC
T ss_conf             99999----998659929998588766


No 193
>pfam00106 adh_short short chain dehydrogenase. This family contains a wide variety of dehydrogenases.
Probab=100.00  E-value=1e-38  Score=279.21  Aligned_cols=164  Identities=27%  Similarity=0.380  Sum_probs=152.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCE-EEEEECC--HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             99999389986889999999988998-9999789--89999999999864992899987899999999999999998189
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAY-VIACGRS--ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~--~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      ||+|||||++|||+++|++|+++|++ |++++|+  .+.++++.++++..+.++.++++|++|+++++++++++.+++|+
T Consensus         1 ~T~lITGas~GIG~aia~~la~~Ga~~vv~~~r~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~   80 (167)
T pfam00106         1 GTVLITGGTGGLGLALARWLAAEGARHLVLVSRRGDAPGAAELVAELEALGAEVTVAACDVADRDALAALLAALPAALGP   80 (167)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             98999897878999999999987994899965996768999999999955985999984699999999999999997599


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             87998768758888886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      +|+||||||+. ...++.+++.++|++++++|++|+|+++|.+.|    ++.|+|||+||.+++.|.|++++|++||+|+
T Consensus        81 iD~linnAG~~-~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~----~~~G~Ii~isS~~g~~~~~~~~~Y~asKaal  155 (167)
T pfam00106        81 LDGVVHNAGVL-DDGPLEELTPERFERVLAPKVTGAWNLHELTLD----LDLGAFVLFSSVAGVLGSPGQANYAAANAAL  155 (167)
T ss_pred             CCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHC----CCCCCEEEEECCCCCCCCCCCHHHHHHHHHH
T ss_conf             73999887126-898656526999999999986999999999755----3589579993511137899977899999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999854
Q gi|254780337|r  176 EALARTWSKETV  187 (257)
Q Consensus       176 ~~lt~~la~E~~  187 (257)
                      .+||++||.|+.
T Consensus       156 ~~lt~~La~E~~  167 (167)
T pfam00106       156 DALAEHRRAEGL  167 (167)
T ss_pred             HHHHHHHHHCCC
T ss_conf             999999997679


No 194
>PRK06720 hypothetical protein; Provisional
Probab=100.00  E-value=7.1e-39  Score=280.25  Aligned_cols=160  Identities=19%  Similarity=0.269  Sum_probs=152.3

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      .|+|+|+||++|||||++|||+++|+.|+++|++|++++|++++++++.+++...|+++.++.+|++++++++++++++.
T Consensus         9 ~M~~~L~gKvalITGa~~GIG~a~A~~la~~Ga~Vvi~d~~~~~~~~~~~~i~~~g~~a~~~~~Dvs~~~~v~~~i~~~~   88 (169)
T PRK06720          9 VMKMKLAGKVAIVTGGGIGIGRNTALLLAKQGAKVIVTDIDQESGQATVEEITNLGGEALFVSYDMEKQGDWQRVISITL   88 (169)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             28686299999998975489999999999869989995276365999999999749953789758899999999999999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                      ++||++|+||||||+. ...++.+.+.|+|++++++|  +.|+++|++.|.|++++.|+|||++|++|..+.|+++.|++
T Consensus        89 ~~~g~iDiLvNNAGI~-~~~~~~~~~~e~~~~v~~vN--~v~~~~k~~~~~m~kq~~G~IIN~aSi~Gl~G~~Gqs~Ys~  165 (169)
T PRK06720         89 NAFSRIDMLFQNAGLY-KIDSIFSRQQENDSNVLCIN--DVWIEIKQLTSSFMKQQEEVVLSDLPIFGIIGTKGQSFHTV  165 (169)
T ss_pred             HHCCCCCEEEECCCCC-CCCCCCCCCHHHHHHHHHHH--HHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHH
T ss_conf             9759899899894217-88760017989999999887--59999999999999759978999887151267888367562


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780337|r  171 SKAA  174 (257)
Q Consensus       171 sKaa  174 (257)
                       |++
T Consensus       166 -~~~  168 (169)
T PRK06720        166 -EAL  168 (169)
T ss_pred             -CCC
T ss_conf             -311


No 195
>PRK05854 short chain dehydrogenase; Provisional
Probab=100.00  E-value=2.9e-38  Score=276.12  Aligned_cols=228  Identities=23%  Similarity=0.282  Sum_probs=190.2

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             248899999389986889999999988998999978989999999999864--992899987899999999999999998
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      ||+|||+|||||++|||+++|++|++.|++|++++|++++.+++.+++++.  +.++.++.+|++|.++|+++.+++.++
T Consensus        11 dL~GK~~vITGa~sGIG~~~a~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~~v~~~~lDLs~l~sVr~~a~~~~~~   90 (314)
T PRK05854         11 DLSGKLAVVTGASSGLGFGLARRLAAAGADVILPVRNRAKGEAAVAAIRTAVPDAKLTIRALDLSSLASVAALGEQLLAE   90 (314)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             99999899906882999999999997849899997999999999999998689985699964631689999999987530


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-----------
Q ss_conf             189879987687588888867659999999999998999999999999998608986999788356478-----------
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC-----------  161 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~-----------  161 (257)
                      +.+||+||||||++..  |..+.+.|.|+.+|.||..|+|.+++.++|.|++ +.+|||+++|.+.+.+           
T Consensus        91 ~~~lDiLInNAGv~~~--~~~~~T~dG~E~~f~vN~LghflLt~~Llp~l~~-~~~RIV~vsS~~~~~~~i~~~dl~~~~  167 (314)
T PRK05854         91 GRPIHLLINNAGVMTP--PERQTTADGFELQFGTNHLGHFALTAHLLPLLRA-GRARVTSQSSIAARRGRINFDDLNFER  167 (314)
T ss_pred             CCCCCEEEECCCCCCC--CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC-CCCEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             6875278726766658--8654057763665553457788898877876325-787056643420115776545688645


Q ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHH--HHCCEEEEECCCCCCCHHHHHHC------CC------CC----CCCCCCHH
Q ss_conf             -89836889899999999999999854--43869975532883797798441------44------43----24588889
Q gi|254780337|r  162 -RPLWGAYSASKAAIEALARTWSKETV--NTALRVINIDPGPTRTSMRAKAM------PA------ED----PNTVPHPQ  222 (257)
Q Consensus       162 -~~~~~~Y~asKaal~~lt~~la~E~~--~~gIrvn~I~PG~v~T~m~~~~~------~~------~~----~~~~~~pe  222 (257)
                       +..+.+|+.||-|...|++.|++.+.  ..||++|+++||.|.|.++....      +.      ..    ..-+..|+
T Consensus       168 ~y~~~~aY~~SKlanilf~~eLarr~~~~~~~v~~~~vhPG~v~T~l~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~t~~  247 (314)
T PRK05854        168 SYAPMTAYGQSKLAVLMFALELDRRSRAAGWGITSNAAHPGLAKTNLLAAGPSHGRDKPTLMVRLIRTLWRFGFLWQTVE  247 (314)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHH
T ss_conf             68861888899999999999998652406989799997998435686445662123343799999999887601157888


Q ss_pred             HHHHHHHHHHCHHHCCCCCEEEE
Q ss_conf             99999999619756266857987
Q gi|254780337|r  223 KVAKIISFLCATQKIETGKLFSV  245 (257)
Q Consensus       223 diA~~v~fL~s~~~~~tG~~~~v  245 (257)
                      +-|...+|++.......|..+.-
T Consensus       248 ~GA~t~l~aA~~p~~~~G~y~~~  270 (314)
T PRK05854        248 EAILPALYAATSPQAEGGAFYGP  270 (314)
T ss_pred             HHHHHHHHHHCCCCCCCCEEECC
T ss_conf             98999899873844589728666


No 196
>PRK06197 short chain dehydrogenase; Provisional
Probab=100.00  E-value=5.1e-38  Score=274.51  Aligned_cols=234  Identities=20%  Similarity=0.259  Sum_probs=194.2

Q ss_pred             CCEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHH
Q ss_conf             73265248899999389986889999999988998999978989999999999864--9928999878999999999999
Q gi|254780337|r   10 SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKT   87 (257)
Q Consensus        10 ~~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~   87 (257)
                      +++. ||.|||+|||||++|||+++|++|++.|++|+++.|+.++.++..+++.+.  +.++.++.+|++|.++|+++.+
T Consensus         9 ~~ip-DL~GK~~lITGa~sGIG~~~A~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~i~~~~lDLssl~sV~~~a~   87 (306)
T PRK06197          9 ADIP-DQSGRVAVVTGANTGLGYETAAALAAKGAHVVLAVRNLDKGNAAAARITAAHPGADVTLQELDLASLASVRAAAD   87 (306)
T ss_pred             HHCC-CCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
T ss_conf             5688-989999999168959999999999978498999979899999999999976899857999766430778999999


Q ss_pred             HHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC------
Q ss_conf             99998189879987687588888867659999999999998999999999999998608986999788356478------
Q gi|254780337|r   88 YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC------  161 (257)
Q Consensus        88 ~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~------  161 (257)
                      ++.+++++||+||||||++..  + ...+.|.|+.+|.||..|+|.+++..+|.|++...+||||+||.+-...      
T Consensus        88 ~~~~~~~~lDvLinNAGi~~~--~-~~~T~dG~E~~f~vN~lghflLt~lLl~~l~~~~~~RIV~vsS~~h~~~~~~~~d  164 (306)
T PRK06197         88 ALRAAYPRIDLLINNAGVMYT--P-KQTTADGFELQFGTNHLGHFALTGLLLDRLLPVPGSRVVTVSSGGHRIRAAIHFD  164 (306)
T ss_pred             HHHHCCCCCCEEEECCCCCCC--C-CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECHHHHCCCCCCCC
T ss_conf             999618987689977844568--8-7226765333333313688888887778753157882699944576057788842


Q ss_pred             -------CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCE--EEEECCCCCCCHHHHHHCCC-----CCC--CCCCCHHHHH
Q ss_conf             -------8983688989999999999999985443869--97553288379779844144-----432--4588889999
Q gi|254780337|r  162 -------RPLWGAYSASKAAIEALARTWSKETVNTALR--VINIDPGPTRTSMRAKAMPA-----EDP--NTVPHPQKVA  225 (257)
Q Consensus       162 -------~~~~~~Y~asKaal~~lt~~la~E~~~~gIr--vn~I~PG~v~T~m~~~~~~~-----~~~--~~~~~pediA  225 (257)
                             +..+.+|+.||-|...|++.|++.+...++.  +++++||.++|++.......     ...  --...|++-|
T Consensus       165 dl~~~~~y~~~~aY~~SKLanilft~eL~rrl~~~~~~v~~~a~hPG~v~T~l~r~~~~~~~~~~~~~~~~~~~s~~~GA  244 (306)
T PRK06197        165 DLQWERRYNRVAAYGQSKLANLLFTYELQRRLAAAGATTIAVAAHPGVSNTELQRNLPRALRPVAAVLAPLLAQSPAMGA  244 (306)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHHH
T ss_conf             45765678747888888999999999999987605998699992798616833323768899999998765148777779


Q ss_pred             HHHHHHHCHHHCCCCCEEEECC
Q ss_conf             9999961975626685798768
Q gi|254780337|r  226 KIISFLCATQKIETGKLFSVPQ  247 (257)
Q Consensus       226 ~~v~fL~s~~~~~tG~~~~vdg  247 (257)
                      ...+|++.+....+|+.+.-+|
T Consensus       245 ~t~l~~A~~~~~~~G~Y~~~~g  266 (306)
T PRK06197        245 LPTLRAATDPAVRGGQYYGPDG  266 (306)
T ss_pred             HHHHHHHCCCCCCCCEEECCCC
T ss_conf             9999982086668985875687


No 197
>KOG4169 consensus
Probab=100.00  E-value=5.2e-38  Score=274.44  Aligned_cols=224  Identities=27%  Similarity=0.355  Sum_probs=190.6

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             5248899999389986889999999988998999978989999999999864--99289998789999999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      |+++||.|++||+.+|||++++++|+.+|..+...+-++|..+..++ +++.  ..++.|++|||++..++++.++++.+
T Consensus         1 m~~tGKna~vtggagGIGl~~sk~Ll~kgik~~~i~~~~En~~a~ak-L~ai~p~~~v~F~~~DVt~~~~~~~~f~ki~~   79 (261)
T KOG4169           1 MDLTGKNALVTGGAGGIGLATSKALLEKGIKVLVIDDSEENPEAIAK-LQAINPSVSVIFIKCDVTNRGDLEAAFDKILA   79 (261)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCHHEEEHHHHHCHHHHHH-HHCCCCCCEEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             94137458996378636699999999767154061040147899998-86039984399998012007889999999998


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCEEEEECCHHHCCCCCCCHHH
Q ss_conf             8189879987687588888867659999999999998999999999999998608---9869997883564788983688
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH---CGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~---~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      .||.+||||||||++.         +.+|++++++||.|.++.++.++|+|.+++   +|-|||+||..|..|.|-.++|
T Consensus        80 ~fg~iDIlINgAGi~~---------dkd~e~Ti~vNLtgvin~T~~alpyMdk~~gG~GGiIvNmsSv~GL~P~p~~pVY  150 (261)
T KOG4169          80 TFGTIDILINGAGILD---------DKDWERTINVNLTGVINGTQLALPYMDKKQGGKGGIIVNMSSVAGLDPMPVFPVY  150 (261)
T ss_pred             HHCCEEEEECCCCCCC---------CHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCHHH
T ss_conf             7094579971664446---------1207786502221200336663044554349998189970110266766420232


Q ss_pred             HHHHHHHHHHHHHHHHH--HHHHCCEEEEECCCCCCCHHHHHHCCC-----CC------CCCC--CCHHHHHHHHHHHHC
Q ss_conf             98999999999999998--544386997553288379779844144-----43------2458--888999999999619
Q gi|254780337|r  169 SASKAAIEALARTWSKE--TVNTALRVINIDPGPTRTSMRAKAMPA-----ED------PNTV--PHPQKVAKIISFLCA  233 (257)
Q Consensus       169 ~asKaal~~lt~~la~E--~~~~gIrvn~I~PG~v~T~m~~~~~~~-----~~------~~~~--~~pediA~~v~fL~s  233 (257)
                      ++||||+.+|||++|.+  |.+.|||+|++|||+++|+|.......     ..      ..+.  -.|.++|..+.-.. 
T Consensus       151 ~AsKaGVvgFTRSla~~ayy~~sGV~~~avCPG~t~t~l~~~~~~~~~~~e~~~~~~~~l~~~~~q~~~~~a~~~v~ai-  229 (261)
T KOG4169         151 AASKAGVVGFTRSLADLAYYQRSGVRFNAVCPGFTRTDLAENIDASGGYLEYSDSIKEALERAPKQSPACCAINIVNAI-  229 (261)
T ss_pred             HHCCCCEEEEEHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHH-
T ss_conf             3200115642054224566765587999977873148999988851884401689999999755688799999999997-


Q ss_pred             HHHCCCCCEEEECCCC
Q ss_conf             7562668579876876
Q gi|254780337|r  234 TQKIETGKLFSVPQNR  249 (257)
Q Consensus       234 ~~~~~tG~~~~vdgG~  249 (257)
                       |.-.+|++..||+|+
T Consensus       230 -E~~~NGaiw~v~~g~  244 (261)
T KOG4169         230 -EYPKNGAIWKVDSGS  244 (261)
T ss_pred             -HHCCCCCEEEEECCC
T ss_conf             -642588589972683


No 198
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=2.5e-37  Score=269.92  Aligned_cols=207  Identities=23%  Similarity=0.291  Sum_probs=181.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+++|-|+||||+++|||+++|++|.+.|.+|++|+|++++|++++++.    +..+...||+.|.++..++++++.++|
T Consensus         1 mk~tgnTiLITGG~sGIGl~lak~f~elgN~VIi~gR~e~~L~e~~~~~----p~~~t~v~Dv~d~~~~~~lvewLkk~~   76 (245)
T COG3967           1 MKTTGNTILITGGASGIGLALAKRFLELGNTVIICGRNEERLAEAKAEN----PEIHTEVCDVADRDSRRELVEWLKKEY   76 (245)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHCC----CCHHEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             9644767999379643659999999983897999657499999998609----413156513203566999999998629


Q ss_pred             CCCCEEEECCCCCCCCCCH-HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             8987998768758888886-765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   94 GKLDILIANAGILGSISPI-WQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~-~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      ..+|+||||||+......+ .+...++.+..+++|+.+|+++++.++|++++|+.+.|||+||+.|..|....+.||+||
T Consensus        77 P~lNvliNNAGIqr~~dlt~~e~~~~~~~~eI~~Nl~API~Lt~~~lphl~~q~~a~IInVSSGLafvPm~~~PvYcaTK  156 (245)
T COG3967          77 PNLNVLINNAGIQRNEDLTGAEDLLDDAEQEIATNLLAPIRLTALLLPHLLRQPEATIINVSSGLAFVPMASTPVYCATK  156 (245)
T ss_pred             CCHHEEEECCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHH
T ss_conf             86113430300032011158731256788888875102799999999999719773699832553457654555202438


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999999999985443869975532883797798441444324588889999999
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKII  228 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v  228 (257)
                      +|++.+|.+|+..++..+|+|..+.|..|+|+    ......+++++-..++....
T Consensus       157 AaiHsyt~aLR~Qlk~t~veVIE~~PP~V~t~----~~nt~~~~km~ls~~~~~t~  208 (245)
T COG3967         157 AAIHSYTLALREQLKDTSVEVIELAPPLVDTT----EGNTQARGKMPLSAFISETE  208 (245)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEECCCCEECC----CCCCCCCCCCCCCHHHHHHH
T ss_conf             89999899999986436568999528703237----66667655578651357679


No 199
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=100.00  E-value=1.1e-36  Score=265.51  Aligned_cols=175  Identities=26%  Similarity=0.309  Sum_probs=158.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECC---HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             9999938998688999999998899-89999789---8999999999986499289998789999999999999999818
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGA-YVIACGRS---ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~---~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      .|+||||+++|||+++|+.|+++|+ +|++++|+   ++..++..++++..+.++.++++|++|+++++++++++.++||
T Consensus         1 ~tvlVTGas~GIG~~~a~~la~~Ga~~vvl~~R~~~~~~~~~~~~~~~~~~g~~v~~~~~Dv~~~~~~~~~v~~~~~~~g   80 (180)
T smart00822        1 GTYLITGGLGGLGLELARWLAERGARHLVLLSRSGPDAPGAAELLAELEALGAEVTVVACDVADRAALAAALAAIPARLG   80 (180)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             99999787879999999999987998899986898781889999999995699699998026886776667776799739


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      +||+||||||+.. ..++.+.++|+|+++|++|++|+++++|.+.|.    +.++||++||++|..+.|++++|+++|++
T Consensus        81 ~id~lvn~AG~~~-~~~~~~~~~~~~~~~~~vnv~g~~~l~~~~~~~----~~~~iV~~SSiag~~g~~g~~~Y~Aak~~  155 (180)
T smart00822       81 PLRGVIHAAGVLD-DGLLANLTPERFAAVLAPKVDGAWNLHELTRDL----PLDFFVLFSSVAGVLGNPGQANYAAANAF  155 (180)
T ss_pred             CEEEEEEECCCCC-CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCCC----CCCEEEEECCHHHCCCCCCCHHHHHHHHH
T ss_conf             8379994246669-977255999999999999999999999983367----88569997658765789986899999999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCC
Q ss_conf             9999999999854438699755328837
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTR  202 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~  202 (257)
                      +.+|++.+    +++|+|||+|+||++.
T Consensus       156 l~~la~~~----~~~g~~v~~i~pg~w~  179 (180)
T smart00822      156 LDALAAHR----RARGLPATSINWGAWA  179 (180)
T ss_pred             HHHHHHHH----HHCCCCEEEEECCCCC
T ss_conf             99999999----8569929998478868


No 200
>TIGR02685 pter_reduc_Leis pteridine reductase; InterPro: IPR014058   Pteridine reductase is an enzyme used by trypanosomatids (including Trypanosoma cruzi and Leishmania major) to obtain reduced pteridines by salvage rather than biosynthetic pathways. Enzymes in T. cruzi described as pteridine reductase 1 (PTR1) and pteridine reductase 2 (PTR2) have different activity profiles. PTR1 is more active with fully oxidized biopterin and folate than with reduced forms, while PTR2 reduces dihydrobiopterin and dihydrofolate but not oxidized pteridines. T. cruzi PTR1 and PTR2 are more similar to each other in sequence than either is to the pteridine reductase of Leishmania major, and all are included in this family..
Probab=100.00  E-value=4.7e-37  Score=268.04  Aligned_cols=230  Identities=21%  Similarity=0.298  Sum_probs=190.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEEC-CHHHHHHHHHHHHHC-CCCEEEEECCCCCHH-----------------
Q ss_conf             9999389986889999999988998999978-989999999999864-992899987899999-----------------
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGR-SISQLEKLKNALQKI-NKKIDIFAFDLRDSN-----------------   80 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r-~~~~l~~~~~~~~~~-g~~~~~~~~Dv~d~~-----------------   80 (257)
                      +||||||.+.||++||.+|.++||+|++++| +++.+..|.+++++. ...+..++.||+...                 
T Consensus         3 aA~vTGaAkRiG~sIAv~LH~~GyrVv~HYh~Sa~aA~~LaaeLNa~R~nsAv~~qaDLsns~tasfsetdGsvPv~L~~   82 (283)
T TIGR02685         3 AAVVTGAAKRIGRSIAVKLHQEGYRVVVHYHRSAAAASTLAAELNAERANSAVVCQADLSNSATASFSETDGSVPVTLLS   82 (283)
T ss_pred             EEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHCCCCCCCCCCEEHHH
T ss_conf             24650025552189999985089889994024567899999997340789769996131310000001247742012674


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCH--------------HHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9999999999981898799876875888888676599--------------99999999998999999999999998608
Q gi|254780337|r   81 ALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKE--------------KSFADVISVNVMANWNIMRSFDPWLKKSH  146 (257)
Q Consensus        81 ~v~~~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~--------------e~~~~~~~vNl~g~~~l~~~~~~~m~~~~  146 (257)
                      .|+++++.+...||+.|+|||||.-+. +.|+..-+.              -.--+.|-.|-.+||+|+|.|..+-+..+
T Consensus        83 ~Ce~iid~cfrafGRCDVLVNNASafY-PTPLl~gD~~~GGss~~~~k~~e~~vAeLfGsNAiAP~fLi~aFAqR~~gt~  161 (283)
T TIGR02685        83 SCEEIIDACFRAFGRCDVLVNNASAFY-PTPLLRGDDEEGGSSVADKKSVEVQVAELFGSNAIAPYFLIKAFAQRQKGTR  161 (283)
T ss_pred             HHHHHHHHHHHCCCCCCEEECCCCCCC-CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             378898644320586310231640005-7888878676677333456508888786515235778999998874105787


Q ss_pred             ------CCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCC--CCCHHHHHHCCCCCCCCC
Q ss_conf             ------986999788356478898368898999999999999998544386997553288--379779844144432458
Q gi|254780337|r  147 ------CGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGP--TRTSMRAKAMPAEDPNTV  218 (257)
Q Consensus       147 ------~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~--v~T~m~~~~~~~~~~~~~  218 (257)
                            .=+|||+-..=-..|-+++..|+++|+||.||||+-|.|+++++||||.|+||.  ....|- +...++...++
T Consensus       162 ~~~rs~nlSiVNl~DAMtdqPl~gf~~YtMaK~AL~GLTrsAALELAp~~IRVNgVaPGlSlLP~aMp-~e~qe~yRRKV  240 (283)
T TIGR02685       162 AEQRSTNLSIVNLCDAMTDQPLLGFTLYTMAKHALEGLTRSAALELAPLQIRVNGVAPGLSLLPDAMP-EEVQEDYRRKV  240 (283)
T ss_pred             CCCCCCCCCEEEHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCC-CCCCCCCCCCC
T ss_conf             56555544212120341046613566877678986666799998614255156324687500787788-64221244668


Q ss_pred             ------CCHHHHHHHHHHHHCHH-HCCCCCEEEECCCCEE
Q ss_conf             ------88899999999961975-6266857987687631
Q gi|254780337|r  219 ------PHPQKVAKIISFLCATQ-KIETGKLFSVPQNRFV  251 (257)
Q Consensus       219 ------~~pediA~~v~fL~s~~-~~~tG~~~~vdgG~~~  251 (257)
                            ...|+||++|.||+|.. .||||.+|.||||.-|
T Consensus       241 PLgqreaSAe~iaDvviFLvS~~A~YITGt~iKVDGGlsL  280 (283)
T TIGR02685       241 PLGQREASAEQIADVVIFLVSKKAKYITGTIIKVDGGLSL  280 (283)
T ss_pred             CCCCCCCCHHHHHHEEEEEECCCCCEEECCEEEECCCEEE
T ss_conf             7777623356461088665248987142117887265410


No 201
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative; InterPro: IPR011285   This entry represents a small, very well conserved family of proteins closely related to the FabG family, IPR011284 from INTERPRO, and possibly equal in function. In all completed genomes with a member of this family, a FabG in IPR011284 from INTERPRO is also found..
Probab=100.00  E-value=1.8e-36  Score=264.11  Aligned_cols=228  Identities=25%  Similarity=0.314  Sum_probs=212.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEEC-CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             999389986889999999988998999978-9899999999998649928999878999999999999999981898799
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGR-SISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r-~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      +||||+|+|||+++|.+|+..|..|.++.+ +...+++...++...|.....++.|+.|..++...++.-.++.|..-.+
T Consensus         1 vlvtG~s~GiG~aia~~la~~G~~~~~h~~~~~~~a~~~~~~~~a~G~~~~~~~fdv~~r~~~r~~le~~~~~~GayyG~   80 (239)
T TIGR01831         1 VLVTGASRGIGRAIALKLAADGFEIAVHYHSDRADAEESVAAIRAQGGNARLLKFDVADRVAVREVLEADIAEHGAYYGV   80 (239)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             95225652267999998862763388875133014789999987458723665300353899999999889854864653


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHH-HHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             8768758888886765999999999999899999999999-999860898699978835647889836889899999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD-PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEAL  178 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~-~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~l  178 (257)
                      |.|||+.++ ..|.-++++|||.++++||.+.|+.++-+. |....+++||||.++|.+|..+..++..|+++|+|+.+-
T Consensus        81 v~~aG~~rd-~afPal~~~~Wd~v~~t~ld~fynv~~P~~mPm~~~r~GGri~t~~svsG~~GnrGqvnysa~kaG~iGa  159 (239)
T TIGR01831        81 VLNAGIARD-AAFPALSEEDWDAVIHTNLDGFYNVIHPLVMPMIRARQGGRIITLASVSGVMGNRGQVNYSAAKAGLIGA  159 (239)
T ss_pred             EECCCCCHH-CCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCHHHHHCCHHHH
T ss_conf             000221100-0144334123346545043114556534565445304787079873112113577530012110221234


Q ss_pred             HHHHHHHHHHHCCEEEEECCCCCCCHHHHH-------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCCC
Q ss_conf             999999854438699755328837977984-------414443245888899999999961975-62668579876876
Q gi|254780337|r  179 ARTWSKETVNTALRVINIDPGPTRTSMRAK-------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR  249 (257)
Q Consensus       179 t~~la~E~~~~gIrvn~I~PG~v~T~m~~~-------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG~  249 (257)
                      ||.|+.|++.+.|+||||+||.++|+|.++       .+...|.+|+++|+|+|.++.||+|+. +|+|-|++.|+||.
T Consensus       160 tkal~~ela~r~itvnC~aPGli~t~m~~~~~~~l~~~l~~~Pm~r~G~~~e~a~~~~~lmsd~a~y~trqvi~~nGGm  238 (239)
T TIGR01831       160 TKALAVELAKRKITVNCIAPGLIDTEMVAEVEKDLKEALKTVPMKRMGQPEEVAALAAFLMSDDAAYVTRQVISVNGGM  238 (239)
T ss_pred             HHHHHHHHHHCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCHHHCCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCC
T ss_conf             5787765540304777405653135889888999999985144333477778999999986124210011335514766


No 202
>PRK07453 protochlorophyllide oxidoreductase; Validated
Probab=100.00  E-value=8.2e-35  Score=253.07  Aligned_cols=228  Identities=21%  Similarity=0.193  Sum_probs=180.2

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      ..+|||||||++|||+++|+.|++.|++|+++.|+.++.+++.+++.....++.++.+|++|.++|+++.+++.+.+.+|
T Consensus         5 ~~~TvvITGansGIG~eta~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~~~~lDLssl~SVr~~a~~~~~~~~~l   84 (322)
T PRK07453          5 AKGTVLITGASSGVGLYAAKALAKRGWHVIMACRSLKKAEAAAQELGIPPDSYTIIHIDLGDLDSVRRFVDDFRALGKPL   84 (322)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99839996888689999999999789989999799999999999961889877999898899999999999999865984


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCEEEEECCHHHCCC-------------
Q ss_conf             79987687588888867659999999999998999999999999998608--986999788356478-------------
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH--CGRAIILSSGAAYKC-------------  161 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~--~G~IInisS~~g~~~-------------  161 (257)
                      |+||||||++.+...-.+.+.|.|+.+|.||..|+|++++..+|.|++..  .+|||++||.+....             
T Consensus        85 DiLInNAGv~~p~~~~~~~T~dG~E~~f~vNhLghFlLt~lLlp~L~~s~~~~~RIV~vsS~~h~~~~~~~~~~~p~~~d  164 (322)
T PRK07453         85 DALVCNAAVYKPLLKEPLRSPQGYELSMATNHLGHFLLCNLLLEDLKKSPAPDPRLVILGTVTANPKELGGKIPIPAPAD  164 (322)
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHCCCCCCCCCCCCCCCC
T ss_conf             08986565446556787345887634543105889999998899997278999818998122432302377556677777


Q ss_pred             ----------------------CCCCHHHHHHHHHHHHHHHHHHHHH-HHHCCEEEEECCCCC-CCHHHHHHCC------
Q ss_conf             ----------------------8983688989999999999999985-443869975532883-7977984414------
Q gi|254780337|r  162 ----------------------RPLWGAYSASKAAIEALARTWSKET-VNTALRVINIDPGPT-RTSMRAKAMP------  211 (257)
Q Consensus       162 ----------------------~~~~~~Y~asKaal~~lt~~la~E~-~~~gIrvn~I~PG~v-~T~m~~~~~~------  211 (257)
                                            +..+.+|+-||-|...|++-|++.+ ...||++++++||.| +|++.....+      
T Consensus       165 ~~dl~~~~~~~~~~~~~~~~~~y~~~~aY~~SKlanilf~~eL~rrl~~~~~i~~~a~hPG~V~~T~l~r~~~~~~~~~~  244 (322)
T PRK07453        165 LGDLSGFEAGFKAPISMADGKKFKPGKAYKDSKLCNMLTMRELHRRYHESTGITFSSLYPGCVADTPLFRNTPKLFQKLF  244 (322)
T ss_pred             CCHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCEECCCCCCCCHHHHHHHH
T ss_conf             20234555314673101257757808789999999999999999861247893799717824116843112658899999


Q ss_pred             -C--C-CCCCCCCHHHHHHHHHHHHCHHHC-CCCCEEE
Q ss_conf             -4--4-324588889999999996197562-6685798
Q gi|254780337|r  212 -A--E-DPNTVPHPQKVAKIISFLCATQKI-ETGKLFS  244 (257)
Q Consensus       212 -~--~-~~~~~~~pediA~~v~fL~s~~~~-~tG~~~~  244 (257)
                       -  . .......++.-+..+.+++++..+ .+|..+.
T Consensus       245 ~~~~~~~~~~~~~~~~a~~~~~~~a~~p~~~~~G~y~~  282 (322)
T PRK07453        245 PWFQKNITGGYVSQELAGERVAQVVADPEFAQSGVHWS  282 (322)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHCCHHHCCCCCCCC
T ss_conf             99998754033246667789999871863277851146


No 203
>KOG1199 consensus
Probab=100.00  E-value=5.5e-37  Score=267.60  Aligned_cols=230  Identities=25%  Similarity=0.328  Sum_probs=203.1

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             24889999938998688999999998899899997898999999999986499289998789999999999999999818
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +.+|-+++|||+.+|+|++.|++|++.|++|++.+...++.++.+.++   |.++.|.++|++++++|...+..+..+||
T Consensus         6 s~kglvalvtggasglg~ataerlakqgasv~lldlp~skg~~vakel---g~~~vf~padvtsekdv~aala~ak~kfg   82 (260)
T KOG1199           6 STKGLVALVTGGASGLGKATAERLAKQGASVALLDLPQSKGADVAKEL---GGKVVFTPADVTSEKDVRAALAKAKAKFG   82 (260)
T ss_pred             HHCCEEEEEECCCCCCCHHHHHHHHHCCCEEEEEECCCCCCHHHHHHH---CCCEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             316725786167552027789999846860798727765446799984---89369821666747889999998776605


Q ss_pred             CCCEEEECCCCCCCCCC-----HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------CCCEEEEECCHHHCCCCC
Q ss_conf             98799876875888888-----6765999999999999899999999999999860------898699978835647889
Q gi|254780337|r   95 KLDILIANAGILGSISP-----IWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS------HCGRAIILSSGAAYKCRP  163 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~-----~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~------~~G~IInisS~~g~~~~~  163 (257)
                      ++|.+|||||+...++.     -...+.|+|++++|||++|+|+.+|+....|-++      +.|.|||..|.++..+..
T Consensus        83 rld~~vncagia~a~ktyn~~k~~~h~ledfqrvidvn~~gtfnvirl~aglmg~nepdq~gqrgviintasvaafdgq~  162 (260)
T KOG1199          83 RLDALVNCAGIAYAFKTYNVQKKKHHDLEDFQRVIDVNVLGTFNVIRLGAGLMGENEPDQNGQRGVIINTASVAAFDGQT  162 (260)
T ss_pred             CEEEEEECCCEEEEEEEEEECCCCCCCHHHHHHEEEEEEEEEEEEEEEHHHHHCCCCCCCCCCCEEEEEECEEEEECCCC
T ss_conf             50026532320254434431346545289865504320012554423202442478888788413798200001235743


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC----------CCCCCCCCHHHHHHHHHHHHC
Q ss_conf             8368898999999999999998544386997553288379779844144----------432458888999999999619
Q gi|254780337|r  164 LWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA----------EDPNTVPHPQKVAKIISFLCA  233 (257)
Q Consensus       164 ~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~----------~~~~~~~~pediA~~v~fL~s  233 (257)
                      ++++|++||+|+.+||--+|.++++.|||+|+|+||..+|||.... |+          -.+.|+++|.|.|.++--+. 
T Consensus       163 gqaaysaskgaivgmtlpiardla~~gir~~tiapglf~tpllssl-pekv~~fla~~ipfpsrlg~p~eyahlvqaii-  240 (260)
T KOG1199         163 GQAAYSASKGAIVGMTLPIARDLAGDGIRFNTIAPGLFDTPLLSSL-PEKVKSFLAQLIPFPSRLGHPHEYAHLVQAII-  240 (260)
T ss_pred             CHHHHHCCCCCEEEEECHHHHHCCCCCEEEEEECCCCCCCHHHHHH-HHHHHHHHHHHCCCCHHCCCHHHHHHHHHHHH-
T ss_conf             2555411467367544112232266755998645522487355544-59999999872899022298688899999997-


Q ss_pred             HHHCCCCCEEEECCCC
Q ss_conf             7562668579876876
Q gi|254780337|r  234 TQKIETGKLFSVPQNR  249 (257)
Q Consensus       234 ~~~~~tG~~~~vdgG~  249 (257)
                      +..|.+|++|.+||..
T Consensus       241 enp~lngevir~dgal  256 (260)
T KOG1199         241 ENPYLNGEVIRFDGAL  256 (260)
T ss_pred             HCCCCCCEEEEECCEE
T ss_conf             2766577079853402


No 204
>KOG1014 consensus
Probab=100.00  E-value=5.5e-35  Score=254.21  Aligned_cols=210  Identities=25%  Similarity=0.278  Sum_probs=183.3

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             8999993899868899999999889989999789899999999998-649928999878999999999999999981898
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~-~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      |+.|+||||+-|||+++|++||++|.+|++.+|++++|+++++|++ +++.++..+.+|.++++.+-+-+.+..+. ..+
T Consensus        49 g~WAVVTGaTDGIGKayA~eLAkrG~nvvLIsRt~~KL~~v~kEI~~~~~vev~~i~~Dft~~~~~ye~i~~~l~~-~~V  127 (312)
T KOG1014          49 GSWAVVTGATDGIGKAYARELAKRGFNVVLISRTQEKLEAVAKEIEEKYKVEVRIIAIDFTKGDEVYEKLLEKLAG-LDV  127 (312)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHCC-CCE
T ss_conf             9779997788852299999999759879999688899999999998875807999998648981568999988627-864


Q ss_pred             CEEEECCCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             79987687588-88886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r   97 DILIANAGILG-SISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        97 DilVNNAGi~~-~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      -|||||+|... .+..|.+++.+++++.++||++++..++|.++|.|.+++.|-|||++|.+|..|.|.++.|++||+.+
T Consensus       128 gILVNNvG~~~~~P~~f~~~~~~~~~~ii~vN~~~~~~~t~~ilp~M~~r~~G~IvnigS~ag~~p~p~~s~ysasK~~v  207 (312)
T KOG1014         128 GILVNNVGMSYDYPESFLKYPEGELQNIINVNILSVTLLTQLILPGMVERKKGIIVNIGSFAGLIPTPLLSVYSASKAFV  207 (312)
T ss_pred             EEEEECCCCCCCCCHHHHHCCHHHHHHEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHH
T ss_conf             89996553167883778738556453146774326899998850555337886699822633556671578877878888


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             99999999985443869975532883797798441444324588889999999996
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL  231 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL  231 (257)
                      ..|+++|+.|+..+||-|-++.|..|.|+|.+-..   +.--.+.||..|+-.+.-
T Consensus       208 ~~~S~~L~~Ey~~~gI~Vq~v~p~~VaTkm~~~~~---~sl~~ps~~tfaksal~t  260 (312)
T KOG1014         208 DFFSRCLQKEYESKGIFVQSVIPYLVATKMAKYRK---PSLFVPSPETFAKSALNT  260 (312)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEEHHHEECCCCCCCC---CCCCCCCHHHHHHHHHHH
T ss_conf             88779999998766769999503551234214678---877674889987998861


No 205
>KOG1208 consensus
Probab=100.00  E-value=2.7e-34  Score=249.62  Aligned_cols=227  Identities=26%  Similarity=0.322  Sum_probs=189.2

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986--4992899987899999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK--INKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~--~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      ...++.+|+++|||+++|||+++|+.||.+|++|++..|+.++.+++++++..  ...++.++++|+++.++|.++.++.
T Consensus        29 ~~~~~~~~~~vVTGansGIG~eta~~La~~Ga~Vv~~~R~~~~~~~~~~~i~~~~~~~~i~~~~lDLssl~SV~~fa~~~  108 (314)
T KOG1208          29 HGIDLSGKVALVTGATSGIGFETARELALRGAHVVLACRNEERGEEAKEQIQKGKANQKIRVIQLDLSSLKSVRKFAEEF  108 (314)
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             35667787799958988437999999995799899984777889999999971087763699987999999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC--------
Q ss_conf             998189879987687588888867659999999999998999999999999998608986999788356478--------
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC--------  161 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~--------  161 (257)
                      .+.++++|+||||||++...  . ..+.|.++..|.+|..|+|++++.++|.|+.+..+||||+||......        
T Consensus       109 ~~~~~~ldvLInNAGV~~~~--~-~~t~DG~E~~~~tN~lg~flLt~lLlp~lk~s~~~RIV~vsS~~~~~~~~~~~l~~  185 (314)
T KOG1208         109 KKKEGPLDVLINNAGVMAPP--F-SLTKDGLELTFATNYLGHFLLTELLLPLLKRSAPSRIVNVSSILGGGKIDLKDLSG  185 (314)
T ss_pred             HHCCCCCCEEEECCCCCCCC--C-CCCCCCHHHEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHCCC
T ss_conf             85178765898655223676--5-45654411300023299999999999998537897679980653467665332362


Q ss_pred             -----CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC-------CCCCCCCCCHHHHHHHHH
Q ss_conf             -----89836889899999999999999854438699755328837977984414-------443245888899999999
Q gi|254780337|r  162 -----RPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP-------AEDPNTVPHPQKVAKIIS  229 (257)
Q Consensus       162 -----~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~-------~~~~~~~~~pediA~~v~  229 (257)
                           +....+|+.||-+..-+++-|++.+.+ ||.++++.||.++|+...+...       .-...-+..|++-|+++.
T Consensus       186 ~~~~~~~~~~~Y~~SKla~~l~~~eL~k~l~~-~V~~~~~hPG~v~t~~l~r~~~~~~~l~~~l~~~~~ks~~~ga~t~~  264 (314)
T KOG1208         186 EKAKLYSSDAAYALSKLANVLLANELAKRLKK-GVTTYSVHPGVVKTTGLSRVNLLLRLLAKKLSWPLTKSPEQGAATTC  264 (314)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHC-CCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHEE
T ss_conf             33135550678888699899999999988554-96699867861215440032078999999976674258887853142


Q ss_pred             HHHCHH--HCCCCCE
Q ss_conf             961975--6266857
Q gi|254780337|r  230 FLCATQ--KIETGKL  242 (257)
Q Consensus       230 fL~s~~--~~~tG~~  242 (257)
                      |++-..  ...+|..
T Consensus       265 ~~a~~p~~~~~sg~y  279 (314)
T KOG1208         265 YAALSPELEGVSGKY  279 (314)
T ss_pred             CHHCCCCCCCCCCCC
T ss_conf             050276334766540


No 206
>KOG1610 consensus
Probab=100.00  E-value=1.1e-33  Score=245.43  Aligned_cols=190  Identities=25%  Similarity=0.411  Sum_probs=177.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      -++.+|.++|||+-+|.|+.+|+.|.+.|.+|++.-.+++.++.+..+..  .++...+..||+++++|+++.+.+.+..
T Consensus        25 ~~~~~k~VlITGCDSGfG~~LA~~l~~~Gf~V~Agclt~~gae~L~~~~~--s~rl~t~~LDVT~~esi~~a~~~V~~~l  102 (322)
T KOG1610          25 DSLSDKAVLITGCDSGFGRLLAKKLDKKGFRVFAGCLTEEGAESLRGETK--SPRLRTLQLDVTKPESVKEAAQWVKKHL  102 (322)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHC--CCCCEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             36677379983477177799999998658878887206705898763233--8740247532588789999999999864


Q ss_pred             C--CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             8--98799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   94 G--KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        94 g--~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
                      +  ++-.||||||+....+|.+=.+.+||.++++||+.|++.+++.++|.+++++ |||||++|++|+.+.|..++||+|
T Consensus       103 ~~~gLwglVNNAGi~~~~g~~ewl~~~d~~~~l~vNllG~irvT~~~lpLlr~ar-GRvV~v~S~~Gr~~~p~~g~Y~~S  181 (322)
T KOG1610         103 GEDGLWGLVNNAGISGFLGPDEWLTVEDYRKVLNVNLLGTIRVTKAFLPLLRRAR-GRVVNVSSVLGRVALPALGPYCVS  181 (322)
T ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEECCCCCCCCCCCCCCCHHH
T ss_conf             6655135773366455668511152999999886530548999998887777605-708995044567667656652032


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHH
Q ss_conf             99999999999998544386997553288379779
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMR  206 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~  206 (257)
                      |+||.+|+.+|++|+.+.||+|..|.||..+|++.
T Consensus       182 K~aVeaf~D~lR~El~~fGV~VsiiePG~f~T~l~  216 (322)
T KOG1610         182 KFAVEAFSDSLRRELRPFGVKVSIIEPGFFKTNLA  216 (322)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC
T ss_conf             99999999999988775286799964675566667


No 207
>KOG1210 consensus
Probab=100.00  E-value=1.1e-31  Score=232.05  Aligned_cols=211  Identities=26%  Similarity=0.280  Sum_probs=191.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-C-CCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             99999389986889999999988998999978989999999999864-9-928999878999999999999999981898
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-N-KKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g-~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      +.++|||+|+|||+++|.++..+|++|.+++|+..++++++.+++-. + ..+.++.+|++|.++++..+++..+.+|.+
T Consensus        34 ~hi~itggS~glgl~la~e~~~~ga~Vti~ar~~~kl~~a~~~l~l~~~~~~v~~~S~d~~~Y~~v~~~~~~l~~~~~~~  113 (331)
T KOG1210          34 RHILITGGSSGLGLALALECKREGADVTITARSGKKLLEAKAELELLTQVEDVSYKSVDVIDYDSVSKVIEELRDLEGPI  113 (331)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             26998168415668999999970374299946487899987431144435303675355302899998876323304895


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608-98699978835647889836889899999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
                      |.|+||||.. -.+.|++.+.+++.+.++||.+|.++++++.++.|++.. .|+|+.++|.+|..+.+++++|++||+|+
T Consensus       114 d~l~~cAG~~-v~g~f~~~s~~~v~~~m~vNylgt~~v~~~~~~~mk~~~~~g~I~~vsS~~a~~~i~GysaYs~sK~al  192 (331)
T KOG1210         114 DNLFCCAGVA-VPGLFEDLSPEVVEKLMDVNYLGTVNVAKAAARAMKKREHLGRIILVSSQLAMLGIYGYSAYSPSKFAL  192 (331)
T ss_pred             CEEEEECCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHCCCCCCCCCCCHHHHH
T ss_conf             0278706765-542001399999999887553446799999999863225684799843325416756641356078999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCC--------CCCCCHHHHHHHHHH
Q ss_conf             9999999998544386997553288379779844144432--------458888999999999
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDP--------NTVPHPQKVAKIISF  230 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~--------~~~~~pediA~~v~f  230 (257)
                      .+|..++++|+.++||+|....|+.++||..++....+|.        ....+|||+|.+++-
T Consensus       193 rgLa~~l~qE~i~~~v~Vt~~~P~~~~tpGfE~En~tkP~~t~ii~g~ss~~~~e~~a~~~~~  255 (331)
T KOG1210         193 RGLAEALRQELIKYGVHVTLYYPPDTLTPGFERENKTKPEETKIIEGGSSVIKCEEMAKAIVK  255 (331)
T ss_pred             HHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCHHEEEECCCCCCCCHHHHHHHHHH
T ss_conf             999999999876526699997289878976431023674210310078887688999999986


No 208
>COG0623 FabI Enoyl-[acyl-carrier-protein]
Probab=100.00  E-value=3.8e-31  Score=228.53  Aligned_cols=239  Identities=21%  Similarity=0.278  Sum_probs=206.8

Q ss_pred             ECCCCCEEEEECC--CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH-HHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             5248899999389--986889999999988998999978989999999999-8649928999878999999999999999
Q gi|254780337|r   14 VNLDNRLALVTGS--SRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        14 ~~l~~K~alVTGa--s~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~-~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      ..|+||.+||+|-  .+.|++.||+.++++|+.+++++.++ ++++-..++ +..+ ....++|||+++++++++|+++.
T Consensus         2 g~L~GK~~lI~Gvan~rSIAwGIAk~l~~~GAeL~fTy~~e-~l~krv~~la~~~~-s~~v~~cDV~~d~~i~~~f~~i~   79 (259)
T COG0623           2 GLLEGKRILIMGVANNRSIAWGIAKALAEQGAELAFTYQGE-RLEKRVEELAEELG-SDLVLPCDVTNDESIDALFATIK   79 (259)
T ss_pred             CCCCCCEEEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHHHHHCC-CCEEEECCCCCHHHHHHHHHHHH
T ss_conf             76678658999732662179999999997598799984358-88999999876416-77699667787689999999998


Q ss_pred             HHHCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHH
Q ss_conf             981898799876875888---88867659999999999998999999999999998608986999788356478898368
Q gi|254780337|r   91 KRWGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA  167 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~  167 (257)
                      +++|++|+|||+-|..+.   .+++.|++.|.|...++|-..+..-+.|++.|.|.+  +|+||..+=..+.+..|++..
T Consensus        80 ~~~g~lD~lVHsIaFa~k~el~G~~~dtsre~f~~a~~IS~YS~~~lak~a~plM~~--ggSiltLtYlgs~r~vPnYNv  157 (259)
T COG0623          80 KKWGKLDGLVHSIAFAPKEELKGDYLDTSREGFLIAMDISAYSFTALAKAARPLMNN--GGSILTLTYLGSERVVPNYNV  157 (259)
T ss_pred             HHHCCCCEEEEEECCCCHHHHCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCEEEEEECCCEEECCCCCH
T ss_conf             760766479987314886781786000678888777625471299999999985169--971799972163441478742


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCH----------HHHHHCCCCCCCCCCCHHHHHHHHHHHHCHH-H
Q ss_conf             8989999999999999985443869975532883797----------7984414443245888899999999961975-6
Q gi|254780337|r  168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRTS----------MRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-K  236 (257)
Q Consensus       168 Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~----------m~~~~~~~~~~~~~~~pediA~~v~fL~s~~-~  236 (257)
                      -+.+|++|++-+|-||.|++++|||||+|+-|+++|=          |.+..-...|.+|-.+.|||.+...||+|+= +
T Consensus       158 MGvAKAaLEasvRyLA~dlG~~gIRVNaISAGPIrTLAasgI~~f~~~l~~~e~~aPl~r~vt~eeVG~tA~fLlSdLs~  237 (259)
T COG0623         158 MGVAKAALEASVRYLAADLGKEGIRVNAISAGPIRTLAASGIGDFRKMLKENEANAPLRRNVTIEEVGNTAAFLLSDLSS  237 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             67889988888999999847048377014145267887601300999998887508756878877733557887600112


Q ss_pred             CCCCCEEEECCCCEECCCCC
Q ss_conf             26685798768763154379
Q gi|254780337|r  237 IETGKLFSVPQNRFVNYLTP  256 (257)
Q Consensus       237 ~~tG~~~~vdgG~~~n~~~p  256 (257)
                      -+||+++.||+|..+...-|
T Consensus       238 giTGei~yVD~G~~i~~m~~  257 (259)
T COG0623         238 GITGEIIYVDSGYHIMGMGP  257 (259)
T ss_pred             CCCCEEEEECCCCEEECCCC
T ss_conf             66540699748840540688


No 209
>KOG1209 consensus
Probab=100.00  E-value=3.7e-33  Score=242.02  Aligned_cols=189  Identities=30%  Similarity=0.370  Sum_probs=167.9

Q ss_pred             CCCEEEEECCC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH-HHC
Q ss_conf             88999993899-8688999999998899899997898999999999986499289998789999999999999999-818
Q gi|254780337|r   17 DNRLALVTGSS-RGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK-RWG   94 (257)
Q Consensus        17 ~~K~alVTGas-~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~-~~g   94 (257)
                      +-|.++|||+| +|||.++|++|+++|+.|+.++|+.+.-..+..+   .|  +..+++|++++++|.....++.+ .+|
T Consensus         6 ~~k~VlItgcs~GGIG~ala~ef~~~G~~V~AtaR~~e~M~~L~~~---~g--l~~~kLDV~~~~~V~~v~~evr~~~~G   80 (289)
T KOG1209           6 QPKKVLITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQ---FG--LKPYKLDVSKPEEVVTVSGEVRANPDG   80 (289)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHH---HC--CEEEEECCCCHHHHHHHHHHHHHCCCC
T ss_conf             7975999605776534999999986781999970224607667886---09--705870568727789988888618998


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      ++|+|+||||.. ...|..|.+.++.++.|++|+.|.++++|++. +|.-+..|.|||++|..++.|+|+.++|++||+|
T Consensus        81 kld~L~NNAG~~-C~~Pa~d~~i~ave~~f~vNvfG~irM~~a~~-h~likaKGtIVnvgSl~~~vpfpf~~iYsAsKAA  158 (289)
T KOG1209          81 KLDLLYNNAGQS-CTFPALDATIAAVEQCFKVNVFGHIRMCRALS-HFLIKAKGTIVNVGSLAGVVPFPFGSIYSASKAA  158 (289)
T ss_pred             CEEEEECCCCCC-CCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHH-HHHHHCCCEEEEECCEEEEECCCHHHHHHHHHHH
T ss_conf             268887179987-65523468789998640211234343889999-9998726649974453588024315666677999


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCC
Q ss_conf             99999999998544386997553288379779844144
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA  212 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~  212 (257)
                      +++++++|+.|+++.||+|..+.||-|.|++..+.++.
T Consensus       159 ihay~~tLrlEl~PFgv~Vin~itGGv~T~Ia~k~l~~  196 (289)
T KOG1209         159 IHAYARTLRLELKPFGVRVINAITGGVATDIADKRLPE  196 (289)
T ss_pred             HHHHHHHCEEEEECCCCEEEEECCCCEECCCCCCCCCC
T ss_conf             99863200776542651789731463030112577751


No 210
>KOG1611 consensus
Probab=100.00  E-value=2.3e-31  Score=230.05  Aligned_cols=203  Identities=24%  Similarity=0.297  Sum_probs=169.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH--HC
Q ss_conf             9999938998688999999998-89989999-78989999999999864992899987899999999999999998--18
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELAR-SGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR--WG   94 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~-~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~--~g   94 (257)
                      |.++||||.||||+.++++|.+ .|..+++. .|+.+++.+..+......++++.+++||++.++++++++++.+-  ..
T Consensus         4 ksv~ItGaNRGIGlgLVk~llk~~~i~~iiat~r~~e~a~~~l~~k~~~d~rvHii~Ldvt~deS~~~~~~~V~~iVg~~   83 (249)
T KOG1611           4 KSVFITGANRGIGLGLVKELLKDKGIEVIIATARDPEKAATELALKSKSDSRVHIIQLDVTCDESIDNFVQEVEKIVGSD   83 (249)
T ss_pred             CCEEEECCCCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             40899626762107788998357884799984479677657878763258852799873365777999999987514668


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-----------EEEEECCHHHCCCC-
Q ss_conf             987998768758888886765999999999999899999999999999860898-----------69997883564788-
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG-----------RAIILSSGAAYKCR-  162 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G-----------~IInisS~~g~~~~-  162 (257)
                      .+|+||||||+..+..+..+.+.+.|-+.+++|..||+.++|+|+|.+++...-           .|||++|..+-.+. 
T Consensus        84 GlnlLinNaGi~~~y~~~~~~~r~~~~~~~~tN~v~~il~~Q~~lPLLkkaas~~~gd~~s~~raaIinisS~~~s~~~~  163 (249)
T KOG1611          84 GLNLLINNAGIALSYNTVLKPSRAVLLEQYETNAVGPILLTQAFLPLLKKAASKVSGDGLSVSRAAIINISSSAGSIGGF  163 (249)
T ss_pred             CCEEEEECCCEEEECCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCCCCCCCC
T ss_conf             70588854600132345668858999987501340399999999999998752246776564313589852111345787


Q ss_pred             --CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHH
Q ss_conf             --983688989999999999999985443869975532883797798441444324588889999999
Q gi|254780337|r  163 --PLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKII  228 (257)
Q Consensus       163 --~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v  228 (257)
                        ..+.+|.+||+|++.|+|+++.|+++.+|.|.+|+||||+|+|-.       .+...+|||=+..+
T Consensus       164 ~~~~~~AYrmSKaAlN~f~ksls~dL~~~~ilv~sihPGwV~TDMgg-------~~a~ltveeSts~l  224 (249)
T KOG1611         164 RPGGLSAYRMSKAALNMFAKSLSVDLKDDHILVVSIHPGWVQTDMGG-------KKAALTVEESTSKL  224 (249)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEEECCCCC-------CCCCCCHHHHHHHH
T ss_conf             77634566755999999998864650478689999468707857788-------87620551539999


No 211
>KOG1204 consensus
Probab=99.97  E-value=7.9e-32  Score=233.09  Aligned_cols=225  Identities=25%  Similarity=0.286  Sum_probs=187.9

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      .+|++|+||+|+|||..++..+.+++-.....+++...++ +......++........|++.+.-.+++++...+++|+.
T Consensus         5 ~r~villTGaSrgiG~~~v~~i~aed~e~~r~g~~r~~a~-~~~L~v~~gd~~v~~~g~~~e~~~l~al~e~~r~k~gkr   83 (253)
T KOG1204           5 MRKVILLTGASRGIGTGSVATILAEDDEALRYGVARLLAE-LEGLKVAYGDDFVHVVGDITEEQLLGALREAPRKKGGKR   83 (253)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHCCHHHHHHHHHCCCCC-CCCEEEEECCCCCEECHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             6459999257777558789999962427888866303566-666588716873122027888899999985045347715


Q ss_pred             CEEEECCCCCCCCCCHH--HCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             79987687588888867--659999999999998999999999999998608-986999788356478898368898999
Q gi|254780337|r   97 DILIANAGILGSISPIW--QIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~--~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                      |++|||||...+.+...  +.+.++|++.|++|+++++-+.+.++|.+++++ .|.+||+||.++.+|++.|++||++|+
T Consensus        84 ~iiI~NAG~lgdvsk~~~~~~D~~qw~ky~~~NlfS~VsL~~~~l~~lk~~p~~~~vVnvSS~aav~p~~~wa~yc~~Ka  163 (253)
T KOG1204          84 DIIIHNAGSLGDVSKGAVDLGDSDQWKKYWDLNLFSMVSLVQWALPKLKKSPVNGNVVNVSSLAAVRPFSSWAAYCSSKA  163 (253)
T ss_pred             EEEEECCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHCCCCHHHHHHHHHH
T ss_conf             67773588754355413785557999999886534587668999887107886670799504455264408888632699


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC--------------CCCCCCCHHHHHHHHHHHHCHHHCCC
Q ss_conf             9999999999985443869975532883797798441444--------------32458888999999999619756266
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE--------------DPNTVPHPQKVAKIISFLCATQKIET  239 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~--------------~~~~~~~pediA~~v~fL~s~~~~~t  239 (257)
                      |.++|.+.||.|.- .+|+|.+++||.+||+|+.......              ..+++..|+..|..+.+|+-..-+.+
T Consensus       164 Ar~m~f~~lA~EEp-~~v~vl~~aPGvvDT~mq~~ir~~~~~~p~~l~~f~el~~~~~ll~~~~~a~~l~~L~e~~~f~s  242 (253)
T KOG1204         164 ARNMYFMVLASEEP-FDVRVLNYAPGVVDTQMQVCIRETSRMTPADLKMFKELKESGQLLDPQVTAKVLAKLLEKGDFVS  242 (253)
T ss_pred             HHHHHHHHHHHCCC-CCEEEEECCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             99999999850475-66369971587505466777763247898999999998862774780657999999998457666


Q ss_pred             CCEE
Q ss_conf             8579
Q gi|254780337|r  240 GKLF  243 (257)
Q Consensus       240 G~~~  243 (257)
                      ||-+
T Consensus       243 G~~v  246 (253)
T KOG1204         243 GQHV  246 (253)
T ss_pred             CCCC
T ss_conf             6403


No 212
>pfam08643 DUF1776 Fungal family of unknown function (DUF1776). This is a fungal family of unknown function. One of the proteins in this family has been localized to the mitochondria.
Probab=99.97  E-value=1.2e-28  Score=211.87  Aligned_cols=184  Identities=16%  Similarity=0.162  Sum_probs=163.4

Q ss_pred             CCEEEEEC-CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             89999938-99868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   18 NRLALVTG-SSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        18 ~K~alVTG-as~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      ..++||+| .+.+|||++|..|.++|+.|+++.|+++..+.+.++.   ...+.++..|++|++++++.++++.+.++..
T Consensus         3 ~~vVli~Gs~~~pi~R~iA~dL~rrGf~Vfa~~r~~~~~~~l~~~~---~~~i~~L~lDvt~~~si~~a~~~~~~~l~~~   79 (296)
T pfam08643         3 REVVLVAGSPTEPLTRSIALDLERRGFIVFVTVTSAEEYKTVESEQ---REDIRPLWLDDTAPSSAEASLSEFLQLLETP   79 (296)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC---CCCCCEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             1299996699974589999999968978999957778899998624---4788527740788267999999999980676


Q ss_pred             --------------CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCEEEEECCHHHCC
Q ss_conf             --------------7998768758888886765999999999999899999999999999860--898699978835647
Q gi|254780337|r   97 --------------DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS--HCGRAIILSSGAAYK  160 (257)
Q Consensus        97 --------------DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~--~~G~IInisS~~g~~  160 (257)
                                    ..+|+|++...+.+|+++++.++|++.|++|+.|++.++|.++|+|+.+  +.+.|++++|+++..
T Consensus        80 ~~~~~g~~~~~l~L~gvi~~p~l~~p~Gpie~i~~~~~~~~~~~N~~g~i~~tq~~LPllr~~~~~~~iIv~~~Si~g~~  159 (296)
T pfam08643        80 HAPFPGAKPHVLRLRGVILVPSLSYPSGPIETIPPSSWASELNTRLLNPILTLQGLLPLLTSRSQKSKLIVFNPSISSSL  159 (296)
T ss_pred             CCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCC
T ss_conf             65557887552223247852676678785100899999999999949999999998888873468972899967631145


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCH
Q ss_conf             88983688989999999999999985443869975532883797
Q gi|254780337|r  161 CRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTS  204 (257)
Q Consensus       161 ~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~  204 (257)
                      +.|+.++|++||+|+.+|+.+|+.|+.++||+|..|.||.++..
T Consensus       160 ~~P~~~~y~ask~ale~~s~~LR~El~~~gI~V~~i~pG~i~~~  203 (296)
T pfam08643       160 NPPYHAPEALVSSALSTFFTILTRELRPHNIDVTQIKLGNLDLS  203 (296)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             68753599999999999999999874315965999944530457


No 213
>TIGR01500 sepiapter_red sepiapterin reductase; InterPro: IPR006393   These sequences represent sepiapterin reductase, a member of the short chain dehydrogenase/reductase family. The enzyme catalyzes the last step in the biosynthesis of tetrahydrobiopterin. A similar enzyme in Bacillus cereus was isolated for its ability to convert benzil to (S)-benzoin, a property sepiapterin reductase also shares. ; GO: 0004757 sepiapterin reductase activity, 0006729 tetrahydrobiopterin biosynthetic process.
Probab=99.96  E-value=2.4e-27  Score=203.14  Aligned_cols=222  Identities=27%  Similarity=0.384  Sum_probs=191.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHH------CCCEEEEEECCHHHHHHHHHHHH--H-C-CCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             999938998688999999998------89989999789899999999998--6-4-992899987899999999999999
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELAR------SGAYVIACGRSISQLEKLKNALQ--K-I-NKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~------~G~~Vi~~~r~~~~l~~~~~~~~--~-~-g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      ++||||||+|||+++|.+|++      +|..|++.+|+.+.|+++++++.  + . +..+..+.+|+....+++..++.+
T Consensus         2 ~~lvTGASrGfGr~~Aq~lak~nP~k~~gs~lvL~aRn~~~L~~~kaei~tia~~~~l~v~~~sldl~~~~~~e~~~k~l   81 (267)
T TIGR01500         2 LLLVTGASRGFGRELAQELAKRNPLKAEGSVLVLLARNDEALKELKAEIETIAEVSDLSVDLVSLDLEAAKDVEDLLKAL   81 (267)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCHHHHHHHH
T ss_conf             58873562015689999987306564665167875067478888898877752267734674142112200179999999


Q ss_pred             HHHHCCCC----EEEECCCCCCCCCCHHH--CCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCC---EEEEECCHH
Q ss_conf             99818987----99876875888888676--599-9999999999899999999999999860--898---699978835
Q gi|254780337|r   90 AKRWGKLD----ILIANAGILGSISPIWQ--IKE-KSFADVISVNVMANWNIMRSFDPWLKKS--HCG---RAIILSSGA  157 (257)
Q Consensus        90 ~~~~g~iD----ilVNNAGi~~~~~~~~~--~~~-e~~~~~~~vNl~g~~~l~~~~~~~m~~~--~~G---~IInisS~~  157 (257)
                      .+..++=+    ++|||||..++.+...+  +++ +..++-++.|+++.+-++-.+++.+++.  +.|   .|||+||..
T Consensus        82 ~e~~~~~~~~r~~~inNaGtlgd~sk~~d~~~sD~~~~q~y~~~N~tS~~~lts~~~k~fk~~Gs~yg~~~tvVN~SsLc  161 (267)
T TIGR01500        82 RESIKKEEYERLLLINNAGTLGDVSKREDKDLSDSKNVQKYYDLNVTSAVVLTSELLKKFKELGSQYGLEKTVVNLSSLC  161 (267)
T ss_pred             HHCCCCCCCCEEEEEECCCCCCCCCCHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCHHH
T ss_conf             84379455404888816864000131000235522677535543478899998999987331377567650044021688


Q ss_pred             HCCCCCCCHHHHHHHHHHHHHHHHHHHHHH--HHCCEEEEECCCCCCCHHHHHHCCCC--C------------CCCCCCH
Q ss_conf             647889836889899999999999999854--43869975532883797798441444--3------------2458888
Q gi|254780337|r  158 AYKCRPLWGAYSASKAAIEALARTWSKETV--NTALRVINIDPGPTRTSMRAKAMPAE--D------------PNTVPHP  221 (257)
Q Consensus       158 g~~~~~~~~~Y~asKaal~~lt~~la~E~~--~~gIrvn~I~PG~v~T~m~~~~~~~~--~------------~~~~~~p  221 (257)
                      |..|++.|+.||++||+=.+|-|.||.|+.  ..+++|-.=+||++||+|+.....+.  +            .+++..|
T Consensus       162 Ai~pf~~walYC~~kAaRdM~FqvLalEe~lna~~~~VLNYapGvlDTdM~~~vree~~eDPd~~~~~~elk~~gkl~~p  241 (267)
T TIGR01500       162 AIKPFKSWALYCASKAARDMFFQVLALEEKLNADDVKVLNYAPGVLDTDMQSQVREEASEDPDVKKFYRELKEDGKLVDP  241 (267)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCCEECH
T ss_conf             86230311466657899999999998775307886056305588756345799987314683468999865114831075


Q ss_pred             HHHHHHHHHHHCHHHCCCCC
Q ss_conf             99999999961975626685
Q gi|254780337|r  222 QKVAKIISFLCATQKIETGK  241 (257)
Q Consensus       222 ediA~~v~fL~s~~~~~tG~  241 (257)
                      ..=|..+.-|+...+|-||.
T Consensus       242 ~~sa~~~~~lle~~kFksG~  261 (267)
T TIGR01500       242 KRSAEKLLKLLEKFKFKSGS  261 (267)
T ss_pred             HHHHHHHHHHHHHHCCCCCC
T ss_conf             56899999988741477688


No 214
>TIGR01289 LPOR light-dependent protochlorophyllide reductase; InterPro: IPR005979    This family contains the light-dependent, NADPH-dependent form of protochlorophyllide reductase (1.3.1.33 from EC) which catalyses the reaction  chlorophyllide A + NADP+ = protochlorophyllide + NADPH.  The enzyme belongs to the short chain alcohol dehydrogenase family. ; GO: 0016630 protochlorophyllide reductase activity, 0015995 chlorophyll biosynthetic process, 0019685 photosynthesis dark reaction, 0009507 chloroplast.
Probab=99.86  E-value=1.1e-20  Score=158.57  Aligned_cols=193  Identities=23%  Similarity=0.225  Sum_probs=165.7

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             8999993899868899999999889-989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSG-AYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G-~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      ..+++|||||+|+|...|+.|++.| |+||..-|+-+++++.++++.=....-..+..|++.-++|.+++++..+.--++
T Consensus         3 K~tviITGASSG~GL~~AKAL~~~G~WHV~MACR~l~Ka~~aA~~~G~p~~sYti~~lDL~~LdSVR~FV~~Fr~~gr~L   82 (321)
T TIGR01289         3 KPTVIITGASSGLGLYAAKALAETGKWHVVMACRDLLKAEKAAKSLGMPKDSYTILHLDLGSLDSVRQFVEQFRESGRPL   82 (321)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             87078863731357899999986398089981446168899998438886661354301344678999999998607842


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCEEEEECCHHH-------CCC------
Q ss_conf             79987687588888867659999999999998999999999999998608--986999788356-------478------
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH--CGRAIILSSGAA-------YKC------  161 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~--~G~IInisS~~g-------~~~------  161 (257)
                      |.||.||+++.+...--..+.|+|+-.+.+|-+|.|+|++..+..+++..  .-|.|.++|+.|       ..|      
T Consensus        83 daLVCNAAVy~P~~~EP~~~adgfELSV~TNHlGHFLL~~LLL~DLk~~~~~~~RlII~G~~T~N~~~L~G~~P~Pa~a~  162 (321)
T TIGR01289        83 DALVCNAAVYLPLLKEPLYSADGFELSVATNHLGHFLLCNLLLDDLKKSPDKDKRLIILGSVTANSKELAGKVPIPAKAD  162 (321)
T ss_pred             EEEEEHHHHHCCCCCCCCCCCCCEEECHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCHHHCCCCCCCCCCCC
T ss_conf             01342134526633477648775032013445569999999999986067777867998301045001477885346877


Q ss_pred             -----------------------CCCCHHHHHHHHHHHHHHHHHHHHHH-HHCCEEEEECCCCC-CCHHHHHHC
Q ss_conf             -----------------------89836889899999999999999854-43869975532883-797798441
Q gi|254780337|r  162 -----------------------RPLWGAYSASKAAIEALARTWSKETV-NTALRVINIDPGPT-RTSMRAKAM  210 (257)
Q Consensus       162 -----------------------~~~~~~Y~asKaal~~lt~~la~E~~-~~gIrvn~I~PG~v-~T~m~~~~~  210 (257)
                                             +...-||-=||-+-..=+|-|++.|- .+||..|++.||-| +|++..+..
T Consensus       163 LGdl~Gl~aG~~~~n~aMidg~~F~~~KAYKDSK~cnMlT~r~lHrRyH~~TGI~F~sLYPGC~A~T~LFR~~~  236 (321)
T TIGR01289       163 LGDLSGLEAGLKAPNIAMIDGKEFKGAKAYKDSKLCNMLTVRELHRRYHDETGIVFASLYPGCVADTGLFREHL  236 (321)
T ss_pred             CCCCCHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCC
T ss_conf             67631133055545643136866654442035678878537888888744037274236885300676330231


No 215
>KOG1478 consensus
Probab=99.83  E-value=1.7e-19  Score=150.58  Aligned_cols=192  Identities=21%  Similarity=0.294  Sum_probs=166.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC-----EEEEEECCHHHHHHHHHHHHHCCC----CEEEEECCCCCHHHHHHHHHHH
Q ss_conf             9999938998688999999998899-----899997898999999999986499----2899987899999999999999
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGA-----YVIACGRSISQLEKLKNALQKINK----KIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~-----~Vi~~~r~~~~l~~~~~~~~~~g~----~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      |+|||||+++|||.+++.+|.++--     +++++.|+.+++|++..++.+..+    ++.++.+|+++-.+|.++...+
T Consensus         4 KvalITGanSglGl~i~~RLl~~~De~~~ltl~ltcR~~~kae~vc~~lk~f~p~~~i~~~yvlvD~sNm~Sv~~A~~di   83 (341)
T KOG1478           4 KVALITGANSGLGLAICKRLLAEDDENVRLTLCLTCRNMSKAEAVCAALKAFHPKSTIEVTYVLVDVSNMQSVFRASKDI   83 (341)
T ss_pred             EEEEEECCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEEEEHHHHHHHHHHHHHH
T ss_conf             38999448886439999999751577616999997177267999999999748876137999998506589999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCC--------------------------HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9981898799876875888888--------------------------67659999999999998999999999999998
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISP--------------------------IWQIKEKSFADVISVNVMANWNIMRSFDPWLK  143 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~--------------------------~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~  143 (257)
                      .++|.++|.+--|||+....+-                          -...+.|+...+|+.|+.|+|++.+...|.+-
T Consensus        84 ~~rf~~ld~iylNAg~~~~~gi~w~~avf~~fsnpv~amt~pt~~~~t~G~is~D~lg~iFetnVFGhfyli~~l~pll~  163 (341)
T KOG1478          84 KQRFQRLDYIYLNAGIMPNPGINWKAAVFGLFSNPVIAMTSPTEGLLTQGKISADGLGEIFETNVFGHFYLIRELEPLLC  163 (341)
T ss_pred             HHHHHHCCEEEECCCCCCCCCCCHHHHHHHHHHCHHHHHCCCHHHHHHCCEECCCCHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             98865335899715657887635999999986023677528106655245133553666752044411024865536764


Q ss_pred             HCCCCEEEEECCHHHCCC---------CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC
Q ss_conf             608986999788356478---------8983688989999999999999985443869975532883797798441
Q gi|254780337|r  144 KSHCGRAIILSSGAAYKC---------RPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM  210 (257)
Q Consensus       144 ~~~~G~IInisS~~g~~~---------~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~  210 (257)
                      .+....+|-+||..+...         ..+-.+|.+||-++.-+.-++-+.+.+.|+--+.++||..-|.|.....
T Consensus       164 ~~~~~~lvwtSS~~a~kk~lsleD~q~~kg~~pY~sSKrl~DlLh~A~~~~~~~~g~~qyvv~pg~~tt~~~~~~l  239 (341)
T KOG1478         164 HSDNPQLVWTSSRMARKKNLSLEDFQHSKGKEPYSSSKRLTDLLHVALNRNFKPLGINQYVVQPGIFTTNSFSEYL  239 (341)
T ss_pred             CCCCCEEEEEEECCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHCCCCCEEECCHHHHHH
T ss_conf             3799738997201146656887887643378974211789999999986144511234520467413220036541


No 216
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated
Probab=99.79  E-value=5.2e-17  Score=133.95  Aligned_cols=197  Identities=22%  Similarity=0.264  Sum_probs=149.8

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             65248899999389986889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      -.+|+|||+.|||||+++|+++.++|..+||+|+...+++++...   +++.....+..+.-++.+++.++..++     
T Consensus       175 alSLKGKTV~VTGASG~LG~aL~k~l~~~GAKVIalTs~~~~i~~---~~~~~~~~~~~i~W~~G~E~~L~~~L~-----  246 (410)
T PRK07424        175 ALSLKGKTVAVTGASGTLGQALLKELHQQGAKVIALTSNSDKIPL---EINGEDLPVKTIHWQVGQEAALAELLE-----  246 (410)
T ss_pred             EEECCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCC---CCCCCCCCCEEEEEECCCHHHHHHHHH-----
T ss_conf             130168679995477377899999999779989999358986553---446654671278643288889888886-----


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             189879987687588888867659999999999998999999999999998608---98699978835647889836889
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH---CGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~---~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                        ++||||.|+||+..    .+-+.+.+.+.++||..+.|++++.|.+.++.++   ..-|-.-+|.+... ....+.|-
T Consensus       247 --kiDILILNHGIN~~----g~~~~~~i~~S~EINalS~~rll~lF~~~~~~~~~~~~kEIWvNTSEAEI~-PA~sP~YE  319 (410)
T PRK07424        247 --KVDILVINHGINVH----GERTPEAINKSYEVNTFSAWRLMELFLTTVKTNQDKATKEVWVNTSEAEVS-PAFSPLYE  319 (410)
T ss_pred             --HCCEEEECCCCCCC----CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHCC-CCCCCHHH
T ss_conf             --46899884887856----665978988767478777999999999996046445774389965343205-55482889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHH
Q ss_conf             899999999999999854438699755328837977984414443245888899999999961975
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ  235 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~  235 (257)
                      .||..+ |.--++...  ....++--+-+|+.+++++        |-.+..|+.||+.|.+++...
T Consensus       320 iSKrli-GqLVSlrrl--~~~~~IRKlILGPFkS~LN--------PiGiMSa~~VAk~I~~~ak~~  374 (410)
T PRK07424        320 LSKRAL-GDLVTLRRL--DAPCVIRKLILGPFKSQLN--------PYGVMSADWVAKQIVKLAKRD  374 (410)
T ss_pred             HHHHHH-HHHHHHHHC--CCCCEEEEEECCCCCCCCC--------CCCCCCHHHHHHHHHHHHHCC
T ss_conf             899997-765867633--7882688763055444688--------762028899999999998558


No 217
>pfam02719 Polysacc_synt_2 Polysaccharide biosynthesis protein. This is a family of diverse bacterial polysaccharide biosynthesis proteins including the CapD protein, WalL protein mannosyl-transferase and several putative epimerases (e.g. WbiI).
Probab=99.68  E-value=4.3e-14  Score=114.39  Aligned_cols=212  Identities=18%  Similarity=0.207  Sum_probs=153.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             99938998688999999998899-8999978989999999999864--99289998789999999999999999818987
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      +|||||++=||..++++|+++|. .|++.+++...+..+..++...  ..++.++.+|++|.+.++++++    ++ ++|
T Consensus         1 ILVTGGaGFIGS~Lv~~Ll~~g~~~v~v~d~~~~~~~~~~~~l~~~~~~~~~~~~~~DI~D~~~l~~~~~----~~-~~D   75 (280)
T pfam02719         1 VLVTGGGGSIGSELCRQILKFNPKKIILFSRDEFKLYEIEQELREEYNDPKLRFFIGDVRDRERLERAME----EY-GVD   75 (280)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHH----HC-CCC
T ss_conf             7997488679999999999689988999908874277899998862678983899811689899999987----54-999


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             99876875888888676599999999999989999999999999986089869997883564788983688989999999
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      +++|-|+.. ....    +.++....+++|+.|+.++...+..    .+-.++|.+||-.+..|   ..+|++||.+-+.
T Consensus        76 ~V~HlAA~~-~V~~----s~~~P~~~~~~Nv~gT~nlLe~a~~----~~vk~~v~~STd~a~~P---~s~Yg~sK~~~E~  143 (280)
T pfam02719        76 TVFHAAALK-HVPL----VEYNPMEAIKTNVLGTENVAEAAIE----NGVEKFVLISTDKAVNP---TNVMGATKRLAEK  143 (280)
T ss_pred             EEEECHHHC-CCCC----HHHCHHHHHHHHHHHHHHHHHHHHH----CCCCEEECCCCCCCCCC---CCCCCCCHHHHHH
T ss_conf             999810311-6532----7669999998872777999988885----39624551476644569---9845423777899


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCH-------HHHHHCCCCC--------CCCCCCHHHHHHHHHHHHCHHHCCCCCE
Q ss_conf             999999985443869975532883797-------7984414443--------2458888999999999619756266857
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTS-------MRAKAMPAED--------PNTVPHPQKVAKIISFLCATQKIETGKL  242 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~-------m~~~~~~~~~--------~~~~~~pediA~~v~fL~s~~~~~tG~~  242 (257)
                      +.++.+.++...++++..+.++-|--|       +..+....++        ...+..-+|+++++...+.  .-..|++
T Consensus       144 l~~~y~~~~~~~~~~~~~lR~fNVyGprgsVIp~Fi~~~~~~~pi~I~dg~qtRdf~~V~D~v~~~l~a~~--~~~~gei  221 (280)
T pfam02719       144 LFQAANRESGSGKTRFSAVRFGNVLGSRGSVIPLFKKQIAEGGPVTVTHPDMTRFFMTIPEAVQLVLQAGA--MGKGGEI  221 (280)
T ss_pred             HHHHHHHHHCCCCCEEEEEEECCEECCCCCCHHHHHHHHHCCCCEEECCCCCEEEEEEHHHHHHHHHHHHH--HCCCCCE
T ss_conf             99999997199985489875445028997709999999985998656599843855879999999999997--2877867


Q ss_pred             EEECCCCEE
Q ss_conf             987687631
Q gi|254780337|r  243 FSVPQNRFV  251 (257)
Q Consensus       243 ~~vdgG~~~  251 (257)
                      +++..|+-+
T Consensus       222 fnig~g~~~  230 (280)
T pfam02719       222 FVLDMGEPV  230 (280)
T ss_pred             EECCCCCCE
T ss_conf             888899866


No 218
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzyme catalyzes the first step in the biosynthesis of pseudaminic acid, the conversion of UDP-N-acetylglucosamine to UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences are members of the broader pfam01073 (3-beta hydroxysteroid dehydrogenase/isomerase family) family.
Probab=99.65  E-value=1.7e-13  Score=110.36  Aligned_cols=209  Identities=16%  Similarity=0.159  Sum_probs=148.8

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             48899999389986889999999988--9989999789899999999998649928999878999999999999999981
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARS--GAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~--G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+||++|||||++=||.+++++|+++  ...+++.+|++.....+.....  ..++.++..|++|.+.++.+++      
T Consensus         2 ~~~K~ILVTGGaGfIGS~lv~~Ll~~~~~~~iii~~~de~~~~~l~~~~~--~~~i~f~~gDIrD~~~l~~~~~------   73 (324)
T TIGR03589         2 FNNKSILITGGTGSFGKAFISRLLENYNPKKIIIYSRDELKQWEMQQKFP--APCLRFFIGDVRDKERLTRALR------   73 (324)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHCC--CCCEEEEECCCCCHHHHHHHHC------
T ss_conf             99399999079779999999999972998289996686403288985168--9875999677778899997634------


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
                       .+|+++|-|+. ... |..+..+   ...+++|+.|+.++..++..    .+--++|.+|+--+..|   ...|++||.
T Consensus        74 -~vD~VfHaAA~-khV-p~se~nP---~e~i~tNV~Gt~nlleaa~~----~~Vkk~V~iSTDka~~P---~n~yGasK~  140 (324)
T TIGR03589        74 -GVDYVVHAAAL-KQV-PAAEYNP---FECIRTNINGAQNVIDAAID----NGVKRVVALSTDKAANP---INLYGATKL  140 (324)
T ss_pred             -CCCEEEECCCC-CCC-CHHHHCH---HHHHHHHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCC---CCCCCCCHH
T ss_conf             -88899994627-767-2677698---99999997999999999885----55431786226888899---674312367


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCH------HHH-HHCCCCCC---------CCCCCHHHHHHHHHHHHCHHHC
Q ss_conf             9999999999985443869975532883797------798-44144432---------4588889999999996197562
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTS------MRA-KAMPAEDP---------NTVPHPQKVAKIISFLCATQKI  237 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~------m~~-~~~~~~~~---------~~~~~pediA~~v~fL~s~~~~  237 (257)
                      +-..+..........++.+..++..|-|--+      .+. +...+..+         .-+..-+|.+++|.+-+  +.-
T Consensus       141 ~~E~l~~~~~~~~~~~~~~~~~vRygNV~gsrgSViP~F~~qi~~g~~~~~itd~~mtRf~mtv~dav~lV~~a~--~~~  218 (324)
T TIGR03589       141 ASDKLFVAANNISGSKGTRFSVVRYGNVVGSRGSVVPFFKSLKEEGVTELPITDPRMTRFWITLEQGVNFVLKSL--ERM  218 (324)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEEHHHHHHHHHHHH--HHC
T ss_conf             679999999985078886378863327518886639999999983999744499980799888999999999999--828


Q ss_pred             CCCCEEEECC
Q ss_conf             6685798768
Q gi|254780337|r  238 ETGKLFSVPQ  247 (257)
Q Consensus       238 ~tG~~~~vdg  247 (257)
                      ..|++|.-+.
T Consensus       219 ~~GEifv~k~  228 (324)
T TIGR03589       219 LGGEIFVPKI  228 (324)
T ss_pred             CCCEEEECCC
T ss_conf             8984998369


No 219
>PRK12367 short chain dehydrogenase; Provisional
Probab=99.63  E-value=5e-14  Score=113.97  Aligned_cols=200  Identities=20%  Similarity=0.270  Sum_probs=144.3

Q ss_pred             CEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             32652488999993899868899999999889989999789899999999998649928999878999999999999999
Q gi|254780337|r   11 EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        11 ~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      ..+-..+||++.||||++++|+|+.++|.++|++|+....+......    ... .+....+.....+++.++..++   
T Consensus        10 ~~~~~~kgKtIgITGAsGaLG~AL~k~f~~~GakVIalTh~~~~~~~----~~~-~~p~~wi~W~cG~E~~L~~~Lk---   81 (250)
T PRK12367         10 MINSRWNGKRIGITGASGALGKALTKLFRAKGAKVIGLTHSKINNSE----ISD-ESPNEWVSWECGKESSLDKTLA---   81 (250)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCC----CCC-CCCCEEEEEECCCHHHHHHHHH---
T ss_conf             65556389879996787389999999999889989998368888754----556-7895289843499899999987---


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--EEE-EECCHHHCCCCCCCHH
Q ss_conf             9818987998768758888886765999999999999899999999999999860898--699-9788356478898368
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG--RAI-ILSSGAAYKCRPLWGA  167 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G--~II-nisS~~g~~~~~~~~~  167 (257)
                          ++||||.|+|+..    ..+.+.+.+.+.++||..+.|++++.|...-+....-  .=| ..+|-+-.. -...+.
T Consensus        82 ----kiDILILNHGIn~----~~~~~~~~i~~s~EINalS~~RllelF~~~~~~~~~~~~kEiWvNTSEAEi~-PA~sP~  152 (250)
T PRK12367         82 ----KIDVLILNHGINP----GGRQNSNDINKALEINALSSWRLLQLFEDIALNNNSQIPKEIWVNTSEAEIQ-PALSPV  152 (250)
T ss_pred             ----HCCEEEECCCCCC----CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHCC-CCCCCH
T ss_conf             ----5889998387774----5565978999999877787999999999997366555783588615166415-433803


Q ss_pred             HHHHHHHHH---HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHH
Q ss_conf             898999999---99999999854438699755328837977984414443245888899999999961975
Q gi|254780337|r  168 YSASKAAIE---ALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ  235 (257)
Q Consensus       168 Y~asKaal~---~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~  235 (257)
                      |--||-.+-   .|-+.+--.-.+....+--+.+|+.++.+.        |-.+..|+-||..|.+++...
T Consensus       153 YEiSKrliGqLVslr~n~ld~~~~~~~~irKliLGPFkS~LN--------PiGiMs~~~VA~~I~~~a~~~  215 (250)
T PRK12367        153 YEISKRLIGQLVSLKKNLLDKNERKKLIIRKLILGPFRSELN--------PIGIMSADFVAKQIVDQANLG  215 (250)
T ss_pred             HHHHHHHHCCEEEEECCCCCCCCCCCCEEEEEECCCCCCCCC--------CCCCCCHHHHHHHHHHHHHCC
T ss_conf             787898740311554011452225684589984266556788--------752228899999999998448


No 220
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=99.61  E-value=2.3e-12  Score=102.91  Aligned_cols=217  Identities=18%  Similarity=0.220  Sum_probs=164.0

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             524889999938998688999999998899-8999978989999999999864--9928999878999999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      -.|+||+++||||++-||.++++++++.+. ++++.+|++.++..+..+++..  ..+..++-+|+.|.+.++.+++.- 
T Consensus       246 ~~~~gK~vLVTGagGSiGsel~~qil~~~p~~i~l~~~~E~~~~~i~~el~~~~~~~~~~~~igdVrD~~~~~~~~~~~-  324 (588)
T COG1086         246 AMLTGKTVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKFPELKLRFYIGDVRDRDRVERAMEGH-  324 (588)
T ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCC-
T ss_conf             6707988999689873679999999854987899961763779999999986278751689963534689999998638-


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
                          ++|++.|.|+ . +--|+.|..++|   .+..|+.|+.++..++..    .+--++|.||+--+.+|   ...|++
T Consensus       325 ----kvd~VfHAAA-~-KHVPl~E~nP~E---ai~tNV~GT~nv~~aa~~----~~V~~~V~iSTDKAV~P---tNvmGa  388 (588)
T COG1086         325 ----KVDIVFHAAA-L-KHVPLVEYNPEE---AIKTNVLGTENVAEAAIK----NGVKKFVLISTDKAVNP---TNVMGA  388 (588)
T ss_pred             ----CCCEEEEHHH-H-CCCCCHHCCHHH---HHHHHHHHHHHHHHHHHH----HCCCEEEEEECCCCCCC---CHHHHH
T ss_conf             ----8866887555-5-368631018899---998721738999999998----39778999705866688---417668


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCC------HHHHHHCCCCCCCC---------CCCHHHHHHHHHHHHCHH
Q ss_conf             999999999999998544386997553288379------77984414443245---------888899999999961975
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRT------SMRAKAMPAEDPNT---------VPHPQKVAKIISFLCATQ  235 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T------~m~~~~~~~~~~~~---------~~~pediA~~v~fL~s~~  235 (257)
                      ||..-..+.++.+.+..+.+-++.++--|-|--      |+..+.+.+-.+-.         +..-.|.++.|+.-.  +
T Consensus       389 TKr~aE~~~~a~~~~~~~~~T~f~~VRFGNVlGSrGSViPlFk~QI~~GgplTvTdp~mtRyfMTI~EAv~LVlqA~--a  466 (588)
T COG1086         389 TKRLAEKLFQAANRNVSGTGTRFCVVRFGNVLGSRGSVIPLFKKQIAEGGPLTVTDPDMTRFFMTIPEAVQLVLQAG--A  466 (588)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEEECCEECCCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEHHHHHHHHHHHH--H
T ss_conf             89999999999741048888579999825454588777788999997599845468670567888999999999987--5


Q ss_pred             HCCCCCEEEECCCC
Q ss_conf             62668579876876
Q gi|254780337|r  236 KIETGKLFSVPQNR  249 (257)
Q Consensus       236 ~~~tG~~~~vdgG~  249 (257)
                      ---.|++|..|-|.
T Consensus       467 ~~~gGeifvldMGe  480 (588)
T COG1086         467 IAKGGEIFVLDMGE  480 (588)
T ss_pred             HCCCCCEEEECCCC
T ss_conf             06898589981899


No 221
>TIGR03466 HpnA hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene.
Probab=99.60  E-value=6.7e-13  Score=106.44  Aligned_cols=203  Identities=21%  Similarity=0.219  Sum_probs=139.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      .+|||||++=||..++++|+++|++|....|+....+.+    .  +..+.++.+|++|++++++.++       .+|++
T Consensus         2 riLVTGgtGfiG~~l~~~L~~~G~~V~~l~r~~~~~~~~----~--~~~~~~~~gDl~d~~~~~~~~~-------~~d~V   68 (328)
T TIGR03466         2 KVLVTGATGFVGSAVVRLLLERGEEVRVLVRPTSDRRNL----E--GLDVEIVEGDLRDPASLRKALA-------GCRAL   68 (328)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHH----C--CCCCEEEEEECCCHHHHHHHHH-------CCCEE
T ss_conf             499986777999999999997849899998999865565----2--1797799820799999999971-------78589


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC---------------C
Q ss_conf             8768758888886765999999999999899999999999999860898699978835647889---------------8
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRP---------------L  164 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~---------------~  164 (257)
                      ||.|+...    ++.-+   -+..+++|+.|+.++.+++..    .+-.++|.+||.+.+-..+               .
T Consensus        69 iH~Aa~~~----~~~~~---~~~~~~~Nv~gt~nll~aa~~----~~v~r~V~~SS~~v~g~~~~~~~~~E~~p~~~~~~  137 (328)
T TIGR03466        69 FHVAADYR----LWAPD---PEEMYRANVEGTRNLLRAALE----AGVERVVYTSSVATLGVPGDGTPADETTPSSLEKM  137 (328)
T ss_pred             EEECCCCC----CCCCC---HHHHHHHHHHHHHHHHHHHHH----CCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             76134234----46799---899999999999999999997----29874315633578557888874025676545666


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCH----------HHHHHCCCCCC------CCCCCHHHHHHHH
Q ss_conf             3688989999999999999985443869975532883797----------79844144432------4588889999999
Q gi|254780337|r  165 WGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTS----------MRAKAMPAEDP------NTVPHPQKVAKII  228 (257)
Q Consensus       165 ~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~----------m~~~~~~~~~~------~~~~~pediA~~v  228 (257)
                      .+.|+.||.+-+.+.+.++.+   +|+.+..+.|+.+--|          +..+......+      ..+..-+|+|+++
T Consensus       138 ~~~Y~~sK~~aE~~~~~~~~~---~gl~~~ilRp~~v~Gp~d~~~~~~~~~i~~~~~~~~p~~~~~g~~~v~V~Dva~a~  214 (328)
T TIGR03466       138 IGHYKRSKFLAEEAALRMIAE---KGLPVVIVNPSTPIGPRDIKPTPTGRIIVDFLRGKMPAYVDTGLNLVHVDDVAEGH  214 (328)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH---CCCCEEEECCCCEECCCCCCCCCHHHHHHHHHCCCCCEEECCCCEEEEEHHHHHHH
T ss_conf             577889999999999999997---29975997778568899888876699999997599976755871899838999999


Q ss_pred             HHHHCHHHCCCCCEEEECCCCEEC
Q ss_conf             996197562668579876876315
Q gi|254780337|r  229 SFLCATQKIETGKLFSVPQNRFVN  252 (257)
Q Consensus       229 ~fL~s~~~~~tG~~~~vdgG~~~n  252 (257)
                      ...+  ++-..|+.+.+. |..++
T Consensus       215 ~~a~--~~~~~g~~y~~~-~~~~t  235 (328)
T TIGR03466       215 LLAL--ERGRIGERYILG-GENLT  235 (328)
T ss_pred             HHHH--HCCCCCCEEEEC-CCCCC
T ss_conf             9997--579989879979-99710


No 222
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional
Probab=99.58  E-value=1.8e-12  Score=103.51  Aligned_cols=216  Identities=17%  Similarity=0.185  Sum_probs=141.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCE-EEEEECCH--HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             99999389986889999999988998-99997898--9999999999864992899987899999999999999998189
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAY-VIACGRSI--SQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~~--~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      |++|||||++=||..+++.|+++|.+ |++.+...  .....+...  ....++.++.+|++|.++++++++..     +
T Consensus         2 KkILVTGg~GFIGs~Lv~~Ll~~~~~~v~~~d~~~~~~~~~~~~~~--~~~~~~~~~~~Di~d~~~l~~~~~~~-----~   74 (355)
T PRK10217          2 RKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPV--AQSERFAFEKVDICDRAELARVFTEY-----Q   74 (355)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHH--HCCCCCEEEECCCCCHHHHHHHHHHC-----C
T ss_conf             9699937875799999999997699889998289876525444454--12787169980058899999999861-----9


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH---HH--HCCCCEEEEECCHHHCC----------
Q ss_conf             8799876875888888676599999999999989999999999999---98--60898699978835647----------
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW---LK--KSHCGRAIILSSGAAYK----------  160 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~---m~--~~~~G~IInisS~~g~~----------  160 (257)
                      +|+++|.|+.. ....    +.++-...+++|+.++.++.+++..+   +.  .+..-+++.+||...+-          
T Consensus        75 pD~ViHlAa~~-~~~~----s~~~p~~~~~~N~~gt~~lleaar~~~~~l~~~~~~~~~~~~~SS~~vYG~~~~~~~~~~  149 (355)
T PRK10217         75 PDCVMHLAAES-HVDR----SIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHSTDDFFT  149 (355)
T ss_pred             CCEEEEECCCC-CHHH----HHCCHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHCCCCCCCCCCCCC
T ss_conf             98899942422-1101----211967754303075789999999977544330366148886554200367778888767


Q ss_pred             ---CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCH----------HHHHHCCCCCC---------CCC
Q ss_conf             ---88983688989999999999999985443869975532883797----------79844144432---------458
Q gi|254780337|r  161 ---CRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTS----------MRAKAMPAEDP---------NTV  218 (257)
Q Consensus       161 ---~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~----------m~~~~~~~~~~---------~~~  218 (257)
                         +.....+|+.||.+-..+.+.++.++   |+.+..+.|.-+--|          +..+....++.         ..+
T Consensus       150 E~~~~~P~s~Yg~sK~~~E~l~~~~~~~~---gl~~~i~R~~nvYGP~~~~~~~i~~~i~~~~~g~~i~i~G~G~q~Rdf  226 (355)
T PRK10217        150 ETTPYAPSSPYSASKASSDHLVRAWLRTY---GLPTLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDW  226 (355)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHC---CCCEEEECCCCEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCEEEEE
T ss_conf             78888999888999876655435555415---887697235755791999840499999999749988627999828975


Q ss_pred             CCHHHHHHHHHHHHCHHHCCCCCEEEECCCCEE
Q ss_conf             888999999999619756266857987687631
Q gi|254780337|r  219 PHPQKVAKIISFLCATQKIETGKLFSVPQNRFV  251 (257)
Q Consensus       219 ~~pediA~~v~fL~s~~~~~tG~~~~vdgG~~~  251 (257)
                      ..-+|+++++..++.  ....|++++|.+|...
T Consensus       227 ~yV~D~v~a~~~~~~--~~~~ge~yNiG~g~~~  257 (355)
T PRK10217        227 LYVEDHARALYCVAT--TGKVGETYNIGGHNER  257 (355)
T ss_pred             EEHHHHHHHHHHHHH--CCCCCCEEEECCCCCC
T ss_conf             858999999999996--6999997997999962


No 223
>pfam01370 Epimerase NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.
Probab=99.57  E-value=7.8e-13  Score=105.98  Aligned_cols=201  Identities=21%  Similarity=0.225  Sum_probs=137.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             99938998688999999998899899997898999999999986499289998789999999999999999818987998
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILI  100 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDilV  100 (257)
                      +|||||++=||..+++.|.++|++|+...|+.......     .......++.+|++|++.++++++..     .+|++|
T Consensus         1 ILItGasGfiG~~l~~~L~~~g~~v~~~~r~~~~~~~~-----~~~~~~~~~~~dl~~~~~~~~~~~~~-----~~D~Vi   70 (235)
T pfam01370         1 ILVTGGTGFIGSALVRRLLQEGYEVIVLGRRRRSESLN-----TGRIRFRFHEGDLTDPDALERLLAEV-----QPDAVI   70 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHH-----HCCCCCEEEEEECCCHHHHHHHHHHC-----CCCEEE
T ss_conf             79972897999999999997879899998997301222-----11467659996588999999998538-----998999


Q ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-----------CCCCHHHH
Q ss_conf             7687588888867659999999999998999999999999998608986999788356478-----------89836889
Q gi|254780337|r  101 ANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC-----------RPLWGAYS  169 (257)
Q Consensus       101 NNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~-----------~~~~~~Y~  169 (257)
                      |.||... .. ...   ++-...+++|+.++.++.+++.    +.+..++|++||.+.+-.           ......|+
T Consensus        71 hlAa~~~-~~-~~~---~~~~~~~~~N~~~t~~ll~~~~----~~~~~~~I~~SS~~vYg~~~~~~~~E~~~~~p~~~Y~  141 (235)
T pfam01370        71 HLAAQSG-VG-ASF---EDPAEFIRANVLGTLNLLEAAR----RAGVKRFVFASSSEVYGDVADPPITEDTPLGPLSPYA  141 (235)
T ss_pred             ECCCCCC-CH-HHH---CCHHHHHHHHHHHHHHHHHHHH----HCCCCEEEEECCCEEECCCCCCCCCCCCCCCCCCHHH
T ss_conf             8977478-32-655---1999999999999999999999----8399989992563574799999977777889850799


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCC---------HH----HHHHCCCC----------CCCCCCCHHHHHH
Q ss_conf             8999999999999998544386997553288379---------77----98441444----------3245888899999
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRT---------SM----RAKAMPAE----------DPNTVPHPQKVAK  226 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T---------~m----~~~~~~~~----------~~~~~~~pediA~  226 (257)
                      .||...+.+.+.++.++   ++++..+.|+.+--         .+    ..+.....          ....+..-+|+++
T Consensus       142 ~sK~~~E~~~~~~~~~~---~~~~~ilR~~~vyGp~~~~~~~~~~i~~~i~~~~~~~~~~~~~g~g~~~r~~i~v~D~~~  218 (235)
T pfam01370       142 AAKLAGERLVLAYARAY---GLRAVILRLFNVYGPGDNDTFVTHVIPALIRRILEGKPEILLLGDGTQRRDFLYVDDVAR  218 (235)
T ss_pred             HHHHHHHHHHHHHHHHH---CCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCEEECCCCEEECCCCHHHHHH
T ss_conf             99999999999999984---889865001259889988776214899999999828997277089997891794999999


Q ss_pred             HHHHHHCHHHCCCCCEEEE
Q ss_conf             9999619756266857987
Q gi|254780337|r  227 IISFLCATQKIETGKLFSV  245 (257)
Q Consensus       227 ~v~fL~s~~~~~tG~~~~v  245 (257)
                      ++..++..  -..|++++|
T Consensus       219 ai~~~~~~--~~~g~iyNI  235 (235)
T pfam01370       219 AILLALEH--PDGGEVYNI  235 (235)
T ss_pred             HHHHHHCC--CCCCCCEEC
T ss_conf             99999818--999992429


No 224
>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family. The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones.
Probab=99.56  E-value=2.4e-12  Score=102.76  Aligned_cols=212  Identities=19%  Similarity=0.145  Sum_probs=136.5

Q ss_pred             EEECCCCHHHHHHHHHHHHCC--CEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             993899868899999999889--989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   22 LVTGSSRGIGYYTALELARSG--AYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        22 lVTGas~GIG~a~a~~la~~G--~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      |||||++-||..++++|+++|  +.|...+|+....  ..+.... -..+.++..|++|+++++.+++       .+|.+
T Consensus         1 LVTGg~GFIGs~lv~~Ll~~g~~~~V~~~d~~~~~~--~~~~~~~-~~~~~~v~gDl~d~~~l~~~~~-------~~D~V   70 (280)
T pfam01073         1 LVTGGGGFLGRHIVRLLLREGELQEVRVFDLRFSPE--LLEDFSK-LQVITYIEGDVTDKQDLRRALQ-------GSDVV   70 (280)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHH--HHHHHCC-CCCCEEEECCCCCHHHHHHHHH-------CCCEE
T ss_conf             905867599999999999779975799987889867--8887322-5887599912899999999984-------79989


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-------------CC---
Q ss_conf             87687588888867659999999999998999999999999998608986999788356478-------------89---
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC-------------RP---  163 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~-------------~~---  163 (257)
                      +|.|+.....   ..   .+++..+++|+.|+.++.+++    ++.+-.++|.+||.+.+-+             .|   
T Consensus        71 ~H~Aa~~~~~---~~---~~~~~~~~~Nv~gt~~ll~aa----~~~gvkr~V~~SS~~v~g~~~~~~~~~~~~e~~p~~~  140 (280)
T pfam01073        71 IHTAAIIDVF---GK---AYRDTIMKVNVKGTQNVLDAC----VKAGVRVLVYTSSMEVVGPNSYGQPIVNGDETTPYES  140 (280)
T ss_pred             EEECCCCCCC---CC---CCHHHHHHHHHHHHHHHHHHH----HHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             9721223555---66---799999999999999999999----9647770799700478767777887567888887888


Q ss_pred             -CCHHHHHHHHHHHHHHHHHHHHHHH--HCCEEEEECCCCCC----CHHHHH----HCCCCC---------CCCCCCHHH
Q ss_conf             -8368898999999999999998544--38699755328837----977984----414443---------245888899
Q gi|254780337|r  164 -LWGAYSASKAAIEALARTWSKETVN--TALRVINIDPGPTR----TSMRAK----AMPAED---------PNTVPHPQK  223 (257)
Q Consensus       164 -~~~~Y~asKaal~~lt~~la~E~~~--~gIrvn~I~PG~v~----T~m~~~----~~~~~~---------~~~~~~ped  223 (257)
                       ...+|+.||.+-+.+..........  ....+..+.|+.+-    +.+...    ......         ...+..-+|
T Consensus       141 ~~~~~Y~~SK~~aE~~vl~a~~~~~~~~~~~~~v~lRp~~vyGp~~~~~~~~~~~~~~~g~~~~~~g~g~~~~~~v~V~D  220 (280)
T pfam01073       141 THQDPYPESKALAEKLVLKANGSTLKNGGRLYTCALRPAGIFGEGDPFLFPFLVRLLKNGLAKFRTGDKNVLSDRVYVGN  220 (280)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEECCCHHHH
T ss_conf             88980288999999999985033443145531688546665389951599999999975999736799998889727876


Q ss_pred             HHHHHHHHHC------HHHCCCCCEEEECCCC-EECC
Q ss_conf             9999999619------7562668579876876-3154
Q gi|254780337|r  224 VAKIISFLCA------TQKIETGKLFSVPQNR-FVNY  253 (257)
Q Consensus       224 iA~~v~fL~s------~~~~~tG~~~~vdgG~-~~n~  253 (257)
                      +|++.+..+.      .+.-.-||.+.|-.|. ..+|
T Consensus       221 va~A~vlA~~~l~~~~~~~~~~Ge~y~i~~~~p~~s~  257 (280)
T pfam01073       221 VAWAHILAARALQDPKKASSIAGQFYFISDDTPHNSY  257 (280)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCH
T ss_conf             9999999998601456677889748997799916779


No 225
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional
Probab=99.55  E-value=7.4e-12  Score=99.46  Aligned_cols=213  Identities=17%  Similarity=0.179  Sum_probs=140.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCE-EEEEECC--HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             999389986889999999988998-9999789--8999999999986499289998789999999999999999818987
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAY-VIACGRS--ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~--~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      +|||||++=||..+++.|+++|.. |+..++.  ....+.+...  ....+..+..+|++|.+.++++++..     ++|
T Consensus         3 ILVTGg~GFIGs~l~~~Ll~~~~~~v~~vd~~~~~~~~~~~~~~--~~~~~~~~~~~Di~d~~~l~~~~~~~-----~~D   75 (352)
T PRK10084          3 ILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADV--SDSERYVFEHADICDRAELDRIFAQH-----QPD   75 (352)
T ss_pred             EEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHH--HCCCCCEEEECCCCCHHHHHHHHHHH-----CCC
T ss_conf             99975100899999999997799889998479876778888876--30897179985678999999999973-----999


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HCCCCEEEEECCHHHCC--CC--------
Q ss_conf             9987687588888867659999999999998999999999999998-----60898699978835647--88--------
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLK-----KSHCGRAIILSSGAAYK--CR--------  162 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~-----~~~~G~IInisS~~g~~--~~--------  162 (257)
                      ++||.|+.. ....    +.++-...+++|+.|+.++..++-.+..     ++...++|++||...+-  +.        
T Consensus        76 ~ViHlAA~~-~~~~----s~~~p~~~~~~Nv~gt~nllea~~~~~~~l~~~~~~~~rfv~~SS~~vYG~~~~p~~~~~~~  150 (352)
T PRK10084         76 AVMHLAAES-HVDR----SITGPAAFIETNIVGTYVLLEAARNYWSALDEDKKNAFRFHHISTDEVYGDLPHPDEVENSV  150 (352)
T ss_pred             EEEECCCCC-CCCH----HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEECCCCCCCCCCCCC
T ss_conf             999977346-6561----33096786522378699999999998643200135405888710140346888863335665


Q ss_pred             -----------CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCH------H----HHHHCCCCCC------
Q ss_conf             -----------983688989999999999999985443869975532883797------7----9844144432------
Q gi|254780337|r  163 -----------PLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTS------M----RAKAMPAEDP------  215 (257)
Q Consensus       163 -----------~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~------m----~~~~~~~~~~------  215 (257)
                                 .....|+.||.+...+.+.++.++   |+.+..+.|+-+--|      +    ..+.+..++.      
T Consensus       151 ~~p~~~e~~~~~p~~~Y~~sK~~~E~l~~~~~~~~---gl~~~i~R~~nvyGP~~~~~~~i~~~i~~~l~g~~i~i~G~G  227 (352)
T PRK10084        151 ELPLFTETTAYAPSSPYSASKASSDHLVRAWLRTY---GLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKG  227 (352)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC---CCCEEEEECCCEECCCCCCCHHHHHHHHHHHCCCEEEEECCC
T ss_conf             57765578999999989999999999999877651---587699852753086999603699999999809736881799


Q ss_pred             ---CCCCCHHHHHHHHHHHHCHHHCCCCCEEEECCCCE
Q ss_conf             ---45888899999999961975626685798768763
Q gi|254780337|r  216 ---NTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRF  250 (257)
Q Consensus       216 ---~~~~~pediA~~v~fL~s~~~~~tG~~~~vdgG~~  250 (257)
                         ..+...+|+++++..++..  -..|+++++-+|..
T Consensus       228 ~~~Rdf~yV~D~v~a~~~~~~~--~~~g~~yNig~~~~  263 (352)
T PRK10084        228 DQIRDWLYVEDHARALYKVVTE--GKAGETYNIGGHNE  263 (352)
T ss_pred             CEEEEEEEHHHHHHHHHHHHHC--CCCCCEEEECCCCC
T ss_conf             8567129759999999999866--99999599899997


No 226
>KOG1502 consensus
Probab=99.55  E-value=5.7e-13  Score=106.92  Aligned_cols=216  Identities=19%  Similarity=0.177  Sum_probs=150.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHH--HHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             889999938998688999999998899899997898999999--999986499289998789999999999999999818
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKL--KNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~--~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      .+++++|||||+=||..++++|+.+||+|..+-|++++.+++  ...++..+.+...+..|++|+++.+..++       
T Consensus         5 ~~~~VcVTGAsGfIgswivk~LL~rGY~V~gtVR~~~~~k~~~~L~~l~~a~~~l~l~~aDL~d~~sf~~ai~-------   77 (327)
T KOG1502           5 EGKKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLEGAKERLKLFKADLLDEGSFDKAID-------   77 (327)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHH-------
T ss_conf             8727999488208999999999868998999970863056589998651575442588524355135999970-------


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC-CC--------
Q ss_conf             987998768758888886765999999-99999989999999999999986089869997883564788-98--------
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFA-DVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCR-PL--------  164 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~-~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~-~~--------  164 (257)
                      ++|+++|.|.-. .   +...+   .+ ++++..+.|+.+....+.+.=   .--|+|.+||.++.... +.        
T Consensus        78 gcdgVfH~Asp~-~---~~~~~---~e~~li~pav~Gt~nVL~ac~~~~---sVkrvV~TSS~aAv~~~~~~~~~~~vvd  147 (327)
T KOG1502          78 GCDGVFHTASPV-D---FDLED---PEKELIDPAVKGTKNVLEACKKTK---SVKRVVYTSSTAAVRYNGPNIGENSVVD  147 (327)
T ss_pred             CCCEEEEECCCC-C---CCCCC---CHHHHHHHHHHHHHHHHHHHHCCC---CCCEEEEECCHHHHCCCCCCCCCCCCCC
T ss_conf             787899917667-8---77787---477663178888999999986058---7226999614787114776788885456


Q ss_pred             ---CH--HHHHHHHHHHH----HHHHHHHHHHHH-CCEEEEECCCCCCCHHHHH-----------HCCC----CCC--CC
Q ss_conf             ---36--88989999999----999999985443-8699755328837977984-----------4144----432--45
Q gi|254780337|r  165 ---WG--AYSASKAAIEA----LARTWSKETVNT-ALRVINIDPGPTRTSMRAK-----------AMPA----EDP--NT  217 (257)
Q Consensus       165 ---~~--~Y~asKaal~~----lt~~la~E~~~~-gIrvn~I~PG~v~T~m~~~-----------~~~~----~~~--~~  217 (257)
                         |+  -|+..+.---.    +++--|.|+++. ++....|+||.|--|....           .+.+    .+.  ..
T Consensus       148 E~~wsd~~~~~~~~~~Y~~sK~lAEkaAw~fa~e~~~~lv~inP~lV~GP~l~~~l~~s~~~~l~~i~G~~~~~~n~~~~  227 (327)
T KOG1502         148 EESWSDLDFCRCKKLWYALSKTLAEKAAWEFAKENGLDLVTINPGLVFGPGLQPSLNSSLNALLKLIKGLAETYPNFWLA  227 (327)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCCCHHHHHHHHHHHCCCCCCCCCCEE
T ss_conf             55578188887667788999999999999999857961899668713797756665502999999870655457877434


Q ss_pred             CCCHHHHHHHHHHHHCHHHCCCCCEEEECCCCE
Q ss_conf             888899999999961975626685798768763
Q gi|254780337|r  218 VPHPQKVAKIISFLCATQKIETGKLFSVPQNRF  250 (257)
Q Consensus       218 ~~~pediA~~v~fL~s~~~~~tG~~~~vdgG~~  250 (257)
                      +.+-.|+|++-+++... ....|+.|.+....+
T Consensus       228 ~VdVrDVA~AHv~a~E~-~~a~GRyic~~~~~~  259 (327)
T KOG1502         228 FVDVRDVALAHVLALEK-PSAKGRYICVGEVVS  259 (327)
T ss_pred             EEEHHHHHHHHHHHHCC-CCCCCEEEEECCCCC
T ss_conf             67699989999999717-666834999527652


No 227
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional
Probab=99.53  E-value=7.7e-12  Score=99.35  Aligned_cols=207  Identities=16%  Similarity=0.191  Sum_probs=139.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCC-CHHHHHHHHHHHHHHHCCC
Q ss_conf             9999938998688999999998-8998999978989999999999864992899987899-9999999999999981898
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELAR-SGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR-DSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~-~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~-d~~~v~~~~~~~~~~~g~i   96 (257)
                      |.+|||||++=||..++++|++ .++.|+..++..++.+...     ..+++.++..|++ +.+.++.       ...++
T Consensus         2 KkILVTGgaGFIGs~Lv~~Ll~~~~~~V~~~d~~~~~~~~~~-----~~~~~~~~~gDi~~~~~~~~~-------~~~~~   69 (347)
T PRK11908          2 KKVLILGVNGFIGHHLTKRILETTDWEVYGMDMQTDRLGDLV-----NHPRMHFFEGDITINKEWIEY-------HVKKC   69 (347)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHC-----CCCCEEEEECCCCCCHHHHHH-------HHCCC
T ss_conf             889997574389999999999828978999979976367755-----799859997754469999997-------66059


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC--C----CC-------
Q ss_conf             7998768758888886765999999999999899999999999999860898699978835647--8----89-------
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK--C----RP-------  163 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~--~----~~-------  163 (257)
                      |+++|-|++... ....    ++-...+++|+.+..++.+.+.+    .+ -++|+.||...+-  +    .+       
T Consensus        70 D~V~HlAa~~~~-~~~~----~~p~~~~~~nv~~t~~ll~~~~~----~~-~r~if~SS~~VYG~~~~~~~~~~~~~~~~  139 (347)
T PRK11908         70 DVVLPLVAIATP-ATYV----KQPLRVFELDFEANLPIVRSAVK----YG-KHLVFPSTSEVYGMCSDEEFDPEASALTY  139 (347)
T ss_pred             CEEEEEHHCCCH-HHHH----HCHHHHHHHHHHHHHHHHHHHHH----HC-CEEEECCCCEEECCCCCCCCCCCCCCCCC
T ss_conf             889752000364-8888----68899999999999999999997----39-83896266126547899998977787657


Q ss_pred             -----CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCC--------CCC----------HHHHHHCCCCC------
Q ss_conf             -----8368898999999999999998544386997553288--------379----------77984414443------
Q gi|254780337|r  164 -----LWGAYSASKAAIEALARTWSKETVNTALRVINIDPGP--------TRT----------SMRAKAMPAED------  214 (257)
Q Consensus       164 -----~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~--------v~T----------~m~~~~~~~~~------  214 (257)
                           -...|+.||.+...+.+..+.++   |+.+..+.|.-        +..          .+..+....++      
T Consensus       140 ~p~~~p~~~Y~~sK~~~E~l~~~y~~~~---~l~~~ilR~~nvyGP~~~~~~~~~~~~~~vi~~~i~~~~~g~~i~i~g~  216 (347)
T PRK11908        140 GPINKPRWIYACSKQLMDRVIWAYGMEE---GLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGEPISLVDG  216 (347)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHH---CCCEEEEEECCEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCC
T ss_conf             8877865477899999999999999985---8987999766676699665568544632027999999983898403599


Q ss_pred             ---CCCCCCHHHHHHHHHHHHCH-HHCCCCCEEEECC-CCE
Q ss_conf             ---24588889999999996197-5626685798768-763
Q gi|254780337|r  215 ---PNTVPHPQKVAKIISFLCAT-QKIETGKLFSVPQ-NRF  250 (257)
Q Consensus       215 ---~~~~~~pediA~~v~fL~s~-~~~~tG~~~~vdg-G~~  250 (257)
                         ...+..-+|+++++..++.. +....|++++|-+ |..
T Consensus       217 G~~~Rdf~yV~D~v~a~~~~l~~~~~~~~~~i~NIGs~~~~  257 (347)
T PRK11908        217 GSQKRAFTDIDDGISALMKIIENKDGVASGKIYNIGNPKNN  257 (347)
T ss_pred             CCEEECCEEHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCC
T ss_conf             97103678667999999999967788888997995889986


No 228
>PRK10675 UDP-galactose-4-epimerase; Provisional
Probab=99.47  E-value=1.4e-11  Score=97.60  Aligned_cols=215  Identities=16%  Similarity=0.175  Sum_probs=133.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             9999389986889999999988998999978989999999999864-992899987899999999999999998189879
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~-g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      .+|||||++=||..++++|+++|+.|++.++-...-......++.. +..+.++.+|++|.+.++++++    ++ .+|.
T Consensus         2 kvLVTGg~GFIGs~l~~~Ll~~g~~V~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~~~~~~~----~~-~~d~   76 (338)
T PRK10675          2 RVLVTGGSGYIGSHTCVQLLQNGHDVVILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILH----DH-AIDT   76 (338)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHH----HC-CCCE
T ss_conf             199989876799999999997849899998898873767888886147887599832799899999998----65-9999


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---------CC---CCH
Q ss_conf             987687588888867659999999999998999999999999998608986999788356478---------89---836
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC---------RP---LWG  166 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~---------~~---~~~  166 (257)
                      ++|-||... ...    +.++-...+++|+.|+.++..++    ++.+-.++|+.||...+-.         .|   -..
T Consensus        77 V~HlAa~~~-~~~----~~~~p~~~~~~Nv~gt~nllea~----~~~~vkr~v~~SS~~vYG~~~~~p~~E~~~~~~P~s  147 (338)
T PRK10675         77 VIHFAGLKA-VGE----SVQKPLEYYDNNVNGTLRLISAM----RAANVKNLIFSSSATVYGDQPKIPYVESFPTGTPQS  147 (338)
T ss_pred             EEECCCCCC-CCC----HHHCHHHHHHHHHHHHHHHHHHH----HHCCCCEEEEECCCEEECCCCCCCEECCCCCCCCCC
T ss_conf             998986545-462----11098999886898899999999----973988799963720337898898002478999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEEEEC--------CCCC--------CC---HHHHHH-CC---------------
Q ss_conf             8898999999999999998544386997553--------2883--------79---779844-14---------------
Q gi|254780337|r  167 AYSASKAAIEALARTWSKETVNTALRVINID--------PGPT--------RT---SMRAKA-MP---------------  211 (257)
Q Consensus       167 ~Y~asKaal~~lt~~la~E~~~~gIrvn~I~--------PG~v--------~T---~m~~~~-~~---------------  211 (257)
                      +|+.||.+.+.+.+.++....  ++.+..+.        |...        ..   +...+. ..               
T Consensus       148 ~Yg~sK~~~E~~l~~~~~~~~--~~~~~i~R~fn~~G~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~~l~i~G~~~~~~  225 (338)
T PRK10675        148 PYGKSKLMVEQILTDLQKAQP--DWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTE  225 (338)
T ss_pred             CCHHHHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             413557899999999998768--986899966354254777766879732167999999999844787077527975467


Q ss_pred             -CCCCCCCCCHHHHHHHHHHHHCH-HHCCCCCEEEECCCCE
Q ss_conf             -44324588889999999996197-5626685798768763
Q gi|254780337|r  212 -AEDPNTVPHPQKVAKIISFLCAT-QKIETGKLFSVPQNRF  250 (257)
Q Consensus       212 -~~~~~~~~~pediA~~v~fL~s~-~~~~tG~~~~vdgG~~  250 (257)
                       ......+..-+|+++++.-++.. ..-..++++++-.|.-
T Consensus       226 dG~~~Rdfi~V~D~~~a~~~a~~~~~~~~~~~i~Nigsg~~  266 (338)
T PRK10675        226 DGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVG  266 (338)
T ss_pred             CCCCCCCCEEHHHHHHHHHHHHHHHCCCCCCEEEEECCCCC
T ss_conf             99866563318779999999999741689845899679975


No 229
>pfam04321 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.
Probab=99.42  E-value=8.5e-11  Score=92.37  Aligned_cols=190  Identities=17%  Similarity=0.184  Sum_probs=125.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             99938998688999999998899899997898999999999986499289998789999999999999999818987998
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILI  100 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDilV  100 (257)
                      +|||||++=||..+++.|.++|+.|+..+|.                     .+|++|++.++++++..     ++|++|
T Consensus         1 ILVtG~~GfiGs~l~~~L~~~g~~v~~~~r~---------------------~~D~~d~~~l~~~~~~~-----~pd~Vi   54 (284)
T pfam04321         1 ILVTGANGQLGRELTRLLAERGVEVVALDRP---------------------ELDLTDPEAVAALVREA-----RPDVVV   54 (284)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCC---------------------CCCCCCHHHHHHHHHHC-----CCCEEE
T ss_conf             6996489989999999998689989995486---------------------25788999999999864-----997999


Q ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC-----------CCHHHH
Q ss_conf             768758888886765999999999999899999999999999860898699978835647889-----------836889
Q gi|254780337|r  101 ANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRP-----------LWGAYS  169 (257)
Q Consensus       101 NNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~-----------~~~~Y~  169 (257)
                      |.|+.. ....    ..++.+..+.+|+.++.++...+..    .+ -++|++||...+-+.+           -...|+
T Consensus        55 hlAa~~-~~~~----~~~~~~~~~~~Nv~~t~~l~~~~~~----~~-~~~i~~Ss~~Vy~g~~~~p~~E~~~~~P~~~Yg  124 (284)
T pfam04321        55 NAAAYT-AVDK----AESEPELAYAVNALGPGNLAEACAA----RG-APLIHISTDYVFDGAKGGPYREDDPTGPLNVYG  124 (284)
T ss_pred             ECCCCC-CCHH----HHHCHHHHHHHHHHHHHHHHHHHHH----CC-CCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             724135-5567----7748888998759999999999874----49-857984175300068998854577778988016


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCC----CC----HHHHHHCCCCC-------CCCCCCHHHHHHHHHHHHCH
Q ss_conf             89999999999999985443869975532883----79----77984414443-------24588889999999996197
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPT----RT----SMRAKAMPAED-------PNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v----~T----~m~~~~~~~~~-------~~~~~~pediA~~v~fL~s~  234 (257)
                      .||...+.+.+....       +...+.|+.+    .-    .|........+       .......+|+|+++..++..
T Consensus       125 ~sK~~~E~~~~~~~~-------~~~IlR~~~vyG~~~~~~~~~~~~~~~~~~~i~i~~d~~~~~~~v~D~a~~~~~~~e~  197 (284)
T pfam04321       125 RTKLAGEQAVLAANP-------RHLILRTAWVYGEYGNNFVKTMLRLAAERDELRVVDDQLGSPTSARDLADALLALIRK  197 (284)
T ss_pred             HHHHHHHHHHHHHCC-------CCEEEEEEEECCCCCCCHHHHHHHHHHCCCCCEEECCCCCCCEEHHHHHHHHHHHHHH
T ss_conf             575899999997253-------4607877344288887889999999862898268537568969899999999999982


Q ss_pred             H-H-CCCCCEEEECCCCEECC
Q ss_conf             5-6-26685798768763154
Q gi|254780337|r  235 Q-K-IETGKLFSVPQNRFVNY  253 (257)
Q Consensus       235 ~-~-~~tG~~~~vdgG~~~n~  253 (257)
                      . + -..+.++++-++..+++
T Consensus       198 ~~~~~~~~giyNi~~~~~~s~  218 (284)
T pfam04321       198 RLRGPALAGTYHLAGSGETSW  218 (284)
T ss_pred             CCCCCCCCCCEEECCCCCEEH
T ss_conf             033777776137418984409


No 230
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=99.37  E-value=6.6e-11  Score=93.09  Aligned_cols=202  Identities=21%  Similarity=0.228  Sum_probs=138.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC-CE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898-79
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL-DI   98 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i-Di   98 (257)
                      .+||||+++=||..++++|.+.|+.|...+|...+.....       ..+..+..|++|.+.+.+..+       .. |.
T Consensus         2 ~iLVtG~tGfiG~~l~~~L~~~g~~V~~~~r~~~~~~~~~-------~~~~~~~~d~~~~~~~~~~~~-------~~~d~   67 (314)
T COG0451           2 RILVTGGAGFIGSHLVERLLAAGHDVRGLDRLRDGLDPLL-------SGVEFVVLDLTDRDLVDELAK-------GVPDA   67 (314)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC-------CCCCEEECCCCCHHHHHHHHC-------CCCCE
T ss_conf             6999928877799999999858997999917875431124-------676434225335678998854-------58878


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC-----------CCCH-
Q ss_conf             9876875888888676599999999999989999999999999986089869997883564788-----------9836-
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCR-----------PLWG-  166 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~-----------~~~~-  166 (257)
                      +||.|+....  +....+  +....+++|+.++.++.+++..    .+..++|..||.+..-+.           |... 
T Consensus        68 vih~aa~~~~--~~~~~~--~~~~~~~~nv~gt~~ll~aa~~----~~~~~~v~~ss~~~~~~~~~~~~~~E~~~~~~p~  139 (314)
T COG0451          68 VIHLAAQSSV--PDSNAS--DPAEFLDVNVDGTLNLLEAARA----AGVKRFVFASSVSVVYGDPPPLPIDEDLGPPRPL  139 (314)
T ss_pred             EEECCCCCCC--CCCCCC--CHHHHHHHHHHHHHHHHHHHHH----CCCCEEEEECCCCEECCCCCCCCCCCCCCCCCCC
T ss_conf             9988864677--533321--4788999999999999999986----7998799978750127887888878655788887


Q ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCC----H-----HHHH----HCCCCC---C-------CCCCCHH
Q ss_conf             -8898999999999999998544386997553288379----7-----7984----414443---2-------4588889
Q gi|254780337|r  167 -AYSASKAAIEALARTWSKETVNTALRVINIDPGPTRT----S-----MRAK----AMPAED---P-------NTVPHPQ  222 (257)
Q Consensus       167 -~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T----~-----m~~~----~~~~~~---~-------~~~~~pe  222 (257)
                       +|+.||.....+....+.   .+++.+..+.|+.+--    +     +...    .....+   .       ..+...+
T Consensus       140 ~~Yg~sK~~~E~~~~~~~~---~~~~~~~ilR~~~vyGp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~  216 (314)
T COG0451         140 NPYGVSKLAAEQLLRAYAR---LYGLPVVILRPFNVYGPGDKPDLSSGVVSAFIRQLLKGEPIIVIGGDGSQTRDFVYVD  216 (314)
T ss_pred             CHHHHHHHHHHHHHHHHHH---HCCCCEEEEEECEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCEEEEEEHH
T ss_conf             6779999999999999766---3399579998463788898777420789999999870788503507886224257799


Q ss_pred             HHHHHHHHHHCHHHCCCCCEEEECCCC
Q ss_conf             999999996197562668579876876
Q gi|254780337|r  223 KVAKIISFLCATQKIETGKLFSVPQNR  249 (257)
Q Consensus       223 diA~~v~fL~s~~~~~tG~~~~vdgG~  249 (257)
                      |+++++.+++....  .+ .+++.++.
T Consensus       217 D~~~~~~~~~~~~~--~~-~~ni~~~~  240 (314)
T COG0451         217 DVADALLLALENPD--GG-VFNIGSGT  240 (314)
T ss_pred             HHHHHHHHHHHCCC--CC-EEEECCCC
T ss_conf             99999999973888--71-89946987


No 231
>CHL00194 ycf39 Ycf39; Provisional
Probab=99.36  E-value=5.3e-10  Score=87.03  Aligned_cols=197  Identities=14%  Similarity=0.095  Sum_probs=135.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      ++|||||++-+|+.++++|+++|+.|....|+.+++..+.    ..|  +..+..|+.|++++...++       .+|.+
T Consensus         2 ~ILV~GATG~lGr~vVr~Ll~~G~~Vr~lvRnp~ka~~l~----~~G--ve~v~gDl~dpesl~~Al~-------GvdaV   68 (319)
T CHL00194          2 SLLVIGATGTLGRQIVRRALDEGYQVKCLVRNLRKAAFLK----EWG--AELVYGDLSLPETIPPALE-------GITAI   68 (319)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHH----HCC--CEEEEECCCCHHHHHHHHC-------CCCEE
T ss_conf             7999899858999999999968890899957867632342----159--6799942788778999965-------99679


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             87687588888867659999999999998999999999999998608986999788356478898368898999999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALA  179 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt  179 (257)
                      |+.++. .+ ....        ...+++..+..++.    ...++.+-.|+|.+|+..+.. . ...+|..+|+....+ 
T Consensus        69 i~~~~~-~~-~~~~--------~~~~vd~~g~~~li----~AAk~aGVkr~V~lS~lga~~-~-~~~p~~~~K~~~E~~-  131 (319)
T CHL00194         69 IDASTS-RP-SDLN--------NAYQIDLEGKLALI----EAAKAAKVKRFIFFSILNAEQ-Y-PQVPLMKIKSDIEEK-  131 (319)
T ss_pred             EEECCC-CC-CCCC--------HHHHHHHHHHHHHH----HHHHHCCCCEEEEECCCCCCC-C-CCCHHHHHHHHHHHH-
T ss_conf             994566-77-8862--------08898898899999----999984998899961356666-8-875677879999999-


Q ss_pred             HHHHHHHHHHCCEEEEECCCCCCCHHHHH----HCCCC------C--CCCCCCHHHHHHHHHHHHCHHHCCCCCEEEECC
Q ss_conf             99999854438699755328837977984----41444------3--245888899999999961975626685798768
Q gi|254780337|r  180 RTWSKETVNTALRVINIDPGPTRTSMRAK----AMPAE------D--PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQ  247 (257)
Q Consensus       180 ~~la~E~~~~gIrvn~I~PG~v~T~m~~~----~~~~~------~--~~~~~~pediA~~v~fL~s~~~~~tG~~~~vdg  247 (257)
                            +...|+-.+-+.|+..--.+..+    .....      .  +-.....+|||+.++-.++... ..|+++.+-|
T Consensus       132 ------L~~Sgl~~TIlRPs~F~q~l~~~~a~pi~~~~~v~~~~~~~~ia~I~~~DVA~~~a~aL~~~~-~~gk~y~L~G  204 (319)
T CHL00194        132 ------LKQSGINYTIFRLAGFFQGLISQYAIPILDSQTIWITGESTPIAYIDTQDAAKFALKSLSLPE-TKNKTFPLVG  204 (319)
T ss_pred             ------HHHCCCCEEEECCHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCC-CCCCEEEEEC
T ss_conf             ------986799859984739999889987677630785776699875288779999999999958977-5898999549


Q ss_pred             CCEECC
Q ss_conf             763154
Q gi|254780337|r  248 NRFVNY  253 (257)
Q Consensus       248 G~~~n~  253 (257)
                      .+-+++
T Consensus       205 P~a~T~  210 (319)
T CHL00194        205 PKSWNS  210 (319)
T ss_pred             CCCCCH
T ss_conf             863899


No 232
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432   Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is found together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologues of PfaA, also included in this entry, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis; an alternative to the more familiar iterated mechanism of chain extension and desaturation, and like PfaA the more distant homologues are likewise found near genes for homologues of PfaB, PfaC, and/or PfaD..
Probab=99.25  E-value=6.2e-10  Score=86.57  Aligned_cols=184  Identities=22%  Similarity=0.304  Sum_probs=145.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCC-CEEEEEECCHH--H---------------------------------------
Q ss_conf             88999993899868899999999889-98999978989--9---------------------------------------
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSG-AYVIACGRSIS--Q---------------------------------------   54 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G-~~Vi~~~r~~~--~---------------------------------------   54 (257)
                      ++..+|||||++|+-.+++..||++= ++-++.+|+..  .                                       
T Consensus      2158 ~~~~~LV~GGAKGVT~~C~l~lAK~~~a~FiL~GRS~~~~~~~~P~WA~G~s~~~~LK~AA~~~l~~~GeKPTP~~V~~l 2237 (2773)
T TIGR02813      2158 KDDKVLVTGGAKGVTFECALELAKQCQAHFILAGRSSHIADDELPSWAQGKSDENELKKAAIQHLQASGEKPTPKKVDAL 2237 (2773)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHCCCEEEECCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             68717883787622599999998753211455033045552068741046503567899999999863899885225866


Q ss_pred             ---------HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH--C--CCCEEEECCCCCCCCCCHHHCCHHHHH
Q ss_conf             ---------999999998649928999878999999999999999981--8--987998768758888886765999999
Q gi|254780337|r   55 ---------LEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW--G--KLDILIANAGILGSISPIWQIKEKSFA  121 (257)
Q Consensus        55 ---------l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~--g--~iDilVNNAGi~~~~~~~~~~~~e~~~  121 (257)
                               +......+...|.+++|+.+||+++.+|...+..+.+..  |  .|..+||-||++.+ +-+.+=+++||+
T Consensus      2238 v~PV~s~~EI~~aLaA~~a~Ga~A~Y~s~DV~~s~sva~~~~~~~~~~g~gsl~iTGiIHGAGVLAD-K~I~~KTL~E~~ 2316 (2773)
T TIGR02813      2238 VKPVLSSLEIAQALAAFKAVGASAEYLSVDVTDSVSVAATVAPLNKLLGQGSLDITGIIHGAGVLAD-KHIQDKTLEEFN 2316 (2773)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCHHHHH-HHHHHHHHHHHH
T ss_conf             4123545789999999985188714788604884789999999998616876210036644113423-445340178775


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCC
Q ss_conf             99999989999999999999986089869997883564788983688989999999999999985443869975532883
Q gi|254780337|r  122 DVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT  201 (257)
Q Consensus       122 ~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v  201 (257)
                      .++.+.+.|--.+...    +-..+--.|+..||.+|+.|.++++-|+.|--=|+--.--|+... |. -+|-+..=|+=
T Consensus      2317 ~VYgTKv~GL~~lL~a----~~~~~~K~~~lFSSAAGFYGN~GQSDYa~sNdILNKaAl~l~~~~-P~-A~V~SF~WGPW 2390 (2773)
T TIGR02813      2317 AVYGTKVDGLESLLAA----LNAEKIKLVALFSSAAGFYGNTGQSDYAMSNDILNKAALQLKARN-PE-AKVLSFNWGPW 2390 (2773)
T ss_pred             HHHCCHHHHHHHHHHH----HCHHCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC-CC-CEEEECCCCCC
T ss_conf             3520016889999975----143106577875110245788885317788888889999998619-97-33873147888


Q ss_pred             CCHHHH
Q ss_conf             797798
Q gi|254780337|r  202 RTSMRA  207 (257)
Q Consensus       202 ~T~m~~  207 (257)
                      |-.|..
T Consensus      2391 DGGMV~ 2396 (2773)
T TIGR02813      2391 DGGMVN 2396 (2773)
T ss_pred             CCCCCC
T ss_conf             876227


No 233
>KOG4022 consensus
Probab=99.24  E-value=3.7e-09  Score=81.41  Aligned_cols=211  Identities=16%  Similarity=0.110  Sum_probs=151.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--CC
Q ss_conf             9999938998688999999998899899997898999999999986499289998789999999999999999818--98
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG--KL   96 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g--~i   96 (257)
                      ..++|-|+-.-+|.++.+.|-+++|-|.-+|..+++-          ...-..+..|-+=-++-+...+++-+.++  ++
T Consensus         4 grVivYGGkGALGSacv~~FkannywV~siDl~eNe~----------Ad~sI~V~~~~swtEQe~~v~~~vg~sL~gekv   73 (236)
T KOG4022           4 GRVIVYGGKGALGSACVEFFKANNYWVLSIDLSENEQ----------ADSSILVDGNKSWTEQEQSVLEQVGSSLQGEKV   73 (236)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCEEEEEEEECCCCC----------CCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             5499976864276899999976686899975025665----------661179637753568899999999876242534


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHH----HHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             799876875888888676599999----9999999899999999999999860898699978835647889836889899
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSF----ADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~----~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                      |.++.-||--. .+.   ....++    |-++.--+...-...+.+..|++  .+|..--.+.-++.-+.|+...|.++|
T Consensus        74 Dav~CVAGGWA-GGn---AksKdl~KNaDLMwKQSvwtSaIsa~lAt~HLK--~GGLL~LtGAkaAl~gTPgMIGYGMAK  147 (236)
T KOG4022          74 DAVFCVAGGWA-GGN---AKSKDLVKNADLMWKQSVWTSAISAKLATTHLK--PGGLLQLTGAKAALGGTPGMIGYGMAK  147 (236)
T ss_pred             CEEEEEECCCC-CCC---CCHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCC--CCCEEEECCCCCCCCCCCCCCCHHHHH
T ss_conf             36999605545-777---422566643026778889999999999984358--885355226411027997410021788


Q ss_pred             HHHHHHHHHHHHHHH--HHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEE
Q ss_conf             999999999999854--438699755328837977984414443245888899999999961975-6266857987
Q gi|254780337|r  173 AAIEALARTWSKETV--NTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSV  245 (257)
Q Consensus       173 aal~~lt~~la~E~~--~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~v  245 (257)
                      +|++.+|++|+.+-.  +.|-.+.+|.|-..||||+.+-+|..+...+..-+.+++..+--..+. +--+|..+.+
T Consensus       148 aAVHqLt~SLaak~SGlP~gsaa~~ilPVTLDTPMNRKwMP~ADfssWTPL~fi~e~flkWtt~~~RPssGsLlqi  223 (236)
T KOG4022         148 AAVHQLTSSLAAKDSGLPDGSAALTILPVTLDTPMNRKWMPNADFSSWTPLSFISEHFLKWTTETSRPSSGSLLQI  223 (236)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEE
T ss_conf             9999999876023369999842589863440686553457777666756379999999987526878888733899


No 234
>pfam07993 NAD_binding_4 Male sterility protein. This family represents the C-terminal region of the male sterility protein in a number of arabidopsis and drosophila. A sequence-related jojoba acyl CoA reductase is also included.
Probab=99.22  E-value=5.3e-09  Score=80.34  Aligned_cols=157  Identities=24%  Similarity=0.261  Sum_probs=107.7

Q ss_pred             EECCCCHHHHHHHHHHHHCCC--EEEEEECCH---HHHHHHHHHHHHC--------CCCEEEEECCCCCH------HHHH
Q ss_conf             938998688999999998899--899997898---9999999999864--------99289998789999------9999
Q gi|254780337|r   23 VTGSSRGIGYYTALELARSGA--YVIACGRSI---SQLEKLKNALQKI--------NKKIDIFAFDLRDS------NALE   83 (257)
Q Consensus        23 VTGas~GIG~a~a~~la~~G~--~Vi~~~r~~---~~l~~~~~~~~~~--------g~~~~~~~~Dv~d~------~~v~   83 (257)
                      ||||++=||..+.++|++.+.  +|+..-|..   ...+.+.+.+...        ..++.++..|++++      ++.+
T Consensus         1 vTGaTGFlG~~ll~~Ll~~~~~~~V~~LvR~~~~~~~~~r~~~~~~~~~~~~~~~~~~ri~~v~gDl~~~~lGL~~~~~~   80 (245)
T pfam07993         1 LTGATGFLGKVLLEKLLRSCPEVKIYCLVRAKDGESALERLRQELLKYGLFDRLKALERIIPVAGDLSEPNLGLSDEDFQ   80 (245)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCHHHCCCCEEEEECCCCCCCCCCCHHHHH
T ss_conf             93843599999999999579997899996789840589999999985675310103477799956168865798999999


Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC--CC
Q ss_conf             9999999981898799876875888888676599999999999989999999999999986089869997883564--78
Q gi|254780337|r   84 LTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAY--KC  161 (257)
Q Consensus        84 ~~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~--~~  161 (257)
                      .    +.   ..+|++||+|+.....        ..++...++|+.|+.++.+.+..    .+..+++.+||....  ..
T Consensus        81 ~----l~---~~vd~IiH~Aa~v~~~--------~~~~~~~~~NV~gt~~ll~~a~~----~~~~~~v~vSS~~~~~~~~  141 (245)
T pfam07993        81 E----LA---EEVDVIIHNAATVNFV--------EPYSDLRATNVLGTREVLRLAKQ----MKKLPFHHVSTAYVNGERG  141 (245)
T ss_pred             H----HH---HCCCEEEECCEEECCC--------CCHHHHHHHHHHHHHHHHHHHHH----CCCCEEEEEECCEECCCCC
T ss_conf             9----98---3599999874330356--------88899999999999999999997----6998599995816506677


Q ss_pred             ------------------CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCC
Q ss_conf             ------------------898368898999999999999998544386997553288379
Q gi|254780337|r  162 ------------------RPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRT  203 (257)
Q Consensus       162 ------------------~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T  203 (257)
                                        ......|..||+.-+.+.+..+     +|+.+..+.||.|--
T Consensus       142 ~~~~~~~~~~~~~~~~~~~~~~~~Y~~SK~~aE~lv~~~~-----~gl~~~I~Rp~~v~G  196 (245)
T pfam07993       142 GLLEEKPYPLDEDEPALLGGLPNGYTQSKWLAEQLVREAA-----GGLPVVIYRPSIITG  196 (245)
T ss_pred             CCCCCCCCCCCCCCHHCCCCCCCHHHHHHHHHHHHHHHHH-----CCCCEEEEECCEEEC
T ss_conf             8766656788876011036668828999999999999973-----329989996987865


No 235
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]
Probab=99.20  E-value=1.9e-09  Score=83.30  Aligned_cols=212  Identities=17%  Similarity=0.154  Sum_probs=142.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECC--HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             9999938998688999999998899--89999789--8999999999986499289998789999999999999999818
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGA--YVIACGRS--ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~--~Vi~~~r~--~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +.+||||+++=||....+...++.-  +|+..|+-  ...++.++....  .++..+++.|++|.+.+..++++-     
T Consensus         1 ~~iLVTGGaGFIGsnfvr~~~~~~~d~~v~~~DkLTYAgn~~~l~~~~~--~~~~~fv~~DI~D~~~v~~~~~~~-----   73 (340)
T COG1088           1 MKILVTGGAGFIGSNFVRYILNKHPDDHVVNLDKLTYAGNLENLADVED--SPRYRFVQGDICDRELVDRLFKEY-----   73 (340)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHC--CCCCEEEECCCCCHHHHHHHHHHC-----
T ss_conf             9379965751577899999996099752899752331577878886406--997158854554799999999744-----


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCH--HHC-----------CC
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883--564-----------78
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSG--AAY-----------KC  161 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~--~g~-----------~~  161 (257)
                      .+|.+||=|+-.. .    |-|.++=...+++|+.|++.+..++.++-.+   -+.+.||--  .|.           .+
T Consensus        74 ~~D~VvhfAAESH-V----DRSI~~P~~Fi~TNv~GT~~LLEaar~~~~~---frf~HISTDEVYG~l~~~~~~FtE~tp  145 (340)
T COG1088          74 QPDAVVHFAAESH-V----DRSIDGPAPFIQTNVVGTYTLLEAARKYWGK---FRFHHISTDEVYGDLGLDDDAFTETTP  145 (340)
T ss_pred             CCCEEEEECHHCC-C----CCCCCCHHHHHHCCHHHHHHHHHHHHHHCCC---CEEEEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             8875998110013-3----2233570553400028799999999984666---207994152102566678887544799


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECC----CCCCCH--HH----HHHCCCC---------CCCCCCCHH
Q ss_conf             8983688989999999999999985443869975532----883797--79----8441444---------324588889
Q gi|254780337|r  162 RPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP----GPTRTS--MR----AKAMPAE---------DPNTVPHPQ  222 (257)
Q Consensus       162 ~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~P----G~v~T~--m~----~~~~~~~---------~~~~~~~pe  222 (257)
                      ..-.++|+|||||-..|.+++...+   |+.++...+    |+-.-|  +.    ...+.+.         ....+..-|
T Consensus       146 ~~PsSPYSASKAasD~lVray~~TY---glp~~ItrcSNNYGPyqfpEKlIP~~I~nal~g~~lpvYGdG~~iRDWl~Ve  222 (340)
T COG1088         146 YNPSSPYSASKAASDLLVRAYVRTY---GLPATITRCSNNYGPYQFPEKLIPLMIINALLGKPLPVYGDGLQIRDWLYVE  222 (340)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHC---CCCEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEECCCCCEEEEEEEH
T ss_conf             9999974044556789999999871---9966984477776887671556679999997399985436985402058717


Q ss_pred             HHHHHHHHHHCHHHCCCCCEEEECCCCE
Q ss_conf             9999999961975626685798768763
Q gi|254780337|r  223 KVAKIISFLCATQKIETGKLFSVPQNRF  250 (257)
Q Consensus       223 diA~~v~fL~s~~~~~tG~~~~vdgG~~  250 (257)
                      |-++++-..+....  -|++++|.||.-
T Consensus       223 Dh~~ai~~Vl~kg~--~GE~YNIgg~~E  248 (340)
T COG1088         223 DHCRAIDLVLTKGK--IGETYNIGGGNE  248 (340)
T ss_pred             HHHHHHHHHHHCCC--CCCEEEECCCCC
T ss_conf             57889999995686--776687178752


No 236
>pfam05368 NmrA NmrA-like family. NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.
Probab=99.18  E-value=1.6e-08  Score=77.16  Aligned_cols=192  Identities=16%  Similarity=0.114  Sum_probs=120.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             99938998688999999998899899997898999999999986499289998789999999999999999818987998
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILI  100 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDilV  100 (257)
                      +|||||++-+|+.+++.|++.|++|.+..|+.++..  ..++...|  +..+..|+.|++++.+.++       .+|.++
T Consensus         1 IlV~GatG~iG~~vv~~L~~~g~~Vr~l~R~~~~~~--~~~l~~~g--ve~v~gD~~d~~sl~~al~-------gvd~v~   69 (232)
T pfam05368         1 ILVFGATGYQGGSVVRASLKAGHPVRALVRDPKSEL--AKSLKAAG--VELVEGDLDDHESLVEALK-------GVDVVF   69 (232)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHH--HHHHHHCC--CEEEEECCCCHHHHHHHHC-------CCCEEE
T ss_conf             099896828999999999858993899971873665--66664179--8899906888789999967-------998899


Q ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC----CCCCCHHHHHHHHHHH
Q ss_conf             768758888886765999999999999899999999999999860898699978835647----8898368898999999
Q gi|254780337|r  101 ANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK----CRPLWGAYSASKAAIE  176 (257)
Q Consensus       101 NNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~----~~~~~~~Y~asKaal~  176 (257)
                      +.++...  .       .+.+            ..+.++...++.+--++|. +|.....    +.....+|..+|+.+.
T Consensus        70 ~~~~~~~--~-------~~~~------------~~~~~~~AA~~aGVk~~V~-ss~~~~~~~~~~~~~~~~~~~~K~~~e  127 (232)
T pfam05368        70 SVTGFWL--S-------KEIE------------DGKKLADAAKEAGVKHFIP-SEFGNDVDRSNGVEPAVPHFDSKAEVE  127 (232)
T ss_pred             EECCCCC--C-------HHHH------------HHHHHHHHHHHCCCCCEEE-EEECCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             9158874--1-------7799------------9999999999739983455-550125545676665527889899999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH------CCCC-------C--CCC--CCCHHHHHHHHHHHHCHHHCCC
Q ss_conf             999999998544386997553288379779844------1444-------3--245--8888999999999619756266
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKA------MPAE-------D--PNT--VPHPQKVAKIISFLCATQKIET  239 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~------~~~~-------~--~~~--~~~pediA~~v~fL~s~~~~~t  239 (257)
                      ...+       ..++..+.+.||+..-.+....      ....       +  ...  +...+|+|.++..++....-..
T Consensus       128 ~~l~-------~~g~~~tilrp~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dva~~~~~~l~~p~~~~  200 (232)
T pfam05368       128 RYIR-------ALGIPYTFVYAGFFMGNFLSNLAPPGDLAPPRDKVTLLGPGNPKAVPLDDEEDIGTYVIKILDDPRKLK  200 (232)
T ss_pred             HHHH-------HHCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCEEEEEEHHHHHHHHHHHHCCHHHCC
T ss_conf             9999-------819985999684254301656544320257653699944898761126528899999999964912119


Q ss_pred             CCEEEECCCCEECC
Q ss_conf             85798768763154
Q gi|254780337|r  240 GKLFSVPQNRFVNY  253 (257)
Q Consensus       240 G~~~~vdgG~~~n~  253 (257)
                      |+.+.+. |..+++
T Consensus       201 ~~~~~~~-~~~lT~  213 (232)
T pfam05368       201 GKYIRPP-GNILSG  213 (232)
T ss_pred             CEEEEEC-CCCCCH
T ss_conf             9999828-986799


No 237
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888    The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group. The 4,6-dehydratase makes use of tightly bound NAD^+ as the coenzyme for transiently oxidizing the substrate, activating it for the dehydration step . This and other 4,6-dehydratases catalyze the first committed step in all 6-deoxysugar biosynthetic pathways described to date. Numerous 6-deoxysugars are used in bacterial lipopolysaccharide production as well as in the biosynthesis of a diverse array of secondary metabolites.; GO: 0008460 dTDP-glucose 46-dehydratase activity, 0009225 nucleotide-sugar metabolic process.
Probab=99.13  E-value=8.4e-09  Score=79.03  Aligned_cols=213  Identities=17%  Similarity=0.178  Sum_probs=145.6

Q ss_pred             EEEECCCCHHHHHHHHHHHH-CC-CEEEEEEC-----CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             99938998688999999998-89-98999978-----9899999999998649928999878999999999999999981
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELAR-SG-AYVIACGR-----SISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~-~G-~~Vi~~~r-----~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      +|||||++=||..+++...+ .+ ++|+..|.     +.+.|+.+.+     .++..|++.|++|.+.|+.++++.    
T Consensus         2 ~LVTGGaGFIGsnFvry~~~~~~D~~v~vlDkLTYAgn~e~L~~l~~-----~pr~~Fv~GDI~D~~lv~~~~~e~----   72 (340)
T TIGR01181         2 ILVTGGAGFIGSNFVRYILNEHPDAEVIVLDKLTYAGNLENLADLED-----NPRYRFVKGDIGDRELVDRLLKEH----   72 (340)
T ss_pred             CEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHC-----CCCEEEEECCCCHHHHHHHHHHHC----
T ss_conf             23632785256899999997479957998635445578655523323-----966156742302288998884001----


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH---HC-C-CCE-EEEECC--HHHC------
Q ss_conf             89879987687588888867659999999999998999999999999998---60-8-986-999788--3564------
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLK---KS-H-CGR-AIILSS--GAAY------  159 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~---~~-~-~G~-IInisS--~~g~------  159 (257)
                       .+|.+||=|+-.+ ..    -|.++=...+++|+.|+|.|.=++-+.-.   +. + .-| .+.||-  ..|.      
T Consensus        73 -~~D~VvhFAAESH-VD----RSI~~P~~F~~TNv~GT~tLLEA~R~~w~aL~e~~~a~~r~l~HiSTDEVYGdl~~~~~  146 (340)
T TIGR01181        73 -DPDAVVHFAAESH-VD----RSISGPEAFIETNVVGTYTLLEAVRKYWHALREAKKAGVRKLHHISTDEVYGDLEKGDP  146 (340)
T ss_pred             -CCCEEEECCCCCH-HH----HCCCCCHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCEEECCCCCCCC
T ss_conf             -7677886222052-33----30145411444033788999999974044566445131026357603014404678967


Q ss_pred             ------CCCCCCHHHHHHHHHHHHHHHHHHHHHH-HHCCEEEEECCCCCCCH------HHHHHCCCCC---------CCC
Q ss_conf             ------7889836889899999999999999854-43869975532883797------7984414443---------245
Q gi|254780337|r  160 ------KCRPLWGAYSASKAAIEALARTWSKETV-NTALRVINIDPGPTRTS------MRAKAMPAED---------PNT  217 (257)
Q Consensus       160 ------~~~~~~~~Y~asKaal~~lt~~la~E~~-~~gIrvn~I~PG~v~T~------m~~~~~~~~~---------~~~  217 (257)
                            .|..-.++|+|||||=..|.|++.+-|+ +.-|+=++=.-|+=.=|      |.-+++.+++         ...
T Consensus       147 ~~ftE~tpl~PsSPYSASKAasD~LVrAy~rTYGLp~~ITrCsNNYGPYQfpEKLIPl~I~nal~G~plPvYGdG~~vRD  226 (340)
T TIGR01181       147 ASFTETTPLAPSSPYSASKAASDLLVRAYHRTYGLPVLITRCSNNYGPYQFPEKLIPLMITNALAGKPLPVYGDGQQVRD  226 (340)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCEE
T ss_conf             34423278877872458898887898888875488605768855778756742013689999873899833017883203


Q ss_pred             CCCHHHHHHHHHHHHCHHHCCCCCEEEECCCCE
Q ss_conf             888899999999961975626685798768763
Q gi|254780337|r  218 VPHPQKVAKIISFLCATQKIETGKLFSVPQNRF  250 (257)
Q Consensus       218 ~~~pediA~~v~fL~s~~~~~tG~~~~vdgG~~  250 (257)
                      +.--+|=++++--.+  ++-..|++++|-||.-
T Consensus       227 WlyV~DHcrA~~~VL--~~G~~GE~YNIgg~~E  257 (340)
T TIGR01181       227 WLYVEDHCRAIELVL--EKGRVGEVYNIGGGNE  257 (340)
T ss_pred             EEEHHHHHHHHHHHH--HCCCCCCEEECCCCCC
T ss_conf             245234789999998--2695212564378762


No 238
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional
Probab=99.13  E-value=2.5e-08  Score=75.79  Aligned_cols=205  Identities=16%  Similarity=0.218  Sum_probs=120.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH--HHHCCC
Q ss_conf             9999389986889999999988998-9999789899999999998649928999878999999999999999--981898
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAY-VIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIA--KRWGKL   96 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~--~~~g~i   96 (257)
                      .+|||||++=||..+++.|.++|++ |++.+.-... .+.          ......|+.|..+.+.+...+.  ++|+.+
T Consensus         1 ~ILVTGgaGFIGS~l~~~L~~~G~~~V~~~Dnl~~~-~~~----------~~l~~~~~~d~~~~~~~~~~~~~~~~~~~i   69 (308)
T PRK11150          1 MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDG-TKF----------VNLVDLDIADYMDKEDFLAQIMAGDDFGDI   69 (308)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCC-CCC----------CCCCCCCCCHHCCHHHHHHHHHHCCCCCCC
T ss_conf             999940597999999999997799809999789997-313----------012356310120389999998611345787


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC--C---------CCC
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478--8---------983
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC--R---------PLW  165 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~--~---------~~~  165 (257)
                      |.++|-|+.... .   +.+.   ...++.|+.++.++...+    ++++. ++|+.||.+.+-.  .         .-.
T Consensus        70 d~V~Hlaa~~~~-~---~~~~---~~~~~~n~~~t~nll~~~----~~~~~-~~i~aSSs~vYG~~~~~~~~E~~~~~P~  137 (308)
T PRK11150         70 EAIFHEGACSST-T---EWDG---KYMMDNNYQYSKELLHYC----LEREI-PFLYASSAATYGGRTSDFIEEREYEKPL  137 (308)
T ss_pred             CEEEECCCCCCC-C---CCCC---CHHHHHHHHHHHHHHHHH----HHCCC-CEEEECCHHHHCCCCCCCCCCCCCCCCC
T ss_conf             689999866666-4---5565---113214999999999999----97499-8899547564089888986568889986


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH--CCEEEEE-CCCCC-CCH-------HHHHHCCCCC----------CCCCCCHHHH
Q ss_conf             688989999999999999985443--8699755-32883-797-------7984414443----------2458888999
Q gi|254780337|r  166 GAYSASKAAIEALARTWSKETVNT--ALRVINI-DPGPT-RTS-------MRAKAMPAED----------PNTVPHPQKV  224 (257)
Q Consensus       166 ~~Y~asKaal~~lt~~la~E~~~~--gIrvn~I-~PG~v-~T~-------m~~~~~~~~~----------~~~~~~pedi  224 (257)
                      .+|+.||.+...+.+.++.++.-.  .+|...+ -|+.- +.+       +..+....++          ...+..-+|+
T Consensus       138 s~Yg~sK~~~E~~~~~~~~~~~~~~~~lR~fnvYGP~~~~~~~~~~v~~~~~~~~~~g~~~~~~~G~g~~~RDfiyV~Dv  217 (308)
T PRK11150        138 NVYGYSKFLFDEYVRQILPEANSQICGFRYFNVYGPREGHKGSMASVAFHLNNQLNNGENPKLFEGSENFKRDFVYVGDV  217 (308)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCCCCEEEEEEEHHHH
T ss_conf             87676099999999999998399828987623789597888873207999999997799974753999878845778999


Q ss_pred             HHHHHHHHCHHHCCCCCEEEECCCCE
Q ss_conf             99999961975626685798768763
Q gi|254780337|r  225 AKIISFLCATQKIETGKLFSVPQNRF  250 (257)
Q Consensus       225 A~~v~fL~s~~~~~tG~~~~vdgG~~  250 (257)
                      +++...++  ++-.+| +++|-.|.-
T Consensus       218 ~~a~~~~~--~~~~~g-v~NiGsg~~  240 (308)
T PRK11150        218 AAVNLWFL--ENGVSG-IFNLGTGRA  240 (308)
T ss_pred             HHHHHHHH--HCCCCC-EEEECCCCC
T ss_conf             99999998--569987-499879996


No 239
>KOG1371 consensus
Probab=99.10  E-value=5.5e-09  Score=80.22  Aligned_cols=155  Identities=23%  Similarity=0.289  Sum_probs=115.6

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEC----CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             899999389986889999999988998999978----9899999999998649928999878999999999999999981
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGR----SISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r----~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ++.+|||||++=||..++.+|.+.|+.|++.|.    ..+.+..++..... +.++.++..|++|.+.++++|+..    
T Consensus         2 ~~~VLVtGgaGyiGsht~l~L~~~gy~v~~vDNl~n~~~~sl~r~~~l~~~-~~~v~f~~~Dl~D~~~L~kvF~~~----   76 (343)
T KOG1371           2 GKHVLVTGGAGYIGSHTVLALLKRGYGVVIVDNLNNSYLESLKRVRQLLGE-GKSVFFVEGDLNDAEALEKLFSEV----   76 (343)
T ss_pred             CCEEEEECCCCCEEHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCC-CCCEEEEEECCCCHHHHHHHHHHC----
T ss_conf             837999668763105999999867981799824332124677889986278-774389981566899999998633----


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-----C------C
Q ss_conf             8987998768758888886765999999999999899999999999999860898699978835647-----8------8
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK-----C------R  162 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~-----~------~  162 (257)
                       ++|-+++=|+.. ..+.-.+-+    .+.++.|+.|.+.+.    ..|++.+--.+|+.||..-+=     |      .
T Consensus        77 -~fd~V~Hfa~~~-~vgeS~~~p----~~Y~~nNi~gtlnlL----e~~~~~~~~~~V~sssatvYG~p~~vp~te~~~t  146 (343)
T KOG1371          77 -KFDAVMHFAALA-AVGESMENP----LSYYHNNIAGTLNLL----EVMKAHNVKALVFSSSATVYGLPTKVPITEEDPT  146 (343)
T ss_pred             -CCCEEEEEHHHH-CCCHHHHCC----HHHEEHHHHHHHHHH----HHHHHCCCCEEEEECCEEEECCCCEECCCCCCCC
T ss_conf             -886577624441-331566282----231002114689999----9999759864888423046347643203576877


Q ss_pred             C-CCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9-836889899999999999999854
Q gi|254780337|r  163 P-LWGAYSASKAAIEALARTWSKETV  187 (257)
Q Consensus       163 ~-~~~~Y~asKaal~~lt~~la~E~~  187 (257)
                      - -...|+.+|.++....+.+..-+.
T Consensus       147 ~~p~~pyg~tK~~iE~i~~d~~~~~~  172 (343)
T KOG1371         147 DQPTNPYGKTKKAIEEIIHDYNKAYG  172 (343)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             88888640136779997676531456


No 240
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886    Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5.1.3.2 from EC) interconverts UDP-glucose and UDP-galactose which are precursors of glucose- and galactose-containing exopolysaccharides (EPS). A set of related proteins, some of which are tentatively identified as UDP-glucose-4-epimerase in Thermotoga maritima, Bacillus halodurans, and several archaea, but deeply branched from this set and lacking experimental evidence, are excluded and described by a separate model. ; GO: 0003978 UDP-glucose 4-epimerase activity, 0006012 galactose metabolic process.
Probab=99.10  E-value=1.2e-09  Score=84.71  Aligned_cols=162  Identities=27%  Similarity=0.289  Sum_probs=116.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH-HHHHHHCCCCE
Q ss_conf             99938998688999999998899899997-89899999999998649928999878999999999999-99998189879
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKT-YIAKRWGKLDI   98 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~-r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~-~~~~~~g~iDi   98 (257)
                      +|||||++=||..++++|.+.|+.|++.| .+....+.+...-+-.|..+.+++.||.|.+.++++|+ +-.+  -+||-
T Consensus         2 iLVTGGAGYIGSHt~~~Ll~~G~ev~vlDNLs~G~~~~l~~~~~~~G~~~~fv~gDL~D~~~l~~~f~kqql~--~~idA   79 (341)
T TIGR01179         2 ILVTGGAGYIGSHTVRQLLESGYEVVVLDNLSNGSAEALKRGEEITGKEVTFVEGDLRDRELLRRVFEKQQLE--HKIDA   79 (341)
T ss_pred             EEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCEECCCCCEEEEECCHHHHHHHHHHHHHHHC--CCCCE
T ss_conf             2686146644358878876359728998157888488750023414853205871751579999998774311--67546


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC-------------CC
Q ss_conf             98768758888886765999999999999899999999999999860898699978835647889-------------83
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRP-------------LW  165 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~-------------~~  165 (257)
                      +||=||.. ..+-    |..+=-+-++=|+.+++.|++.+..+=.     .=+..||.++.-|.|             -.
T Consensus        80 ViHFAg~~-~VgE----Sv~~Pl~YY~NNv~nTl~L~~~m~~~GV-----~~~iFSSsAaVYG~p~~~Pi~E~~pl~~Pi  149 (341)
T TIGR01179        80 VIHFAGLI-AVGE----SVQKPLKYYRNNVVNTLNLLEAMQETGV-----KKFIFSSSAAVYGEPESIPISEDSPLGDPI  149 (341)
T ss_pred             EEEECCCC-CCHH----HHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCEEECCCCEEECCCCCCCCCCCCCCCCCC
T ss_conf             75201121-2525----5752454400046899999999998189-----741530421450778855502225677874


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             6889899999999999999854438699755
Q gi|254780337|r  166 GAYSASKAAIEALARTWSKETVNTALRVINI  196 (257)
Q Consensus       166 ~~Y~asKaal~~lt~~la~E~~~~gIrvn~I  196 (257)
                      .+|+.||..++.+=+-+++-  .++..+..+
T Consensus       150 nPYG~sKlM~E~iL~D~~~a--~~~~~~v~L  178 (341)
T TIGR01179       150 NPYGRSKLMVERILRDLSKA--DPDLSYVIL  178 (341)
T ss_pred             CCCCCCHHHHHHHHHHHHHH--CCCCCEEEE
T ss_conf             86655668899999999873--876779985


No 241
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445    This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria. Members are typically encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate CDP-D-glucose. This is used by the proteins in this entry to produce CDP-4-keto-6-deoxyglucose..
Probab=99.09  E-value=1.2e-09  Score=84.68  Aligned_cols=172  Identities=21%  Similarity=0.232  Sum_probs=129.9

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE------EEEECCCCCHHHHHHHHHHH
Q ss_conf             488999993899868899999999889989999789899999999998649928------99987899999999999999
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI------DIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~------~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      .+||.|||||=|+==|.=+..-|.+.||.|.-.+.+++.-..+-+.++- ..+.      ..+..|++|.+.++++++++
T Consensus         2 w~gKkVl~TGHTGFKGSWL~lWL~~lGA~V~GYSL~P~t~PnlFe~l~l-~~~~~~~Wyf~~~~gDIrD~~~L~~~~~~~   80 (361)
T TIGR02622         2 WQGKKVLITGHTGFKGSWLSLWLLELGAEVAGYSLDPPTSPNLFELLNL-AKKIKDSWYFSSIFGDIRDAAKLEKAIAEF   80 (361)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHH-HHHHHCCEEEEEEEECCCCHHHHHHHHHHC
T ss_conf             5686789845786425589999984796798971688788405557525-424323505542330323278999999972


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCH---------HHCC
Q ss_conf             9981898799876875888888676599999999999989999999999999986089869997883---------5647
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSG---------AAYK  160 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~---------~g~~  160 (257)
                           ++||+.|=|+     .|+-..|++|=..+|+||++|++++. .+++..  ..--.+|+|+|=         .|++
T Consensus        81 -----~PeIvFHlAA-----QPLVr~SY~~P~~Tf~TNVmGT~~lL-ea~r~~--~~~~a~v~vTsDK~Y~N~EW~wgYR  147 (361)
T TIGR02622        81 -----KPEIVFHLAA-----QPLVRKSYADPLETFETNVMGTVNLL-EAIRAI--KSVKAVVLVTSDKVYENKEWVWGYR  147 (361)
T ss_pred             -----CCCEEEHHHH-----HHHHHHHHHCHHHHEEEHHHHHHHHH-HHHHHC--CCCEEEEEEECCEEECCCCCCCCCC
T ss_conf             -----8989833354-----27889867320202220032225778-899746--9956999861672330787887523


Q ss_pred             ---CCCCCHHHHHHHHHHHHHHHHHHHHHHH-------HCCEEEEECCCCC
Q ss_conf             ---8898368898999999999999998544-------3869975532883
Q gi|254780337|r  161 ---CRPLWGAYSASKAAIEALARTWSKETVN-------TALRVINIDPGPT  201 (257)
Q Consensus       161 ---~~~~~~~Y~asKaal~~lt~~la~E~~~-------~gIrvn~I~PG~v  201 (257)
                         +.-|.=+|++|||+-+-.+.+.+.-|-.       |+|.+=+.-=|=|
T Consensus       148 E~D~LGGhDPYS~SKAcAELv~~syR~SF~~~~~f~~~h~~~iAsaRAGNV  198 (361)
T TIGR02622       148 ETDPLGGHDPYSSSKACAELVIASYRSSFFGEANFQSTHGIKIASARAGNV  198 (361)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCC
T ss_conf             247887716775328999999999986068888755468636899860640


No 242
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]
Probab=99.08  E-value=4.7e-08  Score=73.99  Aligned_cols=192  Identities=18%  Similarity=0.165  Sum_probs=129.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             99938998688999999998899899997898999999999986499289998789999999999999999818987998
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILI  100 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDilV  100 (257)
                      +||||+++=+|.++.+.|. .+..|+.++|..                     +|++|++.+.+++.+.     ++|++|
T Consensus         3 iLi~G~~GqLG~~L~~~l~-~~~~v~a~~~~~---------------------~Ditd~~~v~~~i~~~-----~PDvVI   55 (281)
T COG1091           3 ILITGANGQLGTELRRALP-GEFEVIATDRAE---------------------LDITDPDAVLEVIRET-----RPDVVI   55 (281)
T ss_pred             EEEECCCCHHHHHHHHHHC-CCCEEEECCCCC---------------------CCCCCHHHHHHHHHHH-----CCCEEE
T ss_conf             8997698767999999717-784399515765---------------------5556858999999861-----999899


Q ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCC-----------CCHHHH
Q ss_conf             768758888886765999999999999899999999999999860898699978835647889-----------836889
Q gi|254780337|r  101 ANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRP-----------LWGAYS  169 (257)
Q Consensus       101 NNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~-----------~~~~Y~  169 (257)
                      |+|+.. ... -.|   .+-+..+.||..|+-++.+++-..     +-.+|.||+-....|..           -...|+
T Consensus        56 n~AAyt-~vD-~aE---~~~e~A~~vNa~~~~~lA~aa~~~-----ga~lVhiSTDyVFDG~~~~~Y~E~D~~~P~nvYG  125 (281)
T COG1091          56 NAAAYT-AVD-KAE---SEPELAFAVNATGAENLARAAAEV-----GARLVHISTDYVFDGEKGGPYKETDTPNPLNVYG  125 (281)
T ss_pred             ECCCCC-CCC-CCC---CCHHHHHHHHHHHHHHHHHHHHHH-----CCEEEEEECCEEECCCCCCCCCCCCCCCCHHHHH
T ss_conf             873203-654-133---898997776779999999999971-----9769996344574389898887789999702454


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCC----HHHHHHCCCCCC----CCCC---CHHHHHHHHHHHHCHHHCC
Q ss_conf             8999999999999998544386997553288379----779844144432----4588---8899999999961975626
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRT----SMRAKAMPAEDP----NTVP---HPQKVAKIISFLCATQKIE  238 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T----~m~~~~~~~~~~----~~~~---~pediA~~v~fL~s~~~~~  238 (257)
                      -||.+-+...+...   ..+=|.-++...|.-.-    .|.+.....++.    +.++   ..+|+|+++.-|+...  .
T Consensus       126 ~sKl~GE~~v~~~~---~~~~I~Rtswv~g~~g~nFv~tml~la~~~~~l~vv~Dq~gsPt~~~dlA~~i~~ll~~~--~  200 (281)
T COG1091         126 RSKLAGEEAVRAAG---PRHLILRTSWVYGEYGNNFVKTMLRLAKEGKELKVVDDQYGSPTYTEDLADAILELLEKE--K  200 (281)
T ss_pred             HHHHHHHHHHHHHC---CCEEEEEEEEEECCCCCCHHHHHHHHHHCCCCEEEECCEEECCCCHHHHHHHHHHHHHCC--C
T ss_conf             77897899999739---987999856554588877899999985059926997984538746999999999998345--5


Q ss_pred             CCCEEEECCCCEECCC
Q ss_conf             6857987687631543
Q gi|254780337|r  239 TGKLFSVPQNRFVNYL  254 (257)
Q Consensus       239 tG~~~~vdgG~~~n~~  254 (257)
                      .+.++++-+....+|+
T Consensus       201 ~~~~yH~~~~g~~Swy  216 (281)
T COG1091         201 EGGVYHLVNSGECSWY  216 (281)
T ss_pred             CCCEEEEECCCCCCHH
T ss_conf             5867998079741199


No 243
>COG4982 3-oxoacyl-[acyl-carrier protein]
Probab=99.04  E-value=5.9e-08  Score=73.37  Aligned_cols=234  Identities=16%  Similarity=0.157  Sum_probs=151.3

Q ss_pred             ECCCCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEE-C-CHHHHHHHHHHHH---HCCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             5248899999389986-88999999998899899997-8-9899999999998---649928999878999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRG-IGYYTALELARSGAYVIACG-R-SISQLEKLKNALQ---KINKKIDIFAFDLRDSNALELTKT   87 (257)
Q Consensus        14 ~~l~~K~alVTGas~G-IG~a~a~~la~~G~~Vi~~~-r-~~~~l~~~~~~~~---~~g~~~~~~~~Dv~d~~~v~~~~~   87 (257)
                      ..+.+|++|||||+.| ||.+++.+|+.-|++||++. | ++++.+=-+..+.   .+|.....++++.++..+|+++++
T Consensus       392 ~~y~d~valVTGA~~gSIaa~Vv~~LL~gGAtVI~TTS~~s~~r~efyr~LYa~~a~~ga~LwvVpaN~~SysDVdAlIe  471 (866)
T COG4982         392 GTYGDKVALVTGASKGSIAAAVVARLLAGGATVIATTSRLSEERTEFYRSLYARHARYGAALWVVPANMGSYSDVDALIE  471 (866)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             87456269981688752699999999708967999734211889999999998617788439998356554230899999


Q ss_pred             HHHHHHC--------------CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEE
Q ss_conf             9999818--------------9879987687588888867659999999999998999999999999998608-986999
Q gi|254780337|r   88 YIAKRWG--------------KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAII  152 (257)
Q Consensus        88 ~~~~~~g--------------~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IIn  152 (257)
                      ++-++-.              .+|.++-=|.+- ..+.+.+... .-+..+.|-|....+++-.+.+.-.+++ .+|.-.
T Consensus       472 wIg~eq~~t~g~~s~~~k~a~~ptll~PFAAp~-v~G~l~~ags-raE~~~rilLw~V~Rliggl~~~~s~r~v~~R~hV  549 (866)
T COG4982         472 WIGDEQTETVGPQSIHIKLAWTPTLLFPFAAPR-VSGELADAGS-RAEFAMRILLWNVLRLIGGLKKQGSSRGVDTRLHV  549 (866)
T ss_pred             HHCCCCCCCCCCCCEECCCCCCCCEEEECCCCC-CCCCCCCCCC-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             860334013477511124566754464335677-6675034772-67889999999999999876541222576652489


Q ss_pred             ECCHHHCCCCC-CCHHHHHHHHHHHHHHHHHHHHH-HHHCCEEEEECCCCCC-CHHHHH--H-CCCCCC--CCCCCHHHH
Q ss_conf             78835647889-83688989999999999999985-4438699755328837-977984--4-144432--458888999
Q gi|254780337|r  153 LSSGAAYKCRP-LWGAYSASKAAIEALARTWSKET-VNTALRVINIDPGPTR-TSMRAK--A-MPAEDP--NTVPHPQKV  224 (257)
Q Consensus       153 isS~~g~~~~~-~~~~Y~asKaal~~lt~~la~E~-~~~gIrvn~I~PG~v~-T~m~~~--~-~~~~~~--~~~~~pedi  224 (257)
                      |--++-.+++. +-++|+-||.|+..+..-+..|- +...+.+.--.-||++ |.+...  . .+....  -+.-.++|+
T Consensus       550 VLPgSPNrG~FGgDGaYgEsK~aldav~~RW~sEs~Wa~~vsl~~A~IGWtrGTGLMg~Ndiiv~aiEk~GV~tyS~~Em  629 (866)
T COG4982         550 VLPGSPNRGMFGGDGAYGESKLALDAVVNRWHSESSWAARVSLAHALIGWTRGTGLMGHNDIIVAAIEKAGVRTYSTDEM  629 (866)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHEEEECCCCCCCCCCHHHHHHHHHCCEECCHHHH
T ss_conf             81489887763787512467888999998750410156777775430122214455577616578799728550478899


Q ss_pred             HHHHHHHHCHHHC--CCCC--EEEECCCC
Q ss_conf             9999996197562--6685--79876876
Q gi|254780337|r  225 AKIISFLCATQKI--ETGK--LFSVPQNR  249 (257)
Q Consensus       225 A~~v~fL~s~~~~--~tG~--~~~vdgG~  249 (257)
                      |.-++-|||.+..  ....  ....+||.
T Consensus       630 A~~LLgL~saev~e~a~~~PI~aDLtGGL  658 (866)
T COG4982         630 AFNLLGLASAEVVELAASSPITADLTGGL  658 (866)
T ss_pred             HHHHHHHCCHHHHHHHHCCCEEEECCCCC
T ss_conf             99998630689999875398676346762


No 244
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]
Probab=99.03  E-value=1.1e-08  Score=78.31  Aligned_cols=154  Identities=23%  Similarity=0.257  Sum_probs=109.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9999938998688999999998899899997898-999999999986499289998789999999999999999818987
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSI-SQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~-~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      .++||||+++=||..++.+|++.|+.|++.|.-. ...+.+.. .     +..++..|+.|.+.++++|++-     ++|
T Consensus         1 ~~iLVtGGAGYIGSHtv~~Ll~~G~~vvV~DNL~~g~~~~v~~-~-----~~~f~~gDi~D~~~L~~vf~~~-----~id   69 (329)
T COG1087           1 MKVLVTGGAGYIGSHTVRQLLKTGHEVVVLDNLSNGHKIALLK-L-----QFKFYEGDLLDRALLTAVFEEN-----KID   69 (329)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHH-C-----CCCEEEECCCCHHHHHHHHHHC-----CCC
T ss_conf             9299965865468999999997898489995688788888602-0-----4856883343199999999864-----998


Q ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCC------------C
Q ss_conf             9987687588888867659999999999998999999999999998608986999788356478898------------3
Q gi|254780337|r   98 ILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL------------W  165 (257)
Q Consensus        98 ilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~------------~  165 (257)
                      .+||-||-. ..+.    |.++=-+-++-|+.|+..|.++    |++.+--.+| .||.++..|.|.            .
T Consensus        70 aViHFAa~~-~VgE----Sv~~Pl~Yy~NNv~gTl~Ll~a----m~~~gv~~~v-FSStAavYG~p~~~Pi~E~~~~~p~  139 (329)
T COG1087          70 AVVHFAASI-SVGE----SVQNPLKYYDNNVVGTLNLIEA----MLQTGVKKFI-FSSTAAVYGEPTTSPISETSPLAPI  139 (329)
T ss_pred             EEEECCCCC-CCCH----HHHCHHHHHHHCHHHHHHHHHH----HHHHCCCEEE-EECCCHHCCCCCCCCCCCCCCCCCC
T ss_conf             899873004-3234----4418788886030869999999----9982997699-9243010389987664788888998


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEE
Q ss_conf             6889899999999999999854438699755
Q gi|254780337|r  166 GAYSASKAAIEALARTWSKETVNTALRVINI  196 (257)
Q Consensus       166 ~~Y~asKaal~~lt~~la~E~~~~gIrvn~I  196 (257)
                      .+|+.||..++.+-+.+++-..   .++..+
T Consensus       140 NPYG~sKlm~E~iL~d~~~a~~---~~~v~L  167 (329)
T COG1087         140 NPYGRSKLMSEEILRDAAKANP---FKVVIL  167 (329)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCC---CCEEEE
T ss_conf             8531579999999999987169---728999


No 245
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=98.98  E-value=1.3e-07  Score=71.08  Aligned_cols=189  Identities=14%  Similarity=0.113  Sum_probs=119.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      |+|||||++-||++++++|.+.|..|....|+.+++..         .....+..|+.|+++.+..+.....-.+.+|.+
T Consensus         1 TIlVtGATG~iG~~v~~~L~~~g~~v~~~~R~~~~~~~---------~~~~~v~~d~~d~~~~~~a~~~~d~~~~~v~~v   71 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQAASVPFLVASRSSSSSAG---------PNEKHVKFDWLDEDTWDNPFSSDDGMEPEISAV   71 (285)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHCCC---------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             98999899818999999998689978999588566466---------667536864448114888976353231274189


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             87687588888867659999999999998999999999999998608986999788356478898368898999999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALA  179 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt  179 (257)
                      .....-    .+    +..+              ..+.+...-++.+-.+||.+|+.....+.+..+     +  ++   
T Consensus        72 ~l~~p~----~~----~~~~--------------~~~~~i~aA~~aGV~~iV~lS~~~~~~~~~~~~-----~--~~---  119 (285)
T TIGR03649        72 YLVAPP----IP----DLAP--------------PMIKFIDFARSKGVRRFVLLSASIIEKGGPAMG-----Q--VH---  119 (285)
T ss_pred             EECCCC----CC----CHHH--------------HHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCH-----H--HH---
T ss_conf             983899----87----7678--------------999999999984998899983035667986103-----8--99---


Q ss_pred             HHHHHHHHHHCCEEEEECCCCCCCHHH----HHHC-------C--CCCCCCCCCHHHHHHHHHHHHCHHHCCCCCEEEEC
Q ss_conf             999998544386997553288379779----8441-------4--44324588889999999996197562668579876
Q gi|254780337|r  180 RTWSKETVNTALRVINIDPGPTRTSMR----AKAM-------P--AEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP  246 (257)
Q Consensus       180 ~~la~E~~~~gIrvn~I~PG~v~T~m~----~~~~-------~--~~~~~~~~~pediA~~v~fL~s~~~~~tG~~~~vd  246 (257)
                      +.+.   ...|+..+.+-|++....+.    ....       .  ....-.+..++|||++..-++.+... .|+.+.+-
T Consensus       120 ~~~~---~~sg~~~tiLRp~~fm~N~~~~~~~~~i~~~g~~~~~~gd~~~~~V~~~DiA~vaa~~L~~~~~-~~~~~~lt  195 (285)
T TIGR03649       120 AHLD---SLGGVEYTVLRPTWFMENFSEEFHVEAIRKENKIYSATGDGKIPFVSADDIARVAYRALTDKVA-PNTDYVVL  195 (285)
T ss_pred             HHHH---HHCCCCEEEEECHHHHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCC-CCCEEEEE
T ss_conf             9999---7369976999663998750566658999748978444788775735587899999999749776-89779986


Q ss_pred             CCCEECC
Q ss_conf             8763154
Q gi|254780337|r  247 QNRFVNY  253 (257)
Q Consensus       247 gG~~~n~  253 (257)
                      |.+-+++
T Consensus       196 Gpe~lt~  202 (285)
T TIGR03649       196 GPELLTY  202 (285)
T ss_pred             CCCCCCH
T ss_conf             8865799


No 246
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=98.92  E-value=3.5e-09  Score=81.53  Aligned_cols=85  Identities=25%  Similarity=0.373  Sum_probs=70.6

Q ss_pred             CCEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             732652488999993899868899999999889989999789899999999998-6499289998789999999999999
Q gi|254780337|r   10 SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAFDLRDSNALELTKTY   88 (257)
Q Consensus        10 ~~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~-~~g~~~~~~~~Dv~d~~~v~~~~~~   88 (257)
                      ++|..+|+||+++|+|++++||+++|+.|+++|++|++++|+.++++++.+++. .++..  ....+.++.++....+  
T Consensus        20 ~~~g~dl~g~~~~V~G~tG~vG~~~A~~lA~~Ga~v~lv~R~~ek~~~~a~~i~~r~g~~--~~~~~~~~~~~~~~~l--   95 (194)
T cd01078          20 ELMGKDLKGKTAVVLGGTGPVGQRAAVLLAREGARVVLVGRDLERAQKAADSLRARFGEG--VGAVETSDDAARAAAI--   95 (194)
T ss_pred             HHHCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCC--CCCCCCCCHHHHHHHH--
T ss_conf             982998679889998588578999999999839979999587888999999999970987--3113578877899774--


Q ss_pred             HHHHHCCCCEEEECC
Q ss_conf             999818987998768
Q gi|254780337|r   89 IAKRWGKLDILIANA  103 (257)
Q Consensus        89 ~~~~~g~iDilVNNA  103 (257)
                           ...|+++..+
T Consensus        96 -----~~adiV~~a~  105 (194)
T cd01078          96 -----KGADVVFAAG  105 (194)
T ss_pred             -----CCCCEEEECC
T ss_conf             -----6698999642


No 247
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional
Probab=98.86  E-value=1.8e-07  Score=70.07  Aligned_cols=199  Identities=16%  Similarity=0.151  Sum_probs=124.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      .+||||+++=+|+++.+.|...| ++...+++..+.                 ..|++|++++++.++..     ++|++
T Consensus         2 kILvtGa~GqLG~~l~~~l~~~~-~~~~~~~~~~~~-----------------~~Dit~~~~v~~~~~~~-----~Pd~I   58 (299)
T PRK09987          2 NILLFGKTGQVGWELQRALAPLG-NLIALDVHSTDY-----------------CGDFSNPEGVAETVRKI-----RPDVI   58 (299)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCC-CEEEEECCCCCC-----------------CCCCCCHHHHHHHHHHC-----CCCEE
T ss_conf             79998999978999999866509-889985263001-----------------36789999999999965-----99999


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC---C--------CCHHH
Q ss_conf             876875888888676599999999999989999999999999986089869997883564788---9--------83688
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCR---P--------LWGAY  168 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~---~--------~~~~Y  168 (257)
                      ||+|+.+ ... -.   +++.+..+.+|..++-++.+.+...     +.++|.+|+-..+.|.   |        -...|
T Consensus        59 IN~aA~T-~VD-~~---E~~~~~a~~vN~~~~~~La~~~~~~-----~~~lIhiSTD~VFdG~~~~pY~E~d~~~P~n~Y  128 (299)
T PRK09987         59 VNAAAHT-AVD-KA---ESEPEFAQLLNATSVEAIAKAANEV-----GAWVVHYSTDYVFPGTGDIPWQETDATAPLNVY  128 (299)
T ss_pred             EECHHHC-CHH-HH---HCCHHHHHHHHHHHHHHHHHHHHHC-----CCEEEEECCCEEECCCCCCCCCCCCCCCCCHHH
T ss_conf             9883101-636-65---2489999998889999999999973-----985999632116068999899999988963689


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCC---CHHHHHHCCCCC----CCCCCCH---HHHHHHHHHHHCH---H
Q ss_conf             9899999999999999854438699755328837---977984414443----2458888---9999999996197---5
Q gi|254780337|r  169 SASKAAIEALARTWSKETVNTALRVINIDPGPTR---TSMRAKAMPAED----PNTVPHP---QKVAKIISFLCAT---Q  235 (257)
Q Consensus       169 ~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~---T~m~~~~~~~~~----~~~~~~p---ediA~~v~fL~s~---~  235 (257)
                      +-||.+-+...+......  -=+|++-+.-+.-+   +-|.........    .+.++.|   .++|+.+..++.-   .
T Consensus       129 G~sKl~GE~~v~~~~~~~--~IlRtswl~~~~g~nFv~~il~~~~~~~~l~vv~Dq~gsPT~~~~la~~~~~~i~~~~~~  206 (299)
T PRK09987        129 GETKLAGEKALQDNCAKH--LIFRTSWVYAGKGNNFAKTMLRLAKEREELSVINDQFGAPTGAELLADCTAHAIRVALNK  206 (299)
T ss_pred             HHHHHHHHHHHHHCCCCE--EEEEEEEEECCCCCCHHHHHHHHHHCCCCCEEECCEECCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             899999899999628740--885147886478987999999998739987135574589746999999999999997358


Q ss_pred             HCCCCCEEEECCCCEECCC
Q ss_conf             6266857987687631543
Q gi|254780337|r  236 KIETGKLFSVPQNRFVNYL  254 (257)
Q Consensus       236 ~~~tG~~~~vdgG~~~n~~  254 (257)
                      ....| ++++-+.-..+|+
T Consensus       207 ~~~~G-iyH~~~~g~~S~y  224 (299)
T PRK09987        207 PEVAG-LYHLVAGGTTTWH  224 (299)
T ss_pred             CCCCC-EEEECCCCCCCHH
T ss_conf             75567-1560499884899


No 248
>TIGR01746 Thioester-redct thioester reductase domain; InterPro: IPR010080   This domain includes the C-terminal domain from the fungal alpha aminoadipate reductase enzyme (also known as aminoadipate semialdehyde dehydrogenase) which is involved in the biosynthesis of lysine , as well as the reductase-containing component of the myxochelin biosynthetic gene cluster, MxcG . The mechanism of reduction involves activation of the substrate by adenylation and transfer to a covalently-linked pantetheine cofactor as a thioester. This thioester is then reduced to give an aldehyde (thus releasing the product) and a regenerated pantetheine thiol ; in myxochelin biosynthesis this aldehyde is further reduced to an alcohol or converted to an amine by an aminotransferase. This is a fundamentally different reaction than beta-ketoreductase domains of polyketide synthases which act at a carbonyl two carbons removed from the thioester and forms an alcohol as a product. The majority of bacterial sequences containing this domain are non-ribosomal peptide synthetases in which this domain is similarly located proximal to a thiolation domain (IPR006163 from INTERPRO). In some cases this domain is found at the end of a polyketide synthetase enzyme, but is unlike ketoreductase domains which are found before the thiolase domains. Exceptions to this observed relationship with the thiolase domain include three proteins which consist of stand-alone reductase domains (from Mycobacterium leprae, Anabaena and from Streptomyces coelicolor) and one protein (from Nostoc) which contains N-terminal homology with a small group of hypothetical proteins but no evidence of a thiolation domain next to the putative reductase domain.; GO: 0004043 L-aminoadipate-semialdehyde dehydrogenase activity.
Probab=98.80  E-value=4.3e-07  Score=67.60  Aligned_cols=216  Identities=24%  Similarity=0.298  Sum_probs=147.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCC----CEEEEEEC-C--HH-HHHHHHHHHH--HCC---------CCEEEEECCCCCHH
Q ss_conf             99993899868899999999889----98999978-9--89-9999999998--649---------92899987899999
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSG----AYVIACGR-S--IS-QLEKLKNALQ--KIN---------KKIDIFAFDLRDSN   80 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G----~~Vi~~~r-~--~~-~l~~~~~~~~--~~g---------~~~~~~~~Dv~d~~   80 (257)
                      ++|+||||+=+|..+.++|.+..    ++|+..=| -  ++ ..+.+.+.++  ++.         .++.++..|++.|.
T Consensus         1 ~vlLTGAtGfLG~~ll~~Ll~~~~s~~~~v~CLVRva~~~~~A~~RL~~~~~Gd~~~l~~~~~~~~~Ri~~~~GDl~~p~   80 (405)
T TIGR01746         1 TVLLTGATGFLGAYLLEELLRRNDSTEAKVICLVRVAKSEEHAMERLREALRGDSYRLWQEDLASIERIEVVAGDLSKPR   80 (405)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCCEEEEECCCCCCC
T ss_conf             95873362678999999997204886405687775149879999999851684223322333331136058868746666


Q ss_pred             H-HHH-HHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCE-EEEECCHH
Q ss_conf             9-999-99999998189879987687588888867659999999999998999999999999998608986-99978835
Q gi|254780337|r   81 A-LEL-TKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGR-AIILSSGA  157 (257)
Q Consensus        81 ~-v~~-~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~-IInisS~~  157 (257)
                      = +.. -++...-.-..+|.+||||+..+.+.        +|+++-..|+.|+..+.|.+..+     .++ .++|||.+
T Consensus        81 lGL~~~~~~~L~Gqs~~~D~i~HngA~Vn~~~--------pY~~Lr~~NV~Gt~~~L~L~~~~-----~~kpl~yvSt~~  147 (405)
T TIGR01746        81 LGLSEAEWERLAGQSENVDTIVHNGALVNWVY--------PYEELRAANVLGTREVLRLAASG-----RAKPLHYVSTIS  147 (405)
T ss_pred             CCCCHHHHHHCCCCCEECCEEEECCEEECCCC--------CHHHHHHHCCHHHHHHHHHHHCC-----CCCEEEEECCHH
T ss_conf             78871677324777300386783641422326--------82665210212599999996158-----985168852400


Q ss_pred             HCCC----------------------CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCC----C--------
Q ss_conf             6478----------------------89836889899999999999999854438699755328837----9--------
Q gi|254780337|r  158 AYKC----------------------RPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTR----T--------  203 (257)
Q Consensus       158 g~~~----------------------~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~----T--------  203 (257)
                      ....                      ....+.|+.||+.-+.+.+-.....-.+|+.|+.+-||.|-    |        
T Consensus       148 v~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~GY~~SKwvaE~lv~~A~~~~PadGl~v~i~RpG~i~g~s~~G~~n~~D~  227 (405)
T TIGR01746       148 VLAAIDLSGGKEEEDVTEDDATVTAPPGLAGGYAQSKWVAELLVREASDRLPADGLPVTIYRPGRILGDSETGAINTSDI  227 (405)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCEECCCCCCCCCCCHH
T ss_conf             02534367887636762046001267766787303499999999998873774557357982751341633673535308


Q ss_pred             -------HHHHH--HCCCCCC------CCCCCHHHHHHHHHHHHCHH-H--CCCCCEEEECCC
Q ss_conf             -------77984--4144432------45888899999999961975-6--266857987687
Q gi|254780337|r  204 -------SMRAK--AMPAEDP------NTVPHPQKVAKIISFLCATQ-K--IETGKLFSVPQN  248 (257)
Q Consensus       204 -------~m~~~--~~~~~~~------~~~~~pediA~~v~fL~s~~-~--~~tG~~~~vdgG  248 (257)
                             -|.-.  ..|..+.      ..+..-+.+|++|..+.+.- +  ..-|+++++.++
T Consensus       228 l~r~v~~~~~~G~l~~P~~~~Nrqr~~~~~~pVd~~a~ai~~~~~~~~~~~~~~~~~~~l~~~  290 (405)
T TIGR01746       228 LWRMVKGCLELGDLAYPQLDENRQRLTEDLTPVDYVARAIVALSSQPAAEAQAGGAVFHLVNP  290 (405)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             889999987440000466611012133223109999999999998764643277217872289


No 249
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase. Members of this protein family are L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31), product of the LYS2 gene. It is also called alpha-aminoadipate reductase. In fungi, lysine is synthesized via aminoadipate. Currently, all members of this family are fungal.
Probab=98.76  E-value=1.8e-06  Score=63.46  Aligned_cols=215  Identities=19%  Similarity=0.227  Sum_probs=137.9

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHC----CCEEEEEECC--H-HHHHHHHHHHHHCC-------CCEEEEECCCCCHHH-
Q ss_conf             8899999389986889999999988----9989999789--8-99999999998649-------928999878999999-
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARS----GAYVIACGRS--I-SQLEKLKNALQKIN-------KKIDIFAFDLRDSNA-   81 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~----G~~Vi~~~r~--~-~~l~~~~~~~~~~g-------~~~~~~~~Dv~d~~~-   81 (257)
                      +.+++|+|||++=+|..+-++|++.    .++|+..-|.  + +..+.+.+.++.++       .++..+..|++.+.- 
T Consensus       970 ~~~~VlLTGATGFLG~~lL~~LL~~~~~~~~~v~cLVRa~~~~~a~~Rl~~~~~~y~lw~~~~~~Ri~v~~GDLs~p~LG 1049 (1389)
T TIGR03443       970 TPITVFLTGATGFLGSFILRDLLTRRSNSNFKVFAHVRAKSEEAGLERLRKTGTTYGIWDEEWASRIEVVLGDLSKEKFG 1049 (1389)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCHHCCCCEEEECCCCCCCCCC
T ss_conf             99879993876188999999998287878538999967898788999999999871886310115779981777874689


Q ss_pred             H-HHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC
Q ss_conf             9-999999999818987998768758888886765999999999999899999999999999860898699978835647
Q gi|254780337|r   82 L-ELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK  160 (257)
Q Consensus        82 v-~~~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~  160 (257)
                      + +.-++...   ..+|++|||++...-..        .|...-..|+.|+..+.+.+...    +.-.+-+|||.+..-
T Consensus      1050 Ls~~~~~~La---~~vD~IiHngA~Vn~~~--------pY~~Lr~aNV~gT~elLrla~~g----r~k~~h~vST~sv~~ 1114 (1389)
T TIGR03443      1050 LSDEKWSDLT---NEVDVIIHNGALVHWVY--------PYSKLRDANVIGTINVLNLCAEG----KAKQFSFVSSTSALD 1114 (1389)
T ss_pred             CCHHHHHHHH---HHCCEEEECCCEECCCC--------CHHHHHHCCCHHHHHHHHHHHCC----CCCEEEEEECHHHCC
T ss_conf             6999999998---41699997893534676--------68887544227899999998569----997069971210068


Q ss_pred             C-----------------CC-----------CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCC----CCH----
Q ss_conf             8-----------------89-----------83688989999999999999985443869975532883----797----
Q gi|254780337|r  161 C-----------------RP-----------LWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT----RTS----  204 (257)
Q Consensus       161 ~-----------------~~-----------~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v----~T~----  204 (257)
                      +                 .+           ....|+-||+.-+.+.+..    +.+|+.|+..-||.|    .|.    
T Consensus      1115 ~~~~~~~~~~~~~~g~~~~~E~d~l~~~~~~l~~GY~qSKWvaE~lv~~A----~~rGlpv~I~RpG~I~G~s~tG~~n~ 1190 (1389)
T TIGR03443      1115 TEYYVNLSDELVQAGGAGIPESDDLMGSSKGLGTGYGQSKWVAEYIIREA----GKRGLRGCIVRPGYVTGDSKTGATNT 1190 (1389)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH----HHCCCCEEEECCCCCCCCCCCCCCCH
T ss_conf             75434432101135777888776554542225774388899999999999----96699889977753501688788777


Q ss_pred             --HHHHH---------CCCCCC-CCCCCHHHHHHHHHHHHC-HHHCCCCCEEEECCCCE
Q ss_conf             --79844---------144432-458888999999999619-75626685798768763
Q gi|254780337|r  205 --MRAKA---------MPAEDP-NTVPHPQKVAKIISFLCA-TQKIETGKLFSVPQNRF  250 (257)
Q Consensus       205 --m~~~~---------~~~~~~-~~~~~pediA~~v~fL~s-~~~~~tG~~~~vdgG~~  250 (257)
                        +.-..         .|.... -.|.--+.||++|+.|+- +..--.+.+++|.+-.-
T Consensus      1191 dDf~~r~ikg~iqlG~~P~~~~~~~~~PVD~va~~iv~~~~~~~~~~~~~~~h~~~~~~ 1249 (1389)
T TIGR03443      1191 DDFLLRMLKGCIQLGLIPNINNTVNMVPVDHVARVVVAAALNPPKESELAVAHVTGHPR 1249 (1389)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCEEEHHHHHHHHHHHHCCCCCCCCCEEEEECCCCC
T ss_conf             88999999999974897898884242427689999999872898678842898369997


No 250
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913    dTDP-4-dehydrorhamnose reductase (1.1.1.133 from EC) catalyzes the last of 4 steps in making dTDP-rhamnose, a precursor of LPS molecules such as core antigen and O-antigen.  dTDP-6-deoxy-L-mannose + NADP+ = dTDP-4-dehydro-6-deoxy-L-mannose + NADPH  ; GO: 0008831 dTDP-4-dehydrorhamnose reductase activity, 0045226 extracellular polysaccharide biosynthetic process.
Probab=98.76  E-value=9e-08  Score=72.11  Aligned_cols=209  Identities=21%  Similarity=0.227  Sum_probs=141.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      ++|||||++=||+++.+.|++.|..++...|+ .+++..          ....+.|++||+.+.+++..+     ++|++
T Consensus         1 rilitGa~GQlG~~L~~~l~~~g~~~~~~~~~-~~~~~~----------~~~~~~Dl~dP~~l~~~~r~~-----~Pd~v   64 (317)
T TIGR01214         1 RILITGANGQLGRELVQQLSKPGRVVVALTRS-TRLKLA----------ARWSQLDLTDPEALEELLRAI-----RPDAV   64 (317)
T ss_pred             CEEEECCCCHHHHHHHHHCCCCCCEEEEECCC-CCCCHH----------HHHHHHCCCCHHHHHHHHHHH-----CCCEE
T ss_conf             97887387567999999707888278643687-776113----------365440622468899999852-----87537


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECC-----H----HHCCCCC------C
Q ss_conf             87687588888867659999999999998999999999999998608986999788-----3----5647889------8
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSS-----G----AAYKCRP------L  164 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS-----~----~g~~~~~------~  164 (257)
                      ||.|+.+ ... =-|.+   =+..|.||..|+..+.+.+..+     +-.+|.||-     +    .+..|+.      -
T Consensus        65 vntAAYT-~VD-~AE~~---~~~AyavNa~A~~~lA~~A~~~-----Ga~~vh~STDYVFDGdfGG~~~~PY~e~D~~nP  134 (317)
T TIGR01214        65 VNTAAYT-DVD-GAESD---PEKAYAVNALAPQNLARAAARV-----GARLVHISTDYVFDGDFGGEGKRPYREDDETNP  134 (317)
T ss_pred             EECCHHC-CCC-CCCCC---HHHHHHHHHHHHHHHHHHHHHC-----CCEEEEEEECEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             6230110-100-00377---7787657407899999999866-----915999863423447557888668876468798


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCC--C----HHHHHH-CCCCCC----CCCCCH---HHHHHHHHH
Q ss_conf             36889899999999999999854438699755328837--9----779844-144432----458888---999999999
Q gi|254780337|r  165 WGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTR--T----SMRAKA-MPAEDP----NTVPHP---QKVAKIISF  230 (257)
Q Consensus       165 ~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~--T----~m~~~~-~~~~~~----~~~~~p---ediA~~v~f  230 (257)
                      ...|+.||..=+-.++.........=||+--+.=+.--  -    -|.+.. ...++.    +.++.|   +|+|+++.-
T Consensus       135 lnvYG~SK~~GE~a~~~~~~~e~~lIvRTsWlY~~~g~~g~NF~~tMlrLaG~~~~~l~vV~DQ~GsPTy~~dLA~~~~~  214 (317)
T TIGR01214       135 LNVYGQSKLAGEQAVRAAGPDENALIVRTSWLYGAGGGSGRNFVKTMLRLAGKEREELRVVDDQIGSPTYAKDLARAIAA  214 (317)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             43121115689999998379985788985213448998842179999985378998403785576873589999999999


Q ss_pred             HHCHHH------CCCCCEEEECCCCEECCC
Q ss_conf             619756------266857987687631543
Q gi|254780337|r  231 LCATQK------IETGKLFSVPQNRFVNYL  254 (257)
Q Consensus       231 L~s~~~------~~tG~~~~vdgG~~~n~~  254 (257)
                      |+...+      -..+-+++.-+-...+|+
T Consensus       215 ll~~~~Wdv~~~a~~~GvYH~~~~G~~SWy  244 (317)
T TIGR01214       215 LLERLNWDVEDAARARGVYHLANSGQVSWY  244 (317)
T ss_pred             HHHHHCCCHHCCCCCCCEEEEEECCCCCHH
T ss_conf             997613340010136734677505431368


No 251
>KOG1430 consensus
Probab=98.71  E-value=3.3e-07  Score=68.37  Aligned_cols=214  Identities=17%  Similarity=0.123  Sum_probs=134.9

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCC--CEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             88999993899868899999999889--9899997898999999999986499289998789999999999999999818
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSG--AYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G--~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      +..+++||||++=||+.++++|.++|  ..|.+.|+....-.-..+......+.+.++.+|+.|..++.+.++       
T Consensus         3 ~~~~vlVtGG~GflG~hlv~~L~~~~~~~~irv~D~~~~~~~~~~e~~~~~~~~v~~~~~D~~~~~~i~~a~~-------   75 (361)
T KOG1430           3 KKLSVLVTGGSGFLGQHLVQALLENELKLEIRVVDKTPTQSNLPAELTGFRSGRVTVILGDLLDANSISNAFQ-------   75 (361)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHCCCCCCEEEEECCHHHHHHHHHHCC-------
T ss_conf             6777999898337899999999845666179995367755565145533467743687223000055665215-------


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC------------CC
Q ss_conf             987998768758888886765999999999999899999999999999860898699978835647------------88
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK------------CR  162 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~------------~~  162 (257)
                      +. .+|++|...  +..+.+   .+-+..+++|+.|    |+..+...++.+--+.|.+||.....            +.
T Consensus        76 ~~-~Vvh~aa~~--~~~~~~---~~~~~~~~vNV~g----T~nvi~~c~~~~v~~lIYtSs~~Vvf~g~~~~n~~E~~p~  145 (361)
T KOG1430          76 GA-VVVHCAASP--VPDFVE---NDRDLAMRVNVNG----TLNVIEACKELGVKRLIYTSSAYVVFGGEPIINGDESLPY  145 (361)
T ss_pred             CC-EEEEECCCC--CCCCCC---CCHHHHEEECCHH----HHHHHHHHHHHCCCEEEEECCCEEEECCEECCCCCCCCCC
T ss_conf             76-078751656--752023---5612521414050----8999999998298789994674288688354557778787


Q ss_pred             CC--CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCC----CCHHHHHHCC----CC---------CCCCCCCHH-
Q ss_conf             98--3688989999999999999985443869975532883----7977984414----44---------324588889-
Q gi|254780337|r  163 PL--WGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT----RTSMRAKAMP----AE---------DPNTVPHPQ-  222 (257)
Q Consensus       163 ~~--~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v----~T~m~~~~~~----~~---------~~~~~~~pe-  222 (257)
                      |.  ..+|+.||+--+.+.+..+.   .....-.++-|-.|    +.-+......    ..         ....+..-+ 
T Consensus       146 p~~~~d~Y~~sKa~aE~~Vl~an~---~~~l~T~aLR~~~IYGpgd~~~~~~i~~~~~~g~~~f~~g~~~~~~~~~~~~N  222 (361)
T KOG1430         146 PLKHIDPYGESKALAEKLVLEANG---SDDLYTCALRPPGIYGPGDKRLLPKIVEALKNGGFLFKIGDGENLNDFTYGEN  222 (361)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCC---CCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCEEEECH
T ss_conf             554554332589999999998569---98715899703411179975204789999980685178605664102288023


Q ss_pred             -HHHHHHH--HHHCHHHCCCCCEEEECCCCE
Q ss_conf             -9999999--961975626685798768763
Q gi|254780337|r  223 -KVAKIIS--FLCATQKIETGKLFSVPQNRF  250 (257)
Q Consensus       223 -diA~~v~--fL~s~~~~~tG~~~~vdgG~~  250 (257)
                       ..|-...  .|.+......||.+.|.-|.-
T Consensus       223 va~ahilA~~aL~~~~~~~~Gq~yfI~d~~p  253 (361)
T KOG1430         223 VAWAHILAARALLDKSPSVNGQFYFITDDTP  253 (361)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEECCCC
T ss_conf             2799998899887148766850899868981


No 252
>PRK07201 short chain dehydrogenase; Provisional
Probab=98.66  E-value=3.6e-06  Score=61.36  Aligned_cols=202  Identities=21%  Similarity=0.168  Sum_probs=130.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHCC-CCEEEEECCCCCHHHH--HHHHHHHHHHHCCC
Q ss_conf             999389986889999999988-9989999789899999999998649-9289998789999999--99999999981898
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARS-GAYVIACGRSISQLEKLKNALQKIN-KKIDIFAFDLRDSNAL--ELTKTYIAKRWGKL   96 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~-G~~Vi~~~r~~~~l~~~~~~~~~~g-~~~~~~~~Dv~d~~~v--~~~~~~~~~~~g~i   96 (257)
                      .|+||+++=||..+.++|++. +++|+.+-|..+ .+++...++..+ .++..+..|++.+.-=  ++.+++.   -+.+
T Consensus         3 yflTGaTGFLG~~LL~~LL~~~~a~V~cLVR~~s-~~r~~~~~~~~~~~Rv~~v~GDL~~p~LGLs~~~~~~L---a~~v   78 (663)
T PRK07201          3 YFVTGGTGFIGRRLVSRLLDRPGARVHVLVRRQS-LGRFERLAEYWGVDRVVPVVGDLTAPELGLSAETIAEL---KGKI   78 (663)
T ss_pred             EEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCC-HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHH---HCCC
T ss_conf             6540684288999999998489998999978774-99999999974898879946777876789599999999---6748


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH--CCC-----------CC
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356--478-----------89
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA--YKC-----------RP  163 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g--~~~-----------~~  163 (257)
                      |.++|||++..-..|        ++....+|+.|+-++.+.+..    .+..++..+||.+.  ...           ..
T Consensus        79 d~I~H~aA~v~~~~~--------y~~~~~~NV~GTr~vL~LA~~----~~~~~~h~vST~~VaG~~~g~~~Ed~~d~~~~  146 (663)
T PRK07201         79 DHFFHLAAVYDLTAD--------EESQRAANVEGTRAAIELAER----LDAGTFHHVSSIAVAGLFEGVFREDMFDEAQD  146 (663)
T ss_pred             CEEEECCEEECCCCC--------HHHHHHHHHHHHHHHHHHHHH----CCCCEEEEEEECEECCCCCCCCCCCCCCCCCC
T ss_conf             999989823578899--------899765212999999999984----79974799963745368898754444544466


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCC----CCH-------------HHHHH---CCCCCC----C---
Q ss_conf             83688989999999999999985443869975532883----797-------------79844---144432----4---
Q gi|254780337|r  164 LWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT----RTS-------------MRAKA---MPAEDP----N---  216 (257)
Q Consensus       164 ~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v----~T~-------------m~~~~---~~~~~~----~---  216 (257)
                      ....|.-||+--+.+.+.      ..|+.+...-||.|    .|.             +..+.   .+...+    +   
T Consensus       147 l~~~Y~qSK~~AE~lVr~------a~glP~~IyRPg~V~GdS~TG~~~k~Dgpy~~~~ll~~l~~~~p~~~P~~~~~~~~  220 (663)
T PRK07201        147 LPTPYHRTKFEAEKLVRE------ECGLPWRIYRPAVVVGDSRTGEMDKIDGPYYFFKVIQKLRAVLPSWTPMLGPEGGR  220 (663)
T ss_pred             CCCCCHHHHHHHHHHHHH------CCCCCEEEEECCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCE
T ss_conf             899616589999999997------48998799808576236656764466407899999999986365545666777773


Q ss_pred             -CCCCHHHHHHHHHHHHCHHHCCCCCEEEE
Q ss_conf             -58888999999999619756266857987
Q gi|254780337|r  217 -TVPHPQKVAKIISFLCATQKIETGKLFSV  245 (257)
Q Consensus       217 -~~~~pediA~~v~fL~s~~~~~tG~~~~v  245 (257)
                       .+.--+-|++++.+|+.. .-..|++|++
T Consensus       221 ~n~vPVDfV~~Ai~~Ls~~-~~~~g~~fHL  249 (663)
T PRK07201        221 TNIVPVDYVVDALDHLAHA-DGRDGQTFHL  249 (663)
T ss_pred             EEEECHHHHHHHHHHHHCC-CCCCCCEEEE
T ss_conf             2251166799999999559-8878867870


No 253
>TIGR01777 yfcH conserved hypothetical protein TIGR01777; InterPro: IPR010099   This entry represents proteins of unknown function including the Escherichia coli YfcH protein..
Probab=98.54  E-value=6.3e-07  Score=66.47  Aligned_cols=204  Identities=17%  Similarity=0.139  Sum_probs=128.5

Q ss_pred             EEEECC-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             999389-9868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   21 ALVTGS-SRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        21 alVTGa-s~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      +||||| |+=||++++.+|-+.|++|++..|+..+................-.-.|+.+.+    | +    ..-.+|.+
T Consensus         1 ~litGgnTGfiG~~L~~~L~~~g~~V~~l~R~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~----W-~----~l~~~Dav   71 (307)
T TIGR01777         1 ILITGGNTGFIGRALTQRLTKSGHEVTILTRSPQAESNTKKVGYKNWLAEGKLGIVIAESG----W-S----ALEGADAV   71 (307)
T ss_pred             CEECCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHCCCCCCCCCCCCCCCCCCHHC----C-C----CCCCCCEE
T ss_conf             9641533023789999999847998999961686432000255445555221245207220----5-6----67886279


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC----CCCEEEEECCHHHCCCCCCCHHHHHHH--H
Q ss_conf             8768758888886765999999999999899999999999999860----898699978835647889836889899--9
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS----HCGRAIILSSGAAYKCRPLWGAYSASK--A  173 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~----~~G~IInisS~~g~~~~~~~~~Y~asK--a  173 (257)
                      ||=||.. -..| .-.+++.=+..++    +=+..|+.+...+++.    ...++..=+|.-|+.+......|.=.-  .
T Consensus        72 iNLAG~~-i~~P-~RWt~~~K~~i~~----SRi~~T~~L~~~i~~~~r~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~~  145 (307)
T TIGR01777        72 INLAGEP-IADP-KRWTEERKQEIRD----SRIDTTRALVEAIAAAPRAEQKPKVFISASAVGYYGHSEDRVFTEEDASG  145 (307)
T ss_pred             EECCCCC-CCCC-CCCCHHHHHHHHH----CCHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEEEECCCCCCEEECCCCCC
T ss_conf             8556888-5778-8878777575652----33478999999998465667887168850166630689982151166788


Q ss_pred             HHHHHHHHHHHHHH-------HHCCEEEEECCCCCCCH---HHHHHCC------------CCCCCCCCCHHHHHHHHHHH
Q ss_conf             99999999999854-------43869975532883797---7984414------------44324588889999999996
Q gi|254780337|r  174 AIEALARTWSKETV-------NTALRVINIDPGPTRTS---MRAKAMP------------AEDPNTVPHPQKVAKIISFL  231 (257)
Q Consensus       174 al~~lt~~la~E~~-------~~gIrvn~I~PG~v~T~---m~~~~~~------------~~~~~~~~~pediA~~v~fL  231 (257)
                      .=..|.-.+..+|-       .-|+||..+--|.|-.+   |+.+.++            +++.-.+.+-+|+.++|.|+
T Consensus       146 ~~ddFla~lc~~WE~~A~~a~~~g~Rvv~~R~G~VLg~~GGaL~~m~~pf~~glGGplG~G~Q~~SWIH~~D~v~~I~~~  225 (307)
T TIGR01777       146 PGDDFLAELCRDWEEAAQAAEQLGTRVVLLRTGIVLGPKGGALAKMLPPFRLGLGGPLGSGRQWFSWIHIEDLVQLILFA  225 (307)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             87772189999999985105336873898764134708987034545667651574236884145053588999999999


Q ss_pred             HCHHHCCCC
Q ss_conf             197562668
Q gi|254780337|r  232 CATQKIETG  240 (257)
Q Consensus       232 ~s~~~~~tG  240 (257)
                      +.. .-++|
T Consensus       226 l~~-~~~~G  233 (307)
T TIGR01777       226 LEN-ASVSG  233 (307)
T ss_pred             HHC-CCCCC
T ss_conf             855-89963


No 254
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=98.52  E-value=1.5e-05  Score=57.24  Aligned_cols=163  Identities=28%  Similarity=0.359  Sum_probs=110.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCC-CEEEEEEC--CH-HHHHHHHHHHH-------HCCCCEEEEECCCCCHHH--HHHH
Q ss_conf             999993899868899999999889-98999978--98-99999999998-------649928999878999999--9999
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSG-AYVIACGR--SI-SQLEKLKNALQ-------KINKKIDIFAFDLRDSNA--LELT   85 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G-~~Vi~~~r--~~-~~l~~~~~~~~-------~~g~~~~~~~~Dv~d~~~--v~~~   85 (257)
                      +++|+|||++=||+-+..+|...- ++|+..=|  +. ...+.+...+.       ....++..+..|++.+.-  -+.-
T Consensus         1 ~~vlLTGATGFLG~yLl~eLL~~~~~kv~cLVRA~s~E~a~~RL~~~~~~~~~~~e~~~~ri~vv~gDl~e~~lGL~~~~   80 (382)
T COG3320           1 RNVLLTGATGFLGAYLLLELLDRSDAKVICLVRAQSDEAALARLEKTFDLYRHWDELSADRVEVVAGDLAEPDLGLSERT   80 (382)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCHHH
T ss_conf             91899457027699999999716887289998227779999999997655301344302537998134445568987889


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCE-EEEECCHHHCCC---
Q ss_conf             9999998189879987687588888867659999999999998999999999999998608986-999788356478---
Q gi|254780337|r   86 KTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGR-AIILSSGAAYKC---  161 (257)
Q Consensus        86 ~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~-IInisS~~g~~~---  161 (257)
                      ++...   ..+|.+++||+....+.|        +.+....|+.|+-.+.|.+.     ++.++ ...|||++....   
T Consensus        81 ~~~La---~~vD~I~H~gA~Vn~v~p--------Ys~L~~~NVlGT~evlrLa~-----~gk~Kp~~yVSsisv~~~~~~  144 (382)
T COG3320          81 WQELA---ENVDLIIHNAALVNHVFP--------YSELRGANVLGTAEVLRLAA-----TGKPKPLHYVSSISVGETEYY  144 (382)
T ss_pred             HHHHH---HHCCEEEECCHHHCCCCC--------HHHHCCCCHHHHHHHHHHHH-----CCCCCEEEEEEEEEECCCCCC
T ss_conf             99986---320357754324435576--------88734764576999999996-----179840499710011453246


Q ss_pred             -----------------CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCC
Q ss_conf             -----------------8983688989999999999999985443869975532883
Q gi|254780337|r  162 -----------------RPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT  201 (257)
Q Consensus       162 -----------------~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v  201 (257)
                                       ....+.|.-||++-+-+.+    |-.++|+++..+-||.|
T Consensus       145 ~~~~~~~~~~~~~~~~~~~~~~GY~~SKwvaE~Lvr----~A~~rGLpv~I~Rpg~I  197 (382)
T COG3320         145 SNFTVDFDEISPTRNVGQGLAGGYGRSKWVAEKLVR----EAGDRGLPVTIFRPGYI  197 (382)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH----HHHHCCCCEEEEECCEE
T ss_conf             777533122453224567667884123899999999----98663897699816724


No 255
>KOG1202 consensus
Probab=98.42  E-value=1.3e-06  Score=64.38  Aligned_cols=174  Identities=17%  Similarity=0.186  Sum_probs=139.2

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCE-EEEEECCH--HHHHH-HHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             8899999389986889999999988998-99997898--99999-99999864992899987899999999999999998
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAY-VIACGRSI--SQLEK-LKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~~--~~l~~-~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      -.|.-+|+|+=+|.|.++|..|..+|++ ++++.|+-  ..-++ .....+..|.++..-..|++..+..+.++++. ++
T Consensus      1767 peksYii~GGLGGFGLELaqWLi~RGar~lVLtSRsGirtGYQa~~vrrWr~~GVqV~vsT~nitt~~ga~~Li~~s-~k 1845 (2376)
T KOG1202        1767 PEKSYIIVGGLGGFGLELAQWLIQRGARKLVLTSRSGIRTGYQALMVRRWRRRGVQVQVSTSNITTAEGARGLIEES-NK 1845 (2376)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHH-HH
T ss_conf             54207996266602689999998617507998514552123789999999865807998335410445179999875-31


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHH---HHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             189879987687588888867659999999999998999999---99999999860898699978835647889836889
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI---MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l---~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      .|++-.+.|-|.+.++ +.+++.+.+.|+++-+-.+.|+.++   +|...|.+     --.|..||.+--++..++..|+
T Consensus      1846 l~~vGGiFnLA~VLRD-~LiEnQt~knFk~va~pK~~~Ti~LD~~sRe~C~~L-----dyFv~FSSvscGRGN~GQtNYG 1919 (2376)
T KOG1202        1846 LGPVGGIFNLAAVLRD-GLIENQTPKNFKDVAKPKYSGTINLDRVSREICPEL-----DYFVVFSSVSCGRGNAGQTNYG 1919 (2376)
T ss_pred             CCCCCCHHHHHHHHHH-HHHCCCCHHHHHHHHCCCEEEEEEHHHHHHHHCCCC-----CEEEEEEEECCCCCCCCCCCCC
T ss_conf             2654212448999876-540356856777641442013665636546547613-----3699987502068877665533


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCC
Q ss_conf             89999999999999985443869975532883
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPT  201 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v  201 (257)
                      -+..++..+.+.-..|.    .-=.+|.=|.|
T Consensus      1920 ~aNS~MERiceqRr~~G----fPG~AiQWGAI 1947 (2376)
T KOG1202        1920 LANSAMERICEQRRHEG----FPGTAIQWGAI 1947 (2376)
T ss_pred             HHHHHHHHHHHHHHHCC----CCCCEEEEECC
T ss_conf             03679999998754148----98624664035


No 256
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]
Probab=98.34  E-value=8.5e-06  Score=58.91  Aligned_cols=193  Identities=16%  Similarity=0.133  Sum_probs=118.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             99938998688999999998899899997898999999999986499289998789999999999999999818987998
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILI  100 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDilV  100 (257)
                      ++|||+++=||++++.+|.+.|..|.+..|+..+.+...      +..+.       ..+.+..   ..   -.++|.+|
T Consensus         1 IliTGgTGlIG~~L~~~L~~~gh~v~iltR~~~~~~~~~------~~~v~-------~~~~~~~---~~---~~~~DavI   61 (297)
T COG1090           1 ILITGGTGLIGRALTARLRKGGHQVTILTRRPPKASQNL------HPNVT-------LWEGLAD---AL---TLGIDAVI   61 (297)
T ss_pred             CEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHC------CCCCC-------CCCHHHH---CC---CCCCCEEE
T ss_conf             957356650168999999848986999974785023324------76533-------4301244---03---67877899


Q ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             7687588888867659999999999998999999999999998608-986999788356478898368898999999999
Q gi|254780337|r  101 ANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAAIEALA  179 (257)
Q Consensus       101 NNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt  179 (257)
                      |=||..-. ..  ..+.+.=+..++    +-+..++.......+.. ...+..-+|..|+.+......|.-....-..|.
T Consensus        62 NLAG~~I~-~r--rWt~~~K~~i~~----SRi~~T~~L~e~I~~~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~g~~Fl  134 (297)
T COG1090          62 NLAGEPIA-ER--RWTEKQKEEIRQ----SRINTTEKLVELIAASETKPKVLISASAVGYYGHSGDRVVTEESPPGDDFL  134 (297)
T ss_pred             ECCCCCCC-CC--CCCHHHHHHHHH----HHHHHHHHHHHHHHHCCCCCCEEEECCEEEEECCCCCEEEECCCCCCCCHH
T ss_conf             88898154-46--578899999999----776899999999985267980898524577755888646415788877759


Q ss_pred             HHHHHHHH-------HHCCEEEEECCCCCCCH---HHHHHCC------------CCCCCCCCCHHHHHHHHHHHHCHHHC
Q ss_conf             99999854-------43869975532883797---7984414------------44324588889999999996197562
Q gi|254780337|r  180 RTWSKETV-------NTALRVINIDPGPTRTS---MRAKAMP------------AEDPNTVPHPQKVAKIISFLCATQKI  237 (257)
Q Consensus       180 ~~la~E~~-------~~gIrvn~I~PG~v~T~---m~~~~~~------------~~~~~~~~~pediA~~v~fL~s~~~~  237 (257)
                      --+...|-       ..|+||..+--|.|-.+   +..+..+            ++..-.|..-||..++|.||... +.
T Consensus       135 a~lc~~WE~~a~~a~~~gtRvvllRtGvVLs~~GGaL~~m~~~fk~glGG~~GsGrQ~~SWIhieD~v~~I~fll~~-~~  213 (297)
T COG1090         135 AQLCQDWEEEALQAQQLGTRVVLLRTGVVLSPDGGALGKMLPLFKLGLGGKLGSGRQWFSWIHIEDLVNAILFLLEN-EQ  213 (297)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCCHHHHCCHHHHCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHC-CC
T ss_conf             99999999998666406846999988778617886034310135522577158987303433299999999999847-57


Q ss_pred             CCC
Q ss_conf             668
Q gi|254780337|r  238 ETG  240 (257)
Q Consensus       238 ~tG  240 (257)
                      +.|
T Consensus       214 lsG  216 (297)
T COG1090         214 LSG  216 (297)
T ss_pred             CCC
T ss_conf             777


No 257
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane]
Probab=98.34  E-value=4.7e-06  Score=60.65  Aligned_cols=216  Identities=16%  Similarity=0.101  Sum_probs=139.5

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             899999389986889999999988998999978989999----9999998649928999878999999999999999981
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLE----KLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~----~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      +|+|||||-++-=|..+|+.|++.||.|.-+-|+...-.    .+.+.-...+.+++.+..|++|...+.++++.+    
T Consensus         2 ~K~ALITGITGQDGsYLa~lLLekGY~VhGi~Rrss~~n~~ri~L~~~~~~~~~~l~l~~gDLtD~~~l~r~l~~v----   77 (345)
T COG1089           2 GKVALITGITGQDGSYLAELLLEKGYEVHGIKRRSSSFNTPRIHLYEDPHLNDPRLHLHYGDLTDSSNLLRILEEV----   77 (345)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHC----
T ss_conf             7269995445875389999998569489878603355776530111165557861799965543568899999860----


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCH--HHCC---------CC
Q ss_conf             898799876875888888676599999999999989999999999999986089869997883--5647---------88
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSG--AAYK---------CR  162 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~--~g~~---------~~  162 (257)
                       .+|-+-|-|+- ...    ..|.|+=.-+.+++-.|+.++. .+++.+- .+.-++..-||.  .|..         |+
T Consensus        78 -~PdEIYNLaAQ-S~V----~vSFe~P~~T~~~~~iGtlrlL-EaiR~~~-~~~~rfYQAStSE~fG~v~~~pq~E~TPF  149 (345)
T COG1089          78 -QPDEIYNLAAQ-SHV----GVSFEQPEYTADVDAIGTLRLL-EAIRILG-EKKTRFYQASTSELYGLVQEIPQKETTPF  149 (345)
T ss_pred             -CCHHHEECCCC-CCC----CCCCCCCCEEEEECHHHHHHHH-HHHHHHC-CCCCEEEECCCHHHHCCCCCCCCCCCCCC
T ss_conf             -94453303432-345----5303586402531006788999-9999748-76607996561776067666754468999


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHH---HHCCEEEEECCCCCCCHHHHH-------HC---------C-CCCCCCCCCHH
Q ss_conf             9836889899999999999999854---438699755328837977984-------41---------4-44324588889
Q gi|254780337|r  163 PLWGAYSASKAAIEALARTWSKETV---NTALRVINIDPGPTRTSMRAK-------AM---------P-AEDPNTVPHPQ  222 (257)
Q Consensus       163 ~~~~~Y~asKaal~~lt~~la~E~~---~~gIrvn~I~PG~v~T~m~~~-------~~---------~-~~~~~~~~~pe  222 (257)
                      --.++|+++|-.-.-+|...+.-|.   -.||..|--+|.--.|=-..+       ..         . -.....|+...
T Consensus       150 yPrSPYAvAKlYa~W~tvNYResYgl~AcnGILFNHESP~Rge~FVTRKIt~ava~Ik~G~q~~l~lGNldAkRDWG~A~  229 (345)
T COG1089         150 YPRSPYAVAKLYAYWITVNYRESYGLFACNGILFNHESPLRGETFVTRKITRAVARIKLGLQDKLYLGNLDAKRDWGHAK  229 (345)
T ss_pred             CCCCHHHHHHHHHHHEEEEHHHHCCCEEECCEEECCCCCCCCCCEEHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHH
T ss_conf             88977889998777603014763473343114433789877531033899999999870661268743633102343167


Q ss_pred             HHHHHHHHHHCH---HHC--CCCCEEEE
Q ss_conf             999999996197---562--66857987
Q gi|254780337|r  223 KVAKIISFLCAT---QKI--ETGKLFSV  245 (257)
Q Consensus       223 diA~~v~fL~s~---~~~--~tG~~~~v  245 (257)
                      |..++...++-.   +.|  .||++-.|
T Consensus       230 DYVe~mwlmLQq~~PddyViATg~t~sV  257 (345)
T COG1089         230 DYVEAMWLMLQQEEPDDYVIATGETHSV  257 (345)
T ss_pred             HHHHHHHHHHCCCCCCCEEEECCCEEEH
T ss_conf             8999999997447998448852752239


No 258
>PRK08309 short chain dehydrogenase; Provisional
Probab=98.26  E-value=1.6e-05  Score=57.15  Aligned_cols=171  Identities=16%  Similarity=0.093  Sum_probs=108.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      -|||-|+++ .=+...+.|+++|+.|.+.+|+.++++...+... ...+++++.+|..|.++++..+.++.++.|++|.+
T Consensus         2 haLVIGGTG-ML~~vs~~L~~qg~~VsiiaR~~~kl~~~~~~~~-~p~~i~~l~~DY~d~~~l~~~l~~ai~q~Gp~dl~   79 (182)
T PRK08309          2 HALVIGGTG-MLKRVSLWLCEEGFHVSIIARDEVKLENVKRESG-TPESITCLPLDYHDDDAVKLAIKRTIEQNGPITLA   79 (182)
T ss_pred             CEEEECCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC-CCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCEE
T ss_conf             169972417-5599999997379999999448788653686237-98632578746488699999999999618985689


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCEEEEE-CCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             876875888888676599999999999989999999999999986-089869997-883564788983688989999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKK-SHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEA  177 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~-~~~G~IIni-sS~~g~~~~~~~~~Y~asKaal~~  177 (257)
                      |-   +.....+      +-               .+.+...+.. .+.-++..| +|.+.    |...           
T Consensus        80 Va---WiHssa~------~a---------------l~~v~~~l~~~~~~~~l~HVlGS~~~----~~~~-----------  120 (182)
T PRK08309         80 VA---WIHSSAK------DA---------------LSVVCRELDLSSETYRLFHVLGSPAK----ASRI-----------  120 (182)
T ss_pred             EE---EEECCCH------HH---------------HHHHHHHHHCCCCCCEEEEEECCCCC----CCCC-----------
T ss_conf             99---9835722------45---------------99999998548998169999468778----6535-----------


Q ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH-CHHH-CCCCCEEE
Q ss_conf             9999999854438699755328837977984414443245888899999999961-9756-26685798
Q gi|254780337|r  178 LARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC-ATQK-IETGKLFS  244 (257)
Q Consensus       178 lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~-s~~~-~~tG~~~~  244 (257)
                          ...-..+.+..---|-.|++..         ....|+.+-|||++-|.--. ++.+ ++.|++=+
T Consensus       121 ----~~e~~~~~~~~y~~ViLGFv~e---------~~~sRWLTHeEIS~GVi~Ai~~~~~~~ivG~vep  176 (182)
T PRK08309        121 ----ASEKIGPLRCSYRRVILGFILE---------DTYSRWLTHEEISDGVIKAIESDCDEHIVGRVEP  176 (182)
T ss_pred             ----CCCCCCCCCCCEEEEEEEEEEE---------CCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             ----1000233578628899888971---------8864146458999999999865797279877634


No 259
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.23  E-value=2.1e-05  Score=56.27  Aligned_cols=98  Identities=18%  Similarity=0.325  Sum_probs=70.7

Q ss_pred             HHHHHHHH-CCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCC
Q ss_conf             99999986-08986999788356478898368898999999999999998544386997553288379779844144432
Q gi|254780337|r  137 SFDPWLKK-SHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDP  215 (257)
Q Consensus       137 ~~~~~m~~-~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~  215 (257)
                      .|.|.|++ .+.||||.++-....   .....-.++.-||++|||+|++|+ ++|+++|.|.-..-              
T Consensus       102 ~~~~~~r~l~~~~rvvv~g~~p~~---~~~~~~~~a~~~legf~rs~~ke~-~~g~t~~l~~v~~~--------------  163 (447)
T PRK08261        102 FFHPLLRNLAPCGRVVVLGRPPET---AADPAQAIAQRALEGFTRSLGKEL-RRGATAQLVYVAPG--------------  163 (447)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCHH---CCCHHHHHHHHHHHHHHHHHHHHH-HCCCEEEEEEECCC--------------
T ss_conf             999998733777608994378022---379999999987778899899997-26843679997888--------------


Q ss_pred             CCCCCHHHHHHHHHHHHCHHH-CCCCCEEEECCCC---EECCCCC
Q ss_conf             458888999999999619756-2668579876876---3154379
Q gi|254780337|r  216 NTVPHPQKVAKIISFLCATQK-IETGKLFSVPQNR---FVNYLTP  256 (257)
Q Consensus       216 ~~~~~pediA~~v~fL~s~~~-~~tG~~~~vdgG~---~~n~~~p  256 (257)
                          ....+..++.||+|..+ |++||++.|..+.   -.||--|
T Consensus       164 ----~~~~~~~~lrf~ls~~sa~v~gq~~~v~~~~~~~~~~~~~p  204 (447)
T PRK08261        164 ----AETGLESTLRFFLSPRSAYVSGQVVRVGAADAAPPADWDRP  204 (447)
T ss_pred             ----CHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCC
T ss_conf             ----40011552424406663311253899638988898887888


No 260
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]
Probab=98.17  E-value=1.7e-05  Score=56.93  Aligned_cols=77  Identities=26%  Similarity=0.377  Sum_probs=64.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             999993899868899999999889-9899997898999999999986499289998789999999999999999818987
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSG-AYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLD   97 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G-~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iD   97 (257)
                      +.+||-|+ +++|+.+|..|++.| .+|.+.+|+.+++.++.+..   +.++.+.++|+.|.+++.++++    ++   |
T Consensus         2 ~~ilviGa-G~Vg~~va~~la~~~d~~V~iAdRs~~~~~~i~~~~---~~~v~~~~vD~~d~~al~~li~----~~---d   70 (389)
T COG1748           2 MKILVIGA-GGVGSVVAHKLAQNGDGEVTIADRSKEKCARIAELI---GGKVEALQVDAADVDALVALIK----DF---D   70 (389)
T ss_pred             CCEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHC---CCCCEEEEECCCCHHHHHHHHH----CC---C
T ss_conf             72899898-666799999998578962999848888999987533---4663169942567588999872----57---7


Q ss_pred             EEEECCCCC
Q ss_conf             998768758
Q gi|254780337|r   98 ILIANAGIL  106 (257)
Q Consensus        98 ilVNNAGi~  106 (257)
                      ++||.+.-.
T Consensus        71 ~VIn~~p~~   79 (389)
T COG1748          71 LVINAAPPF   79 (389)
T ss_pred             EEEEECCCH
T ss_conf             899928705


No 261
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=98.15  E-value=0.00028  Score=48.70  Aligned_cols=196  Identities=22%  Similarity=0.159  Sum_probs=117.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      .+||||||+.+|.+++++|.+.|+.|.+..|+.+++....       ..+.....|+.++..+...+       ..+|.+
T Consensus         2 ~ilV~GatG~~G~~~~~~L~~~~~~v~~~~r~~~~~~~~~-------~~v~~~~~d~~~~~~l~~~~-------~G~~~~   67 (275)
T COG0702           2 KILVTGATGFVGGAVVRELLARGHEVRAAVRNPEAAAALA-------GGVEVVLGDLRDPKSLVAGA-------KGVDGV   67 (275)
T ss_pred             CEEEECCCCCHHHHHHHHHHHCCCEEEEECCCCHHHHHCC-------CCCEEECCCCCCCHHHHHHH-------CCCEEE
T ss_conf             3899867775799999999975986999736822111103-------78528845641607799984-------894179


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             87687588888867659999999999998999999999999998608986999788356478898368898999999999
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALA  179 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt  179 (257)
                      ++..+... ..+ ..         .........+..+...     .+.-+++.+++..+..  .....|..+|.+....-
T Consensus        68 ~~i~~~~~-~~~-~~---------~~~~~~~~~~~a~~a~-----~~~~~~~~~s~~~~~~--~~~~~~~~~~~~~e~~l  129 (275)
T COG0702          68 LLISGLLD-GSD-AF---------RAVQVTAVVRAAEAAG-----AGVKHGVSLSVLGADA--ASPSALARAKAAVEAAL  129 (275)
T ss_pred             EEECCCCC-CCC-CH---------HHHHHHHHHHHHHHCC-----CCCCCEEEEEECCCCC--CCCHHHHHHHHHHHHHH
T ss_conf             99525455-663-01---------2003678999998627-----4424326875023566--88067899999999999


Q ss_pred             HHHHHHHHHHCCEEEEECCCCCCC-HHH--HHHCC--CCCC--CCCCCHHHHHHHHHHHHCHHHCCCCCEEEECCCCE
Q ss_conf             999998544386997553288379-779--84414--4432--45888899999999961975626685798768763
Q gi|254780337|r  180 RTWSKETVNTALRVINIDPGPTRT-SMR--AKAMP--AEDP--NTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRF  250 (257)
Q Consensus       180 ~~la~E~~~~gIrvn~I~PG~v~T-~m~--~~~~~--~~~~--~~~~~pediA~~v~fL~s~~~~~tG~~~~vdgG~~  250 (257)
                      ++....+  ..+|-+.+..|.-.- .+.  ....+  ....  -.....+|++..+.-.+.... ..|+++.+-|-..
T Consensus       130 ~~sg~~~--t~lr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~d~a~~~~~~l~~~~-~~~~~~~l~g~~~  204 (275)
T COG0702         130 RSSGIPY--TTLRRAAFYLGAGAAFIEAAEAAGLPVIPRGIGRLSPIAVDDVAEALAAALDAPA-TAGRTYELAGPEA  204 (275)
T ss_pred             HHCCCCC--CCCCCCCEECCCCHHHHHHHHHCCCCEEECCCCCCCCEEHHHHHHHHHHHHCCCC-CCCCEEEEECCCC
T ss_conf             8569862--0355630011530567999984588514125665471456567999998714853-3486799957400


No 262
>KOG1221 consensus
Probab=98.06  E-value=3.2e-05  Score=55.09  Aligned_cols=178  Identities=15%  Similarity=0.162  Sum_probs=107.0

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCC---CEEEEEECC------HHHHH-----HHHHHHHHC----CCCEEEEECCC
Q ss_conf             2488999993899868899999999889---989999789------89999-----999999864----99289998789
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSG---AYVIACGRS------ISQLE-----KLKNALQKI----NKKIDIFAFDL   76 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G---~~Vi~~~r~------~~~l~-----~~~~~~~~~----g~~~~~~~~Dv   76 (257)
                      -++||+++||||++-+|+-+.+.|++.-   -++.+.=|.      +++++     .+-+.+.+.    -.++..+..|+
T Consensus         9 f~~~k~i~vTG~tGFlgKVliEklLr~~p~v~~IYlLiR~k~g~~~~~Rl~~~~~~~lF~~l~~~~p~~l~Kv~pi~GDi   88 (467)
T KOG1221           9 FYKNKTIFVTGATGFLGKVLIEKLLRTTPDVKRIYLLIRAKKGKAAQERLRTELKDPLFEVLKEKKPEALEKVVPIAGDI   88 (467)
T ss_pred             HHCCCEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEECCEECCCCC
T ss_conf             95798599972763457899999985076765699998347898778999998744699999863952102000012566


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCH
Q ss_conf             99999999999999981898799876875888888676599999999999989999999999999986089869997883
Q gi|254780337|r   77 RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSG  156 (257)
Q Consensus        77 ~d~~~v~~~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~  156 (257)
                      ++++---.--+.. .-...+|+++|+|+..+ +.       |-++-.+.+|.+|+.++.+.+...++-   -..+.+|..
T Consensus        89 ~~~~LGis~~D~~-~l~~eV~ivih~AAtvr-Fd-------e~l~~al~iNt~Gt~~~l~lak~~~~l---~~~vhVSTA  156 (467)
T KOG1221          89 SEPDLGISESDLR-TLADEVNIVIHSAATVR-FD-------EPLDVALGINTRGTRNVLQLAKEMVKL---KALVHVSTA  156 (467)
T ss_pred             CCCCCCCCHHHHH-HHHHCCCEEEEEEEEEC-CC-------HHHHHHHHHHHHHHHHHHHHHHHHHHH---HEEEEEEHH
T ss_conf             6866688827788-88745778999530422-55-------366565422227489999999985211---268984212


Q ss_pred             HHC--------CCCCC----------CHHHHHHHHHH--------------HHHHHHHHHHHH---HHCCEEEEECCCCC
Q ss_conf             564--------78898----------36889899999--------------999999999854---43869975532883
Q gi|254780337|r  157 AAY--------KCRPL----------WGAYSASKAAI--------------EALARTWSKETV---NTALRVINIDPGPT  201 (257)
Q Consensus       157 ~g~--------~~~~~----------~~~Y~asKaal--------------~~lt~~la~E~~---~~gIrvn~I~PG~v  201 (257)
                      ...        +++|-          ...+..+.-.+              -.|||+++..+-   .+++-+.-|.|+.|
T Consensus       157 y~n~~~~~i~E~~y~~~~~~~~~~~i~~~~~~~~~~ld~~~~~l~~~~PNTYtfTKal~E~~i~~~~~~lPivIiRPsiI  236 (467)
T KOG1221         157 YSNCNVGHIEEKPYPMPETCNPEKILKLDENLSDELLDQKAPKLLGGWPNTYTFTKALAEMVIQKEAENLPLVIIRPSII  236 (467)
T ss_pred             HEECCCCCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHHCCCCCEEEECCCCE
T ss_conf             22246665210256764558988887643222189998764775089998630118658999985264898699748741


Q ss_pred             CCH
Q ss_conf             797
Q gi|254780337|r  202 RTS  204 (257)
Q Consensus       202 ~T~  204 (257)
                      -..
T Consensus       237 ~st  239 (467)
T KOG1221         237 TST  239 (467)
T ss_pred             ECC
T ss_conf             013


No 263
>KOG1203 consensus
Probab=97.94  E-value=0.0003  Score=48.54  Aligned_cols=171  Identities=16%  Similarity=0.080  Sum_probs=104.6

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHH-HHHHHHHHHHC
Q ss_conf             48899999389986889999999988998999978989999999999864992899987899999999-99999999818
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALE-LTKTYIAKRWG   94 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~-~~~~~~~~~~g   94 (257)
                      .+-.+++|+||++++|+-+++.|.++|..|-..-|+.++.+.+..+... ......+..|...+.++. .+++.+   --
T Consensus        77 ~~~~~VlVvGatG~vG~~iv~~llkrgf~vra~VRd~~~a~~~~~~~~~-d~~~~~v~~~~~~~~d~~~~~~~~~---~~  152 (411)
T KOG1203          77 KKPTTVLVVGATGKVGRRIVKILLKRGFSVRALVRDEQKAEDLLGVFFV-DLGLQNVEADVVTAIDILKKLVEAV---PK  152 (411)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCCC-CCCCCEEEECCCCCCCHHHHHHHHC---CC
T ss_conf             8887499955887363999999997797023421573655444325333-4442224302256541225666301---34


Q ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
Q ss_conf             98799876875888888676599999999999989999999999999986089869997883564788983688989999
Q gi|254780337|r   95 KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAA  174 (257)
Q Consensus        95 ~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaa  174 (257)
                      ...+.+-++|-. + .. +     |...-..|..-|..++++++    +..+--|+|.++|+.+....+....+.. =+.
T Consensus       153 ~~~~v~~~~ggr-p-~~-e-----d~~~p~~VD~~g~knlvdA~----~~aGvk~~vlv~si~~~~~~~~~~~~~~-~~~  219 (411)
T KOG1203         153 GVVIVIKGAGGR-P-EE-E-----DIVTPEKVDYEGTKNLVDAC----KKAGVKRVVLVGSIGGTKFNQPPNILLL-NGL  219 (411)
T ss_pred             CCEEEEECCCCC-C-CC-C-----CCCCCCEECHHHHHHHHHHH----HHHCCCEEEEEEEECCCCCCCCCHHHHH-HHH
T ss_conf             531587423477-8-75-4-----57884421678889999999----9838745999976347646777255555-443


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCC
Q ss_conf             99999999998544386997553288379
Q gi|254780337|r  175 IEALARTWSKETVNTALRVINIDPGPTRT  203 (257)
Q Consensus       175 l~~lt~~la~E~~~~gIrvn~I~PG~v~T  203 (257)
                      +.-.-+....++...|+--..|-||....
T Consensus       220 ~~~~k~~~e~~~~~Sgl~ytiIR~g~~~~  248 (411)
T KOG1203         220 VLKAKLKAEKFLQDSGLPYTIIRPGGLEQ  248 (411)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             56787769999986589867995321004


No 264
>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368   This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase. This enzyme converts GDP-mannose to GDP-4-dehydro-6-deoxy-D-mannose, the first of three steps for the conversion of GDP-mannose to GDP-fucose in animals, plants, and bacteria. In bacteria, GDP-L-fucose acts as a precursor of surface antigens such as the extracellular polysaccharide colanic acid of Escherichia coli. Excluded from this family are members of the clade that are poorly related because of highly dervied (phylogenetically long-branch) sequences, e.g. Aneurinibacillus thermoaerophilus Gmd, described as a bifunctional GDP-mannose 4,6-dehydratase/GDP-6-deoxy-D-lyxo-4-hexulose reductase .; GO: 0008446 GDP-mannose 46-dehydratase activity, 0019673 GDP-mannose metabolic process, 0005622 intracellular.
Probab=97.87  E-value=0.00056  Score=46.72  Aligned_cols=215  Identities=18%  Similarity=0.135  Sum_probs=150.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEEC-----CHHHHHHHHHHHHHC-CCC--EEEEECCCCCHHHHHHHHHHHH
Q ss_conf             99999389986889999999988998999978-----989999999999864-992--8999878999999999999999
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGR-----SISQLEKLKNALQKI-NKK--IDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r-----~~~~l~~~~~~~~~~-g~~--~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
                      |+|||||-|+==|.-+|+.|+++||.|--.=|     |.++++.+-++..+. .++  ...+=.|+||...+-++++++ 
T Consensus         1 k~ALiTGiTGQDGSYLAE~LL~~GYeVHG~~RRSSSfNT~Ri~hiY~~~h~~~~r~A~~fLHYGDlTDs~~L~~~i~~~-   79 (365)
T TIGR01472         1 KVALITGITGQDGSYLAEFLLEKGYEVHGLIRRSSSFNTQRIEHIYEDPHKEEKRRALMFLHYGDLTDSSNLVKLIDEI-   79 (365)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC-
T ss_conf             9368834555767899999872696876458625542522456764053541016613542044210689999997404-


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH-HHCCCCEEE--EECCHH---HCC----
Q ss_conf             9818987998768758888886765999999999999899999999999999-860898699--978835---647----
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWL-KKSHCGRAI--ILSSGA---AYK----  160 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m-~~~~~G~II--nisS~~---g~~----  160 (257)
                          +++=+=|=|+ ....    .+|.|-=+-+.|+-=.|+.++.-++-.+- ...  .+-|  -=+|.|   |..    
T Consensus        80 ----kP~EiYNLAA-QSHV----~VSFe~PeYTa~~~g~GTLrlLEA~r~hni~gl--~~~~rFYQAStSElYG~v~~~P  148 (365)
T TIGR01472        80 ----KPTEIYNLAA-QSHV----KVSFEIPEYTADVDGIGTLRLLEAVRSHNILGL--IKEIRFYQASTSELYGEVQEIP  148 (365)
T ss_pred             ----CCCEEECCCC-CCCE----EEECCCCCCHHCHHHHHHHHHHHHHHHHHHHCC--CCCEEEEECCCHHHCCCCCCCC
T ss_conf             ----8863420202-3710----354165200001244317789998742334141--2030255245231136555788


Q ss_pred             -----CCCCCHHHHHHHHHHHHHHHHHHHHH---HHHCCEEEEECC--CCC-CCH-H---HHHHCC---------CCC-C
Q ss_conf             -----88983688989999999999999985---443869975532--883-797-7---984414---------443-2
Q gi|254780337|r  161 -----CRPLWGAYSASKAAIEALARTWSKET---VNTALRVINIDP--GPT-RTS-M---RAKAMP---------AED-P  215 (257)
Q Consensus       161 -----~~~~~~~Y~asKaal~~lt~~la~E~---~~~gIrvn~I~P--G~v-~T~-m---~~~~~~---------~~~-~  215 (257)
                           |+--.++|+++|-.-.=.|...+.-|   +-.||.+|==+|  |-+ =|- +   .++..-         .-+ .
T Consensus       149 Q~E~TPF~PRSPYAaAK~yA~w~tvNYREAYgL~A~nGILFNHESP~RGetFVTRKITra~a~I~~G~~~~lyLGNLdA~  228 (365)
T TIGR01472       149 QNETTPFYPRSPYAAAKLYAYWITVNYREAYGLFAVNGILFNHESPRRGETFVTRKITRAAAKIKLGLQEKLYLGNLDAK  228 (365)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHEEEEECCCCCCHHCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             88888768887689998845431021210034100035210467887788532258999999986156311120275441


Q ss_pred             CCCCCHHHHHHHHHHHHC---HHHC--CCCCEEEE
Q ss_conf             458888999999999619---7562--66857987
Q gi|254780337|r  216 NTVPHPQKVAKIISFLCA---TQKI--ETGKLFSV  245 (257)
Q Consensus       216 ~~~~~pediA~~v~fL~s---~~~~--~tG~~~~v  245 (257)
                      ..||.+.|-.+++..+|=   |+.|  .||++-.|
T Consensus       229 RDWGhAkDYV~aMWLMLQ~d~P~DYViATG~t~SV  263 (365)
T TIGR01472       229 RDWGHAKDYVEAMWLMLQQDKPDDYVIATGETHSV  263 (365)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCCCCEEEECCCEEEH
T ss_conf             06650566999988752786889768875733338


No 265
>pfam03435 Saccharop_dh Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.
Probab=97.81  E-value=0.00027  Score=48.84  Aligned_cols=76  Identities=26%  Similarity=0.327  Sum_probs=61.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             99938998688999999998899--8999978989999999999864992899987899999999999999998189879
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGA--YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~--~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      +||-|+ +++|+.++..|++.+.  +|++.+|+.++++++.+.  ..+.++...++|+.|.++++++++       +.|+
T Consensus         1 IlvlGa-G~vG~~~~~~L~~~~~~~~i~vad~~~~~~~~~~~~--~~~~~~~~~~~d~~~~~~l~~~~~-------~~di   70 (384)
T pfam03435         1 VLIIGA-GGVGQGVAPLLARHGDVDEITVADRSLEKAQALAAP--KLGLRFIAIAVDADNYEALAALLK-------EGDL   70 (384)
T ss_pred             CEEECC-CHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHH--CCCCCEEEEEECCCCHHHHHHHHH-------CCCE
T ss_conf             989897-787999999997289988699998988998987752--369853899957789999999871-------2899


Q ss_pred             EEECCCCC
Q ss_conf             98768758
Q gi|254780337|r   99 LIANAGIL  106 (257)
Q Consensus        99 lVNNAGi~  106 (257)
                      +||.++-.
T Consensus        71 Vv~~~p~~   78 (384)
T pfam03435        71 VINLAPPF   78 (384)
T ss_pred             EEECCCHH
T ss_conf             99998434


No 266
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912   Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria . They consist of lipid A (endotoxin) which anchors LPS to the outer membrane, a non-repeating core oligosachharide, and an immunogenic O-antigen repeat polymer, which is an oligosaccharide of 1-40 units that variesbetween different strains of bacteria. Although the O-antigen and most of the core domain are not necessary for growth in the lab, they appear to help bacteria resist environmental stresses including the complement system and antibiotics.   This family consists of examples of ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme involved in biosynthesis of the inner core of LPS in Gram-negative bacteria . This enzyme is homologous to UDP-glucose 4-epimerase (IPR005886 from INTERPRO) and belongs to the NAD dependent epimerase/dehydratase family. It participates in the biosynthetic pathway leading to incorporation of heptose, a conserved sugar, into the core region of LPS, performing the reaction shown below: ADP-D-glycero-D-manno-heptose = ADP-L-glycero-D-manno-heptose It is a homopentameric enzyme with each monomer composed of two domains: an N-terminal modified Rossman fold domain for NADP binding, and a C-terminal substrate binding domain.; GO: 0008712 ADP-glyceromanno-heptose 6-epimerase activity, 0050661 NADP binding, 0005975 carbohydrate metabolic process.
Probab=97.75  E-value=0.00025  Score=49.10  Aligned_cols=209  Identities=18%  Similarity=0.203  Sum_probs=123.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHCC-C-EEEEEEC--C-----HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9993899868899999999889-9-8999978--9-----8999999999986499289998789999999999999999
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSG-A-YVIACGR--S-----ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G-~-~Vi~~~r--~-----~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      +|||||++=||..++..|-++| . .|+++|.  +     ...+..+.+    .+.=..+..++++|.-+=+.+++++.+
T Consensus         1 IiVTGGAGFIGSNlv~~LN~~gP~~dI~vvD~L~~~~~F~ng~~~slg~----~kk~~Nl~~~~I~d~i~k~~~~~~l~~   76 (353)
T TIGR02197         1 IIVTGGAGFIGSNLVKALNERGPETDILVVDNLRDDATFENGNPQSLGH----FKKFLNLADLEIADYIDKDDLLDRLEK   76 (353)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCHHH----CCCCCCCCCCHHHCCCCCHHHHHHHHH
T ss_conf             9550676368999999996438954288874078755246777432234----244325554112133588546999983


Q ss_pred             ---HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-------
Q ss_conf             ---8189879987687588888867659999999999998999999999999998608986999788356478-------
Q gi|254780337|r   92 ---RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC-------  161 (257)
Q Consensus        92 ---~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~-------  161 (257)
                         .++.||+++|=+++    +   ++++.|=+.+|+.|..-.-.|...|..+=     -..|-=||.+ --|       
T Consensus        77 ~~~~~~~~~avfH~GAc----S---~TTe~D~~~~m~nN~~ys~~Ll~~c~~~~-----~~~IYASSAa-tYG~~~~~f~  143 (353)
T TIGR02197        77 GSEALGKIEAVFHQGAC----S---DTTETDGEYMMENNYQYSKRLLDWCAEKG-----VPFIYASSAA-TYGDGEAGFR  143 (353)
T ss_pred             CCCCCCCCCEEEECCHH----H---HHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCEEEECCHH-HCCCCCCCCC
T ss_conf             02013883379973312----5---35886279999889999999999999648-----9868850312-1076877777


Q ss_pred             -----C-----CCCHHHHHHHHHHHHHHH-HHHH-HHHH-H--CCEEEEECCCCC---CCHHH-------HH--------
Q ss_conf             -----8-----983688989999999999-9999-8544-3--869975532883---79779-------84--------
Q gi|254780337|r  162 -----R-----PLWGAYSASKAAIEALAR-TWSK-ETVN-T--ALRVINIDPGPT---RTSMR-------AK--------  208 (257)
Q Consensus       162 -----~-----~~~~~Y~asKaal~~lt~-~la~-E~~~-~--gIrvn~I~PG~v---~T~m~-------~~--------  208 (257)
                           .     .-+-.|+=||+=-..+.+ .+.. +..+ +  |.|--.|. |+=   +-.|-       .+        
T Consensus       144 ~~~~~e~L~kLrPlN~YGySK~lFD~~v~~~~~~~~~~~~q~~GLrYFNVY-GP~E~HKG~MASv~f~~~~q~~~~~~v~  222 (353)
T TIGR02197       144 EDRELEELQKLRPLNVYGYSKFLFDQYVRRRVLPGEALSAQVVGLRYFNVY-GPREYHKGKMASVAFHLFNQIKAGGNVK  222 (353)
T ss_pred             CCCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCC-CCCCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             665658897518788612216789899999860124798642410211346-8886754436999999888997378820


Q ss_pred             HC--------CCCCCCCCCCHHHHHHHHHHHHCHHHCCCCCEEEECCCC
Q ss_conf             41--------444324588889999999996197562668579876876
Q gi|254780337|r  209 AM--------PAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNR  249 (257)
Q Consensus       209 ~~--------~~~~~~~~~~pediA~~v~fL~s~~~~~tG~~~~vdgG~  249 (257)
                      .+        +++....+.--+||+++.+|++.. .-.+| +++|--|+
T Consensus       223 LF~~~~~~~~dGeQ~RDFVYV~DV~~~n~~~~~~-~~~SG-ifN~GtG~  269 (353)
T TIGR02197       223 LFKSHKEGFKDGEQLRDFVYVKDVVKVNLWLLEN-PSKSG-IFNVGTGK  269 (353)
T ss_pred             CCCCCCCCCCCCCCCCCCEEHHHHHHHHHHHHHC-CCCCE-EEECCCCC
T ss_conf             2356685898878110115527699999999848-89841-56447788


No 267
>KOG2865 consensus
Probab=97.72  E-value=0.00038  Score=47.86  Aligned_cols=203  Identities=24%  Similarity=0.213  Sum_probs=122.8

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             524889999938998688999999998899899997898-9999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSI-SQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~-~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      -+++|-++-|-||++=+|+..+..|++.|.+|++-.|.. .....++ ..... +|+.++..|+.|+++|.+.++     
T Consensus        57 sS~sGiVaTVFGAtGFlGryvvnklak~GSQviiPyR~d~~~~r~lk-vmGdL-GQvl~~~fd~~DedSIr~vvk-----  129 (391)
T KOG2865          57 SSVSGIVATVFGATGFLGRYVVNKLAKMGSQVIIPYRGDEYDPRHLK-VMGDL-GQVLFMKFDLRDEDSIRAVVK-----  129 (391)
T ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHHCCCEEEEECCCCCCCHHHEE-ECCCC-CCEEEECCCCCCHHHHHHHHH-----
T ss_conf             42132479985264412089999886358769985358864454500-02543-334564167778799999987-----


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835647889836889899
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASK  172 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asK  172 (257)
                        .-+++||--|-  .. +..+++.+      |+|.+++=.+.|.+    ++.+--+.|.+|+.-+.  ...-+-|--||
T Consensus       130 --~sNVVINLIGr--d~-eTknf~f~------Dvn~~~aerlAric----ke~GVerfIhvS~Lgan--v~s~Sr~LrsK  192 (391)
T KOG2865         130 --HSNVVINLIGR--DY-ETKNFSFE------DVNVHIAERLARIC----KEAGVERFIHVSCLGAN--VKSPSRMLRSK  192 (391)
T ss_pred             --HCCEEEEEECC--CC-CCCCCCCC------CCCCHHHHHHHHHH----HHHCHHHEEEHHHCCCC--CCCHHHHHHHH
T ss_conf             --47579984035--34-45886612------00145899999999----86283525416545665--45767887765


Q ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCC-C---------HHHHHH--CCCC--CCCCCCCH---HHHHHHHHHHHCHH
Q ss_conf             999999999999854438699755328837-9---------779844--1444--32458888---99999999961975
Q gi|254780337|r  173 AAIEALARTWSKETVNTALRVINIDPGPTR-T---------SMRAKA--MPAE--DPNTVPHP---QKVAKIISFLCATQ  235 (257)
Q Consensus       173 aal~~lt~~la~E~~~~gIrvn~I~PG~v~-T---------~m~~~~--~~~~--~~~~~~~p---ediA~~v~fL~s~~  235 (257)
                      ++-+--.   ..++    --.+.|-|.-+- |         .++.+.  +|-.  ..+...+|   -|||.+|.-.+-+.
T Consensus       193 ~~gE~aV---rdaf----PeAtIirPa~iyG~eDrfln~ya~~~rk~~~~pL~~~GekT~K~PVyV~DVaa~IvnAvkDp  265 (391)
T KOG2865         193 AAGEEAV---RDAF----PEATIIRPADIYGTEDRFLNYYASFWRKFGFLPLIGKGEKTVKQPVYVVDVAAAIVNAVKDP  265 (391)
T ss_pred             HHHHHHH---HHHC----CCCEEECHHHHCCCCHHHHHHHHHHHHHCCCEEEECCCCCEEECCEEEEHHHHHHHHHCCCC
T ss_conf             3237999---8638----74435242551155136778999998733734510477514634578751889999860394


Q ss_pred             HCCCCCEEEECCC
Q ss_conf             6266857987687
Q gi|254780337|r  236 KIETGKLFSVPQN  248 (257)
Q Consensus       236 ~~~tG~~~~vdgG  248 (257)
                       --.|+++..-|-
T Consensus       266 -~s~Gktye~vGP  277 (391)
T KOG2865         266 -DSMGKTYEFVGP  277 (391)
T ss_pred             -CCCCCEEEECCC
T ss_conf             -225845661387


No 268
>KOG2733 consensus
Probab=97.71  E-value=0.00024  Score=49.22  Aligned_cols=81  Identities=16%  Similarity=0.211  Sum_probs=68.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHH----CCCEEEEEECCHHHHHHHHHHHHHCC----CCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             999938998688999999998----89989999789899999999998649----9289998789999999999999999
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELAR----SGAYVIACGRSISQLEKLKNALQKIN----KKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~----~G~~Vi~~~r~~~~l~~~~~~~~~~g----~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      -++|-|||+=-|.-+.+++..    +|.++.+.+|++++|+++.+.+.+..    .+...+.||.+|++++.+++.+   
T Consensus         7 DvVIyGASGfTG~yivee~v~~~~~~~~slavAGRn~~KL~~vL~~~~~k~~~~ls~~~i~i~D~~n~~Sl~emak~---   83 (423)
T KOG2733           7 DVVIYGASGFTGKYIVEEAVSSQVFEGLSLAVAGRNEKKLQEVLEKVGEKTGTDLSSSVILIADSANEASLDEMAKQ---   83 (423)
T ss_pred             EEEEECCCCCCCEEEHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHH---
T ss_conf             59998156665302489886430246754787327888999999998632488866543899437887899999864---


Q ss_pred             HHCCCCEEEECCCCCC
Q ss_conf             8189879987687588
Q gi|254780337|r   92 RWGKLDILIANAGILG  107 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~  107 (257)
                          ..++||++|=++
T Consensus        84 ----~~vivN~vGPyR   95 (423)
T KOG2733          84 ----ARVIVNCVGPYR   95 (423)
T ss_pred             ----HEEEEECCCCCE
T ss_conf             ----178775155631


No 269
>PRK12320 hypothetical protein; Provisional
Probab=97.69  E-value=0.00039  Score=47.76  Aligned_cols=104  Identities=19%  Similarity=0.224  Sum_probs=76.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      -++|||+++-+|+.++.+|...|..|+-++|...+         ..-..+.|+++|+.|.--.+        --+.-|.+
T Consensus         2 ~i~VT~A~G~lGR~la~rLla~GH~V~Giar~r~~---------s~~~~~dFV~A~iRd~v~~e--------l~~~AD~V   64 (699)
T PRK12320          2 QILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHD---------ALDPRVDYVCASLRNPVLQE--------LAGEADAV   64 (699)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCC---------CCCCCCCEEECHHHHHHHHH--------HCCCCCEE
T ss_conf             47883462156778999998668724544047986---------66754555421123099997--------40455548


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH
Q ss_conf             87687588888867659999999999998999999999999998608986999788356
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA  158 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g  158 (257)
                      +|+|=+. ...|=            .+|+.|.-    .++.-|.+.+. ++|++||.++
T Consensus        65 ~HlA~~~-~~~p~------------~~~idG~a----~V~~A~a~~G~-R~vfvs~Aag  105 (699)
T PRK12320         65 IHLAPVD-TSAPG------------GVGITGLA----HVANAAARAGA-RLLFVSQAAG  105 (699)
T ss_pred             EEECCCC-CCCCC------------CCCCHHHH----HHHHHHHHHCC-CEEEEECCCC
T ss_conf             8822556-89998------------54636688----99999986188-1798605789


No 270
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate.
Probab=97.68  E-value=0.00043  Score=47.53  Aligned_cols=76  Identities=20%  Similarity=0.354  Sum_probs=58.2

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             24889999938998688999999998899-89999789899999999998649928999878999999999999999981
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      +|++|.++|-|+ +++|+.+++.|.+.|+ +|.++.|+.++++++++++...  .+...  ++.   ++.       +..
T Consensus         9 ~l~~~~vlVIGa-G~~~~~~~~~L~~~g~~~i~v~nRt~~ka~~la~~~~~~--~~~~~--~~~---~l~-------~~l   73 (134)
T pfam01488         9 DLKGKKVLLIGA-GEMARLAAKHLLSKGAKKITIANRTLEKAKELAEEFGGE--EVEAL--PLD---ELE-------ELL   73 (134)
T ss_pred             CCCCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCC--CEEEE--ECH---HHH-------HHH
T ss_conf             814898999996-099999999999759988999547578999999984997--25898--513---544-------136


Q ss_pred             CCCCEEEECCCC
Q ss_conf             898799876875
Q gi|254780337|r   94 GKLDILIANAGI  105 (257)
Q Consensus        94 g~iDilVNNAGi  105 (257)
                      ...|++|++.+.
T Consensus        74 ~~~DivI~aT~s   85 (134)
T pfam01488        74 AEADIVISATSA   85 (134)
T ss_pred             HHCCEEEEECCC
T ss_conf             319999992599


No 271
>TIGR00507 aroE shikimate 5-dehydrogenase; InterPro: IPR011342   The shikimate pathway links the metabolism of carbohydrates to the biosynthesis of aromatic compounds and is essential for the biosynthesis of aromatic amino acids and other aromatic compounds in bacteria, eukaryotic microorganisms and plants . It is a seven-step pathway which converts phosphoenolpyruvate and erythrose 4-phosphate to chorismate, the common precursor for the synthesis of folic acid, ubiquinone, vitamins E and K, and aromatic amino acids. Since this pathway is absent in metazoans, which must therefore obtain the essential amino acids phenylalanine and tryptophan from their diet, the enzymes in this pathway are important targets for the development of novel herbicides and antimicrobial compounds.   This entry represents shikimate 5-dehydrogenases from prokaryotes and functionally equivalent C-terminal domains from larger, multifunctional proteins, the majority of which have an N-terminal quinate dehydrogenase domain. These multifunctional proteins occur in plants, chlamydiae, planctomycetes and a limited number of marine proteobacteria. Shikimate 5-dehydrogenase catalyses the fourth step of the shikimate pathway, which is the NADP-dependent reduction of 3-dehydroshikimate to shikimate .   Structural studies suggests that some shikimate dehydrogenases are monmers while others form homodimers , . Each shikimate dehydrogenase monomer forms a compact two-domain alpha/beta sandwich with a deep interdomain cleft. The N-terminal substrate-binding domain forms a three layer alpha-beta-alpha sandwich, while the C-terminal NADP-binding domain forms a nearly typical Rossman fold. The active site is thought to be located within the interdomain cleft, with substrate binding causing a conformational change which closes the active site cleft, forming a productive active site.; GO: 0004764 shikimate 5-dehydrogenase activity, 0050661 NADP binding.
Probab=97.68  E-value=0.00027  Score=48.87  Aligned_cols=76  Identities=29%  Similarity=0.510  Sum_probs=60.4

Q ss_pred             CCC-CCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHH-----CCCCEEEEECCCCCHHHHHHHHH
Q ss_conf             248-899999389986889999999988-99899997898999999999986-----49928999878999999999999
Q gi|254780337|r   15 NLD-NRLALVTGSSRGIGYYTALELARS-GAYVIACGRSISQLEKLKNALQK-----INKKIDIFAFDLRDSNALELTKT   87 (257)
Q Consensus        15 ~l~-~K~alVTGas~GIG~a~a~~la~~-G~~Vi~~~r~~~~l~~~~~~~~~-----~g~~~~~~~~Dv~d~~~v~~~~~   87 (257)
                      .|. +|.+||-||+ |=+++++..|++. +.+|+++.|..++++++.+.++.     +|. +.++..|            
T Consensus       117 ~l~~~~~~li~GAG-GAa~a~a~~L~~~t~~~~~i~NRT~~ka~~La~~~~~kln~~~G~-~~~~~~~------------  182 (286)
T TIGR00507       117 KLKPNQRVLIIGAG-GAAKAVALELLKATDCNVIIANRTVEKAEELAERFQRKLNKKYGE-IQAFSLD------------  182 (286)
T ss_pred             CCCCCCEEEEEECC-HHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHCCC-EEEEECC------------
T ss_conf             36899779999428-678999999986009978998287789999999989885342485-3652113------------


Q ss_pred             HHHHHHCCCCEEEECCC
Q ss_conf             99998189879987687
Q gi|254780337|r   88 YIAKRWGKLDILIANAG  104 (257)
Q Consensus        88 ~~~~~~g~iDilVNNAG  104 (257)
                      ++..+-|.+|++||.-.
T Consensus       183 ~~~l~~G~~DlIINATs  199 (286)
T TIGR00507       183 EVPLHKGKVDLIINATS  199 (286)
T ss_pred             CCCCCCCCEEEEEECCC
T ss_conf             35555785679985467


No 272
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann
Probab=97.65  E-value=0.00079  Score=45.72  Aligned_cols=77  Identities=19%  Similarity=0.381  Sum_probs=59.7

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             6524889999938998688999999998899-899997898999999999986499289998789999999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      ..++++|.|+|-|+ +|-+++++..|++.|+ +|.+..|+.++.+++.+.++.........  |             ..+
T Consensus        14 ~~~~~~k~vlIlGa-GGaarai~~aL~~~g~~~I~i~nR~~~r~~~l~~~~~~~~~~~~~~--~-------------~~~   77 (155)
T cd01065          14 GIELKGKKVLILGA-GGAARAVAYALAELGAAKIVIVNRTLEKAKALAERFGELGIAIAYL--D-------------LEE   77 (155)
T ss_pred             CCCCCCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEC--C-------------HHH
T ss_conf             99857999999867-5899999999997199822886089999999999850136640104--5-------------344


Q ss_pred             HHCCCCEEEECCCC
Q ss_conf             81898799876875
Q gi|254780337|r   92 RWGKLDILIANAGI  105 (257)
Q Consensus        92 ~~g~iDilVNNAGi  105 (257)
                      .....|++||+--+
T Consensus        78 ~~~~~dliIN~tp~   91 (155)
T cd01065          78 LLAEADLIINTTPV   91 (155)
T ss_pred             HHCCCCEEEECCCC
T ss_conf             31568879876778


No 273
>smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases.
Probab=97.59  E-value=0.00062  Score=46.42  Aligned_cols=79  Identities=20%  Similarity=0.256  Sum_probs=55.0

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--
Q ss_conf             889999938998688999999998899899997898999999999986499289998789999999999999999818--
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG--   94 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g--   94 (257)
                      .|+++||+||++|+|.+..+.....|++|+.+.+++++++.+    ++.|.... +..|-.+++-.+.    +.+..+  
T Consensus       104 ~g~~VlI~gg~G~vG~~aiqlak~~Ga~Vi~t~~s~~k~~~~----~~lG~~~~-~v~~~~~~~~~~~----v~~~t~g~  174 (288)
T smart00829      104 PGESVLIHAAAGGVGQAAIQLAQHLGAEVFATAGSPEKRDFL----RELGIPDD-HIFSSRDLSFADE----ILRATGGR  174 (288)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHH----HHCCCCCC-EEEECCCCCHHHH----HHHHHCCC
T ss_conf             999999978986777999999997398300340888999999----97699960-7621799509999----99870898


Q ss_pred             CCCEEEECCC
Q ss_conf             9879987687
Q gi|254780337|r   95 KLDILIANAG  104 (257)
Q Consensus        95 ~iDilVNNAG  104 (257)
                      ++|+++++.|
T Consensus       175 gvDvv~d~vg  184 (288)
T smart00829      175 GVDVVLNSLA  184 (288)
T ss_pred             CCEEEEECCC
T ss_conf             8279998986


No 274
>PRK05865 hypothetical protein; Provisional
Probab=97.51  E-value=0.00096  Score=45.17  Aligned_cols=102  Identities=23%  Similarity=0.215  Sum_probs=76.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
                      -++|||+++-+|+.++.+|...|..|+-++|...+         ..-..+.|+++|+.|+..++.+.       ..-|.+
T Consensus         2 ~i~VT~A~G~lGR~va~qLia~GH~V~GIAr~r~~---------~~~~~~DFV~A~iRd~~~~~~a~-------~~AD~V   65 (854)
T PRK05865          2 RIAVTGASGVLGRGLTARLLSQGHEVVGIARHRPD---------SWPSSADFIAADIRDATAVESAM-------TGADVV   65 (854)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCC---------CCCCCCCEEECCCCCHHHHHHHH-------CCCCEE
T ss_conf             37883362157778999998668724554057986---------56755666632334789998752-------466548


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             87687588888867659999999999998999999999999998608986999788
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSS  155 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS  155 (257)
                      +|+|=+ ...             --++|+.|.-    .++.-|.+.+.++|++-+|
T Consensus        66 ~H~A~~-~~~-------------~~~~~idG~a----~V~~A~a~aG~r~i~~sqs  103 (854)
T PRK05865         66 AHCAWV-RGR-------------NDHINIDGTA----NVLKAMAETGTGRIVFTSS  103 (854)
T ss_pred             EEECCC-CCC-------------CCCCCCHHHH----HHHHHHHHHCCCEEEEECC
T ss_conf             983121-588-------------7644627688----9999998618836998158


No 275
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]
Probab=97.47  E-value=0.0011  Score=44.89  Aligned_cols=78  Identities=24%  Similarity=0.428  Sum_probs=58.4

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             524889999938998688999999998899-8999978989999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .+.++|.++|-||+ |-+++++..|++.|+ +|.+..|+.++++++++.+.+.+..+..  .+..+.+..+         
T Consensus       122 ~~~~~~~vlilGAG-GAarAv~~aL~~~g~~~i~V~NRt~~ra~~La~~~~~~~~~~~~--~~~~~~~~~~---------  189 (283)
T COG0169         122 VDVTGKRVLILGAG-GAARAVAFALAEAGAKRITVVNRTRERAEELADLFGELGAAVEA--AALADLEGLE---------  189 (283)
T ss_pred             CCCCCCEEEEECCC-HHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCC--CCCCCCCCCC---------
T ss_conf             56678889998976-89999999999869987999958889999999986450563110--2455412355---------


Q ss_pred             HCCCCEEEECCCC
Q ss_conf             1898799876875
Q gi|254780337|r   93 WGKLDILIANAGI  105 (257)
Q Consensus        93 ~g~iDilVNNAGi  105 (257)
                        ..|++||.-.+
T Consensus       190 --~~dliINaTp~  200 (283)
T COG0169         190 --EADLLINATPV  200 (283)
T ss_pred             --CCCEEEECCCC
T ss_conf             --45789978878


No 276
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=97.43  E-value=0.0018  Score=43.26  Aligned_cols=107  Identities=16%  Similarity=0.144  Sum_probs=69.2

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      .++++||+||++|+|....+..-..|++|+.+.+++++++.+    .+.|....   .|..+++-++.+. +.. .-..+
T Consensus       140 ~g~~vLi~gaaGgVG~~avQlAk~~Ga~Vi~t~~s~~k~e~~----~~lGA~~v---i~~~~~~~~~~i~-~~t-~g~gv  210 (327)
T PRK10754        140 PDEQFLFHAAAGGVGLIACQWAKALGAKLIGTVGSAQKAQRA----LKAGAWQV---INYREENIVERVK-EIT-GGKKV  210 (327)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCCCEE---EECCCCCHHHHHH-HHH-CCCCC
T ss_conf             999999981776112689999998699999998989999999----96699999---9899999999999-986-89983


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC  161 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~  161 (257)
                      |+++...|-  .  .+ +       .               .+..+  ++.|++|.+++.++...
T Consensus       211 dvv~D~vG~--~--~~-~-------~---------------~~~~l--~~~G~iv~~G~~~~~~~  246 (327)
T PRK10754        211 RVVYDSVGK--D--TW-E-------A---------------SLDCL--QRRGLMVSFGNASGPVT  246 (327)
T ss_pred             EEEEECCCH--H--HH-H-------H---------------HHHHH--HCCCEEEEEECCCCCCC
T ss_conf             699989888--9--99-9-------9---------------99986--34989999806889866


No 277
>PRK13771 putative alcohol dehydrogenase; Provisional
Probab=97.38  E-value=0.00093  Score=45.26  Aligned_cols=163  Identities=18%  Similarity=0.215  Sum_probs=88.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      .|+++||+|+++|+|...++.....|++|+.+++++++++.+.    +.+..+ .   |-.+       +.+-.++.+.+
T Consensus       162 ~g~~VlI~Ga~G~vG~~aiqlak~~Ga~vi~v~~~~~k~~~~~----~~~~~~-i---~~~~-------~~~~~~~~~g~  226 (332)
T PRK13771        162 EGETVLVTGAGGGVGIHAVQVAKAYGAKVIAVTTSESKAKAVG----KYADYV-I---VGSK-------FSEEVKKLGGA  226 (332)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCCCEE-E---ECCC-------HHHHHHHCCCC
T ss_conf             9999999778775899999999986998999949999999998----569989-8---3630-------57888734686


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
                      |+++.+.|.     +       .+               +..+..+  +.+|+++.+++...... +.-..+        
T Consensus       227 Dvvid~~G~-----~-------~~---------------~~~~~~l--~~~G~iv~~G~~~~~~~-~~~~~~--------  268 (332)
T PRK13771        227 DIVIETVGG-----P-------TL---------------EESLRSL--NWGGKIVLIGNVDPSPA-SLRLGL--------  268 (332)
T ss_pred             CEEEECCCH-----H-------HH---------------HHHHHHH--CCCCEEEEEECCCCCCC-CCCHHH--------
T ss_conf             389845766-----8-------89---------------9888862--58969999934578757-645899--------


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHH--HHCCCCC----CCCCCCHHHHHHHHHHHHCHHHCCCCCEEE
Q ss_conf             9999999985443869975532883797798--4414443----245888899999999961975626685798
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRA--KAMPAED----PNTVPHPQKVAKIISFLCATQKIETGKLFS  244 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~--~~~~~~~----~~~~~~pediA~~v~fL~s~~~~~tG~~~~  244 (257)
                               +..+++++.....+. ..++.+  +.+....    ..+.-.-+|+.++...+.+.  -..|+++.
T Consensus       269 ---------~~~k~~~i~g~~~~~-~~~~~~~~~l~~~g~i~~~i~~~~~l~~~~~A~~~l~~~--~~~GKvVl  330 (332)
T PRK13771        269 ---------LILKDIEILGHISAT-KKDVEEALKLVAEGKIKPVIAGHVSLSDIDKALEMLKDK--SHIGRILV  330 (332)
T ss_pred             ---------HHHCCCEEEEEECCC-HHHHHHHHHHHHCCCCEEEEEEEEEHHHHHHHHHHHHCC--CCCEEEEE
T ss_conf             ---------986687899985578-999999999998699864572798289999999999779--98657999


No 278
>KOG0747 consensus
Probab=97.26  E-value=0.0023  Score=42.64  Aligned_cols=210  Identities=18%  Similarity=0.177  Sum_probs=127.0

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCC--CEEEEEEC-C-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             8999993899868899999999889--98999978-9-899999999998649928999878999999999999999981
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSG--AYVIACGR-S-ISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G--~~Vi~~~r-~-~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      -|.++|||+..=||.-.+..++..=  ++.+..+. + -..++.+.+ +. ..++..++..|+.++..+...+..-    
T Consensus         6 ~~~vlItgg~gfi~Sn~~~~~~~~~p~~~~v~idkL~~~s~~~~l~~-~~-n~p~ykfv~~di~~~~~~~~~~~~~----   79 (331)
T KOG0747           6 EKNVLITGGAGFIGSNFINYLVDKYPDYKFVNLDKLDYCSNLKNLEP-VR-NSPNYKFVEGDIADADLVLYLFETE----   79 (331)
T ss_pred             CCEEEEECCCCCCCHHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHH-HC-CCCCCEEEECHHCCCHHHHHHHCCC----
T ss_conf             56089854767531134553346799877787620000243135443-12-5887168603010509987653367----


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC--CC---------C
Q ss_conf             898799876875888888676599999999999989999999999999986089869997883564--78---------8
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAY--KC---------R  162 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~--~~---------~  162 (257)
                       ++|.++|-|..+...  ..-.  +-+ .....|+.++..+...+.-.-   +--+.|.+|+-..+  ..         .
T Consensus        80 -~id~vihfaa~t~vd--~s~~--~~~-~~~~nnil~t~~Lle~~~~sg---~i~~fvhvSTdeVYGds~~~~~~~E~s~  150 (331)
T KOG0747          80 -EIDTVIHFAAQTHVD--RSFG--DSF-EFTKNNILSTHVLLEAVRVSG---NIRRFVHVSTDEVYGDSDEDAVVGEASL  150 (331)
T ss_pred             -CHHHHHHHHHHHHHH--HHHC--CHH-HHHCCCCHHHHHHHHHHHHCC---CEEEEEEECCCCEECCCCCCCCCCCCCC
T ss_conf             -157777677664146--6507--658-774576034577999988504---7347999646402347664456332256


Q ss_pred             C-CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEC------CCCCCCHHHHHHCC------CC-------CCCCCCCHH
Q ss_conf             9-8368898999999999999998544386997553------28837977984414------44-------324588889
Q gi|254780337|r  163 P-LWGAYSASKAAIEALARTWSKETVNTALRVINID------PGPTRTSMRAKAMP------AE-------DPNTVPHPQ  222 (257)
Q Consensus       163 ~-~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~------PG~v~T~m~~~~~~------~~-------~~~~~~~pe  222 (257)
                      + -..+|++||+|...+.+++...+   |+-+..+.      |+...+....+...      .-       ....+..-|
T Consensus       151 ~nPtnpyAasKaAaE~~v~Sy~~sy---~lpvv~~R~nnVYGP~q~~~klipkFi~l~~~~~~~~i~g~g~~~rs~l~ve  227 (331)
T KOG0747         151 LNPTNPYAASKAAAEMLVRSYGRSY---GLPVVTTRMNNVYGPNQYPEKLIPKFIKLAMRGKEYPIHGDGLQTRSYLYVE  227 (331)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHC---CCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCEECCCCCCEEEEEHH
T ss_conf             8999803788999999999987604---9717999415733888571677688999997189764215741012257699


Q ss_pred             HHHHHHHHHHCHHHCCCCCEEEECC
Q ss_conf             9999999961975626685798768
Q gi|254780337|r  223 KVAKIISFLCATQKIETGKLFSVPQ  247 (257)
Q Consensus       223 diA~~v~fL~s~~~~~tG~~~~vdg  247 (257)
                      |+++++.-.+  ++-..|+++++--
T Consensus       228 D~~ea~~~v~--~Kg~~geIYNIgt  250 (331)
T KOG0747         228 DVSEAFKAVL--EKGELGEIYNIGT  250 (331)
T ss_pred             HHHHHHHHHH--HCCCCCCEEECCC
T ss_conf             9999999998--4578562364168


No 279
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed
Probab=97.20  E-value=0.0041  Score=40.92  Aligned_cols=75  Identities=17%  Similarity=0.327  Sum_probs=55.8

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             524889999938998688999999998899-8999978989999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      .++++|.++|-|++ |-+++++..|++.|. +|.+..|+.++++++.+.+..   .+..     ...+       .....
T Consensus       118 ~~~~~k~vlIlGaG-Gaarai~~al~~~g~~~i~i~nR~~~~a~~l~~~~~~---~~~~-----~~~~-------~~~~~  181 (275)
T PRK00258        118 LDLKGKRILLLGAG-GAARAVILPLLELGVAEITIVNRTVERAEELAELFGE---GVQA-----LGLD-------ELAGE  181 (275)
T ss_pred             CCCCCCEEEEECCC-CHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCC---CCCE-----EEHH-------HHHHC
T ss_conf             78568759998887-1079999999976999899995899999999998356---7627-----5378-------75430


Q ss_pred             HCCCCEEEECCC
Q ss_conf             189879987687
Q gi|254780337|r   93 WGKLDILIANAG  104 (257)
Q Consensus        93 ~g~iDilVNNAG  104 (257)
                      ....|++||+.-
T Consensus       182 ~~~~diiInaTp  193 (275)
T PRK00258        182 LADFDLIINTTS  193 (275)
T ss_pred             CCCCCEEEECCC
T ss_conf             445777996577


No 280
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]
Probab=97.18  E-value=0.0082  Score=38.94  Aligned_cols=101  Identities=23%  Similarity=0.310  Sum_probs=65.1

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH-C-C
Q ss_conf             8999993899868899999999889989999789899999999998649928999878999999999999999981-8-9
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW-G-K   95 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~-g-~   95 (257)
                      |+++||+||++|+|....+...+.|++++++..+.++.+ .   +.+.|....   .|..+++    +.+++.+-. | .
T Consensus       143 g~~VLv~gaaGgVG~~aiQlAk~~G~~~v~~~~s~~k~~-~---~~~lGAd~v---i~y~~~d----~~~~v~~~t~g~g  211 (326)
T COG0604         143 GETVLVHGAAGGVGSAAIQLAKALGATVVAVVSSSEKLE-L---LKELGADHV---INYREED----FVEQVRELTGGKG  211 (326)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHH-H---HHHCCCCEE---EECCCCC----HHHHHHHHHCCCC
T ss_conf             997999778546999999999984995899981757889-9---987399889---7056424----8999999837998


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH
Q ss_conf             879987687588888867659999999999998999999999999998608986999788356
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA  158 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g  158 (257)
                      +|++++..|.            +.|.               ..+..+  +..|+++.++..++
T Consensus       212 vDvv~D~vG~------------~~~~---------------~~l~~l--~~~G~lv~ig~~~g  245 (326)
T COG0604         212 VDVVLDTVGG------------DTFA---------------ASLAAL--APGGRLVSIGALSG  245 (326)
T ss_pred             CCEEEECCCH------------HHHH---------------HHHHHH--CCCCEEEEEECCCC
T ss_conf             7889979867------------9999---------------999974--25958999806887


No 281
>PRK12549 shikimate 5-dehydrogenase; Reviewed
Probab=97.11  E-value=0.0081  Score=38.98  Aligned_cols=77  Identities=14%  Similarity=0.113  Sum_probs=55.8

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             24889999938998688999999998899-89999789899999999998649928999878999999999999999981
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ++++|.++|-|+ +|-+++++..|.+.|+ ++.+.+|+.++.+++.+.+.......     ++....+++       +..
T Consensus       124 ~~~~~~vlilGa-GGaa~ai~~al~~~g~~~i~I~nR~~~r~~~l~~~l~~~~~~~-----~~~~~~~~~-------~~~  190 (284)
T PRK12549        124 DASLERVVQLGA-GGAGAAVAHALLTLGVERLTLFDVDPARAQALADELNARFPAA-----RVTAGSDLA-------AAL  190 (284)
T ss_pred             CCCCCEEEEECC-CCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCC-----EEEECHHHH-------HHH
T ss_conf             535571899656-6168999999997699989999798899999999998657986-----376416767-------654


Q ss_pred             CCCCEEEECCC
Q ss_conf             89879987687
Q gi|254780337|r   94 GKLDILIANAG  104 (257)
Q Consensus        94 g~iDilVNNAG  104 (257)
                      +..|++||+--
T Consensus       191 ~~~d~iINaTp  201 (284)
T PRK12549        191 AAADGLVHATP  201 (284)
T ss_pred             HHCCEEEECCC
T ss_conf             21382665789


No 282
>PRK12548 shikimate 5-dehydrogenase; Provisional
Probab=97.08  E-value=0.0093  Score=38.56  Aligned_cols=83  Identities=17%  Similarity=0.226  Sum_probs=58.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCE-EEEEECCH---HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             5248899999389986889999999988998-99997898---9999999999864992899987899999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAY-VIACGRSI---SQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~~---~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      .++++|.++|-|++ |-+++++..++..|++ +.+..|+.   ++++++.+.+.+..+.......|+.+.+.+..     
T Consensus       122 ~~~~~k~vlIlGaG-Gaa~ai~~~l~~~g~~~i~i~nr~~~~~~ra~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----  195 (289)
T PRK12548        122 VDVKGKKLTIIGAG-GAATAIQVQCALDGAKEITIFNIKDDFYERAEQTVAKIKEEVPACIVHVYDLNDTEKLNA-----  195 (289)
T ss_pred             CCCCCCEEEEEECC-HHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHH-----
T ss_conf             99677747999521-679999999997699889999688148899999999998458776479851431666655-----


Q ss_pred             HHHHCCCCEEEECCC
Q ss_conf             998189879987687
Q gi|254780337|r   90 AKRWGKLDILIANAG  104 (257)
Q Consensus        90 ~~~~g~iDilVNNAG  104 (257)
                        .....|++||.--
T Consensus       196 --~~~~~dliINaT~  208 (289)
T PRK12548        196 --EIATSDILVNATL  208 (289)
T ss_pred             --HHCCCCEEEECCC
T ss_conf             --4322674453356


No 283
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=97.07  E-value=0.024  Score=35.81  Aligned_cols=194  Identities=17%  Similarity=0.169  Sum_probs=101.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH------HHHH
Q ss_conf             9999389986889999999988998999978989999999999864992899987899999999999999------9981
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI------AKRW   93 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~------~~~~   93 (257)
                      .+-|-|+ +=+|..+|..|+..|+.|.+.|++++.+++..+.+.+.-.+  ....+..+.++.+.....+      .+..
T Consensus         4 ~VaViGa-G~mG~giA~~~a~~G~~V~l~D~~~~~l~~a~~~i~~~l~~--~~~~g~~~~~~~~~~~~ri~~~~~l~~al   80 (308)
T PRK06129          4 SIAIVGA-GLIGRAWAIVFARAGHRVRLWDADPAALAAAPAYIAGRLED--LAAFDLLDGESPDAVLARIRATDSLADAV   80 (308)
T ss_pred             EEEEECC-CHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHH--HHHCCCCCHHHHHHHHHCEEECCCHHHHH
T ss_conf             7999777-89999999999858993899989889999999999999999--99769998765999983507228889984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHH---HH-----HHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCC
Q ss_conf             898799876875888888676599999999999---98-----9999999999999986089869997883564788983
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISV---NV-----MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLW  165 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~v---Nl-----~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~  165 (257)
                      ...|.++-++  ..+    .++..+-|.+.-.+   +.     ++.+-.+ .+...+  ++..|++..        .|+.
T Consensus        81 ~~adlViEav--~E~----l~iK~~lf~~le~~~~~~~IlaSnTSsl~is-~la~~~--~~p~R~ig~--------HffN  143 (308)
T PRK06129         81 ADADYVQESA--PEN----LELKRALFAELDALAPPHAILASSTSALLAS-AFTEHL--AGRERCLVA--------HPIN  143 (308)
T ss_pred             CCCCEEEECC--CCC----HHHHHHHHHHHHHHCCCCEEEEECCCCCCHH-HHHHHC--CCCCCEEEE--------CCCC
T ss_conf             7499999998--077----9999999999996569855898455538899-999745--985417887--------7778


Q ss_pred             HHH----------HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC---CCCCCCCHHHHHHHHHHHH
Q ss_conf             688----------989999999999999985443869975532883797798441444---3245888899999999961
Q gi|254780337|r  166 GAY----------SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE---DPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       166 ~~Y----------~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~---~~~~~~~pediA~~v~fL~  232 (257)
                      ++|          .-|--.+...++.+..+++..-|.|+-=.||++-.-++...+.+.   -...+..||||=.++.+=+
T Consensus       144 Pp~l~pLVEIV~g~~Ts~~~v~~~~~~~~~lGk~PV~v~ke~pGFi~NRl~~a~~~EA~~Lv~eGvas~edID~a~~~G~  223 (308)
T PRK06129        144 PPYLIPVVEVVPAPWTAPATVARAHALYRAAGQSPVRLRREIDGFVLNRLQGALLREAFRLVADGVASVEDIDAVIRDGL  223 (308)
T ss_pred             CHHCCCCEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCC
T ss_conf             60006315671799989899999999999839988999025621589999999999999999859989999999998089


Q ss_pred             C
Q ss_conf             9
Q gi|254780337|r  233 A  233 (257)
Q Consensus       233 s  233 (257)
                      .
T Consensus       224 G  224 (308)
T PRK06129        224 G  224 (308)
T ss_pred             C
T ss_conf             9


No 284
>PRK00066 ldh L-lactate dehydrogenase; Reviewed
Probab=96.95  E-value=0.02  Score=36.40  Aligned_cols=111  Identities=21%  Similarity=0.247  Sum_probs=69.0

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHC---CCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             889999938998688999999998899--8999978989999999999864---99289998789999999999999999
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGA--YVIACGRSISQLEKLKNALQKI---NKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~--~Vi~~~r~~~~l~~~~~~~~~~---g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
                      .+|+++| |+ +++|..+|..|+..|.  .+++.|+++++++.....++..   .........   |.++          
T Consensus         6 ~~KI~II-Ga-G~VG~~~a~~l~~~~l~~el~LiD~~~~~a~g~a~Dl~h~~~~~~~~~i~~g---dy~~----------   70 (315)
T PRK00066          6 HNKVVLV-GD-GAVGSSYAYALVNQGIADELVIIDINKEKAEGDAMDLSHAVPFTSPTKIYAG---DYSD----------   70 (315)
T ss_pred             CCEEEEE-CC-CHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEEC---CHHH----------
T ss_conf             9849999-97-9889999999986699888999808987107899988854123688479739---9999----------


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEEC
Q ss_conf             81898799876875888888676599999999999989999999999999986089-8699978
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHC-GRAIILS  154 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~-G~IInis  154 (257)
                       ...-|++|..||.....+   + +   -.+.++.|.    .+.+...|.+.+... +.+++++
T Consensus        71 -~~daDvVVitAG~~~k~g---~-t---R~dll~~N~----~I~~~i~~~i~~~~p~~i~ivvt  122 (315)
T PRK00066         71 -CKDADLVVITAGAPQKPG---E-T---RLDLVEKNL----KIFKSIVGEVMASGFDGIFLVAS  122 (315)
T ss_pred             -HCCCCEEEECCCCCCCCC---C-C---HHHHHHHHH----HHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             -679999998999989999---9-8---789998789----99999887764248853999936


No 285
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated
Probab=96.95  E-value=0.013  Score=37.57  Aligned_cols=106  Identities=22%  Similarity=0.247  Sum_probs=67.3

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             524889999938998688999999998899-8999978989999999999864992899987899999999999999998
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      ..+.|++++|+|+ +++|...++.+-..|+ +|+++++++++++..+    +.|...   ..|.++++ +.+.+..... 
T Consensus       160 ~~~~g~~VlV~Ga-G~vGl~~~~~ak~~Ga~~Vi~~d~~~~kl~~a~----~lGa~~---~i~~~~~~-~~~~~~~~t~-  229 (341)
T PRK05396        160 FDLVGEDVLITGA-GPIGIMAAAVAKHVGARHVVITDVNEYRLELAR----KMGATR---AVNVAKED-LRDVMAELGM-  229 (341)
T ss_pred             CCCCCCEEEEECC-CCCCHHHHHHHHHCCCEEEEEEECCHHHHHHHH----HCCCCE---EEECCCHH-HHHHHHHHHC-
T ss_conf             5778886999899-754329999999849928999948999999898----649949---99688506-8999999748-


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH
Q ss_conf             18987998768758888886765999999999999899999999999999860898699978835
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGA  157 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~  157 (257)
                      -..+|+++...|. .  ..                       .+..+..+  +.+|+++.++...
T Consensus       230 ~~G~Dvvid~~G~-~--~~-----------------------~~~~~~~l--~~gG~vv~~G~~~  266 (341)
T PRK05396        230 TEGFDVGLEMSGA-P--SA-----------------------FRQMLDAM--NHGGRIAMLGIPP  266 (341)
T ss_pred             CCCCEEEEECCCC-H--HH-----------------------HHHHHHHH--HCCCEEEEEECCC
T ss_conf             9997699987898-9--99-----------------------99999986--3598999995579


No 286
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=96.94  E-value=0.019  Score=36.44  Aligned_cols=97  Identities=27%  Similarity=0.289  Sum_probs=64.9

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      .|+.++|+|.+ |+|--..+.....|++|+..+|++++++..+    +.|.... +  |-+|++..+.+.+.       +
T Consensus       166 pG~~V~I~G~G-GlGh~avQ~Aka~ga~Via~~~~~~K~e~a~----~lGAd~~-i--~~~~~~~~~~~~~~-------~  230 (339)
T COG1064         166 PGKWVAVVGAG-GLGHMAVQYAKAMGAEVIAITRSEEKLELAK----KLGADHV-I--NSSDSDALEAVKEI-------A  230 (339)
T ss_pred             CCCEEEEECCC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HHCCCEE-E--ECCCCHHHHHHHHH-------C
T ss_conf             99899998774-8999999999986996999957877999999----8488289-9--76781166776734-------7


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH
Q ss_conf             7998768758888886765999999999999899999999999999860898699978835
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGA  157 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~  157 (257)
                      |+.|+.++ ..   .+.                       ..++.+  +..|+++.++-..
T Consensus       231 d~ii~tv~-~~---~~~-----------------------~~l~~l--~~~G~~v~vG~~~  262 (339)
T COG1064         231 DAIIDTVG-PA---TLE-----------------------PSLKAL--RRGGTLVLVGLPG  262 (339)
T ss_pred             CEEEECCC-HH---HHH-----------------------HHHHHH--HCCCEEEEECCCC
T ss_conf             39999877-45---599-----------------------999986--4297899978888


No 287
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated
Probab=96.94  E-value=0.0015  Score=43.90  Aligned_cols=83  Identities=24%  Similarity=0.301  Sum_probs=58.8

Q ss_pred             ECCCCCEEEEECC----------------CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             5248899999389----------------986889999999988998999978989999999999864992899987899
Q gi|254780337|r   14 VNLDNRLALVTGS----------------SRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR   77 (257)
Q Consensus        14 ~~l~~K~alVTGa----------------s~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~   77 (257)
                      -+|+||.+|||+|                |+-.|+++|+.+...|++|.+..-...        +. ....+..+  .+.
T Consensus       182 ~~l~gkkvLITaG~T~E~IDpVR~IsN~SSGkmG~aiA~~a~~~GA~VtlI~g~~~--------~~-~p~~v~~i--~v~  250 (392)
T PRK05579        182 KDLAGKRVLITAGPTREPIDPVRYITNRSSGKMGYALARAAARRGADVTLVSGPVN--------LP-TPAGVKRI--DVE  250 (392)
T ss_pred             CCCCCCEEEEECCCCEEEECCEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCC--------CC-CCCCCEEE--EEC
T ss_conf             77678879997477247767624766578658999999999967997999964787--------78-99996799--967


Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             9999999999999981898799876875888888
Q gi|254780337|r   78 DSNALELTKTYIAKRWGKLDILIANAGILGSISP  111 (257)
Q Consensus        78 d~~~v~~~~~~~~~~~g~iDilVNNAGi~~~~~~  111 (257)
                         +.+++.+.+.+.+...|++|.+|++. ++.|
T Consensus       251 ---ta~eM~~~v~~~~~~~D~~I~aAAVs-Df~p  280 (392)
T PRK05579        251 ---SAQEMLDAVLAAAQKADIFIMAAAVA-DYRP  280 (392)
T ss_pred             ---CHHHHHHHHHHHCCCCCEEEEEEEEC-CEEE
T ss_conf             ---59999999997354478999930110-0011


No 288
>PRK12749 quinate/shikimate dehydrogenase; Reviewed
Probab=96.93  E-value=0.013  Score=37.60  Aligned_cols=84  Identities=18%  Similarity=0.197  Sum_probs=55.9

Q ss_pred             EECCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHCCC--CEEEEECCCCCHHHHHHHHHHH
Q ss_conf             6524889999938998688999999998899-899997898999999999986499--2899987899999999999999
Q gi|254780337|r   13 HVNLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINK--KIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        13 ~~~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~g~--~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      ..++++|.++|-||+ |-+++++..++..|+ +|.++.|+.+.++++....+..+.  .......++.|+.....     
T Consensus       119 ~~~~~~k~~lIlGaG-Gaa~Ai~~~l~~~g~~~i~i~nR~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~-----  192 (288)
T PRK12749        119 GFDIKGKTMVLLGAG-GASTAIGAQGAIEGLKEIKLFNRRDEFFDKALAFAQRVNENTDCVVTVTDLADQQAFAE-----  192 (288)
T ss_pred             CCCCCCCEEEEEECC-HHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHH-----
T ss_conf             998567768998234-58899999999769987999968855789999999986322575577434101456776-----


Q ss_pred             HHHHCCCCEEEECCC
Q ss_conf             998189879987687
Q gi|254780337|r   90 AKRWGKLDILIANAG  104 (257)
Q Consensus        90 ~~~~g~iDilVNNAG  104 (257)
                        .....|++||.--
T Consensus       193 --~~~~~dliiN~Tp  205 (288)
T PRK12749        193 --ALASADILTNGTK  205 (288)
T ss_pred             --HHCCCCEEECCCC
T ss_conf             --5134655523645


No 289
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family; InterPro: IPR014189   Members of this family are putative quinone oxidoreductases that belong to the broader superfamily of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxidoreductases. An alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, consequently members of this entry are likely to be quinone oxidoreductases. A member of this family in Homo sapiens (Human), PIG3, is induced by p53 but is otherwise uncharacterised..
Probab=96.92  E-value=0.0064  Score=39.67  Aligned_cols=174  Identities=17%  Similarity=0.209  Sum_probs=109.6

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      .|-|+||=|+|||||-.--+.--+.|++|+.|..+.||++...   +++|..   ...|.++++=++.+-++.... ..+
T Consensus       144 ~GEtvLiHGGaSGIGttAIqLAKA~Ga~V~~TaGS~eK~~~a~---~~LGAd---~aINY~e~DFve~~k~~t~g~-kGv  216 (334)
T TIGR02824       144 AGETVLIHGGASGIGTTAIQLAKAFGARVFTTAGSDEKCATAC---EALGAD---IAINYREEDFVEVVKEETGGG-KGV  216 (334)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHH---HHCCCE---EEEECCCCCHHHHHHHHCCCC-CCC
T ss_conf             8972899713673679999999856975999828989999999---860980---786077734799999826899-853


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-CCCCHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478-89836889899999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC-RPLWGAYSASKAAI  175 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~-~~~~~~Y~asKaal  175 (257)
                      |+++=..|- ..               ++=|+.       .+      ...||||.|+.+-|... .-++.         
T Consensus       217 DVILD~vGg-~Y---------------l~~N~~-------al------A~dGRlV~Ig~~gG~~A~e~dL~---------  258 (334)
T TIGR02824       217 DVILDIVGG-SY---------------LARNIK-------AL------ALDGRLVQIGFQGGAKAEELDLG---------  258 (334)
T ss_pred             CEEEECCCH-HH---------------HHHHHH-------HH------HCCCCEEEEECCCCCCCCCCCHH---------
T ss_conf             179857766-88---------------998999-------98------40793999850678320116848---------


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCC-CCH------HHHHHCCCCCCC-------CCCCHHHHHHHHHHHHCHHHCCCCC
Q ss_conf             99999999985443869975532883-797------798441444324-------5888899999999961975626685
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPT-RTS------MRAKAMPAEDPN-------TVPHPQKVAKIISFLCATQKIETGK  241 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v-~T~------m~~~~~~~~~~~-------~~~~pediA~~v~fL~s~~~~~tG~  241 (257)
                          +-|++..   -++=.++-|=++ +-.      +.++.+|--..+       +.-.-+|++++=..|-  ++-.+|+
T Consensus       259 ----~Ll~KR~---~~tGSTLR~R~~G~~KA~Ia~~l~~~VWPll~~G~~~P~I~~~fpL~~A~~AH~~me--~g~h~GK  329 (334)
T TIGR02824       259 ----PLLAKRL---TITGSTLRARPVGAEKAAIAAELREQVWPLLASGRVRPVIDKVFPLEDAAKAHALME--SGDHIGK  329 (334)
T ss_pred             ----HHHHHHH---HHEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCHHHHHHHHHHHH--CCCCCCE
T ss_conf             ----9998875---430102589883589999999988873046665852578421079899999999974--5896014


Q ss_pred             EEE
Q ss_conf             798
Q gi|254780337|r  242 LFS  244 (257)
Q Consensus       242 ~~~  244 (257)
                      ++.
T Consensus       330 iVL  332 (334)
T TIGR02824       330 IVL  332 (334)
T ss_pred             EEE
T ss_conf             774


No 290
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432   Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is found together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologues of PfaA, also included in this entry, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis; an alternative to the more familiar iterated mechanism of chain extension and desaturation, and like PfaA the more distant homologues are likewise found near genes for homologues of PfaB, PfaC, and/or PfaD..
Probab=96.89  E-value=0.045  Score=34.01  Aligned_cols=180  Identities=13%  Similarity=0.098  Sum_probs=128.7

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      .+..++|.+=.++=--.+++.|.+.|++|.+. |+..-.-..+   ......+..+...--|.+.++..++.+.++-..|
T Consensus      1900 ~~~~~~Vi~Ddg~~A~~la~~L~~~G~~Va~v-~s~~~v~~s~---~~l~s~i~~~~l~~~D~~~~~~~i~dI~~~~~~~ 1975 (2773)
T TIGR02813      1900 SKEAAVVIDDDGHNAGVLAEKLIAAGLQVAVV-RSPKVVVSSA---SPLDSEIASVTLEAIDDESIEAVIKDIEEKTAQI 1975 (2773)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHCCCEEEEE-CCCCEEECCC---CHHHCCEEEEEEHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             23535888248852899999998689589997-3883222000---1000120025401120268999999999855443


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCHHHCCCCCCCHH--------
Q ss_conf             7998768758888886765999999999999899999999999999860-8986999788356478898368--------
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS-HCGRAIILSSGAAYKCRPLWGA--------  167 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~-~~G~IInisS~~g~~~~~~~~~--------  167 (257)
                      +.+|+==..... ......+-=.+...-.--+.-.|.+.|..-+.+..+ ...+.+.++-.-|-.|+.+.-.        
T Consensus      1976 ~g~I~LQ~l~~~-~~ad~~~a~~l~~~AK~s~~~AFl~AKl~~~~L~~~k~~~~Fv~Vsr~dGg~Gy~n~d~~~g~~~~k 2054 (2773)
T TIGR02813      1976 DGFIHLQPLATD-AKADKVDAIELVEAAKESVELAFLFAKLLKVKLAENKDRASFVTVSRIDGGFGYLNADEDVGALIVK 2054 (2773)
T ss_pred             CEEEEECCCCHH-HCCCCHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHH
T ss_conf             235563010100-0023002110178887889999999997567876430440067897316742335540123356666


Q ss_pred             ----HHHHHHHHHHHHHHHHHHHHH-HC---CEEEEECCCCC
Q ss_conf             ----898999999999999998544-38---69975532883
Q gi|254780337|r  168 ----YSASKAAIEALARTWSKETVN-TA---LRVINIDPGPT  201 (257)
Q Consensus       168 ----Y~asKaal~~lt~~la~E~~~-~g---Irvn~I~PG~v  201 (257)
                          ---..+||.||||+|..||.. .|   .|+.-|+|-.-
T Consensus      2055 anv~a~L~QAaL~GL~KTl~HEW~~gegsV~CR~lD~a~~L~ 2096 (2773)
T TIGR02813      2055 ANVKAELNQAALAGLTKTLNHEWNAGEGSVFCRALDVAPKLD 2096 (2773)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCHH
T ss_conf             666777778776312332034436888327887553475123


No 291
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, 
Probab=96.88  E-value=0.015  Score=37.23  Aligned_cols=73  Identities=23%  Similarity=0.328  Sum_probs=57.7

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             24889999938998688999999998899-89999789899999999998649928999878999999999999999981
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      +|++|.+||-|+ +-+|+.+++.|.++|+ +|.++.|+.++++++++++   |.++..              ++...+.+
T Consensus       175 ~l~~~~vLviGa-Gem~~l~~~~L~~~g~~~i~v~nRt~~ra~~la~~~---g~~~~~--------------~~~l~~~l  236 (311)
T cd05213         175 NLKGKKVLVIGA-GEMGELAAKHLAAKGVAEITIANRTYERAEELAKEL---GGNAVP--------------LDELLELL  236 (311)
T ss_pred             CCCCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHC---CCEEEC--------------HHHHHHHH
T ss_conf             721167999868-799999999999659982599768678999999974---989972--------------99999999


Q ss_pred             CCCCEEEECCCC
Q ss_conf             898799876875
Q gi|254780337|r   94 GKLDILIANAGI  105 (257)
Q Consensus        94 g~iDilVNNAGi  105 (257)
                      ...|++|-+.|.
T Consensus       237 ~~~DvvisaT~s  248 (311)
T cd05213         237 NEADVVISATGA  248 (311)
T ss_pred             HHCCEEEEECCC
T ss_conf             768999992799


No 292
>COG3268 Uncharacterized conserved protein [Function unknown]
Probab=96.82  E-value=0.0058  Score=39.93  Aligned_cols=142  Identities=19%  Similarity=0.240  Sum_probs=83.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999999999998189879
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
                      ...+|-||++=-|.-+|+.|+++|.+-++.+|+..++..+..++   |.++..+.+++  ++.++++.+       ..++
T Consensus         7 ~d~iiYGAtGy~G~lvae~l~~~g~~~aLAgRs~~kl~~l~~~L---G~~~~~~p~~~--p~~~~~~~~-------~~~V   74 (382)
T COG3268           7 YDIIIYGATGYAGGLVAEYLAREGLTAALAGRSSAKLDALRASL---GPEAAVFPLGV--PAALEAMAS-------RTQV   74 (382)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHC---CCCCCCCCCCC--HHHHHHHHH-------CCEE
T ss_conf             03899746552158999999974886432168889998899850---96644467788--899999974-------2668


Q ss_pred             EEECCCCCCCC-CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-HH--HCCCCEEEEECCHHHCCCCC-CCHHHHHHHH
Q ss_conf             98768758888-88676599999999999989999999999999-98--60898699978835647889-8368898999
Q gi|254780337|r   99 LIANAGILGSI-SPIWQIKEKSFADVISVNVMANWNIMRSFDPW-LK--KSHCGRAIILSSGAAYKCRP-LWGAYSASKA  173 (257)
Q Consensus        99 lVNNAGi~~~~-~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~-m~--~~~~G~IInisS~~g~~~~~-~~~~Y~asKa  173 (257)
                      ++|++|=+... .|+-+.=..  .-+-=..++|-++..+..... -.  ++.+-+||+-   -|.-..| ..+.|+--|.
T Consensus        75 VlncvGPyt~~g~plv~aC~~--~GTdY~DiTGEi~~fe~~i~~yh~~A~~~Ga~Ii~~---cGFDsIPsDl~v~~l~~~  149 (382)
T COG3268          75 VLNCVGPYTRYGEPLVAACAA--AGTDYADITGEIMFFENSIDLYHAQAADAGARIIPG---CGFDSIPSDLGVYALLKQ  149 (382)
T ss_pred             EEECCCCCCCCCCHHHHHHHH--HCCCEEECCCCHHHHHHHHHHHHHHHHHCCCEEECC---CCCCCCCCCHHHHHHHHH
T ss_conf             996146612026479999997--198724135617999999888777887559789666---777767640189999986


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780337|r  174 AIEA  177 (257)
Q Consensus       174 al~~  177 (257)
                      ++.-
T Consensus       150 ~~~d  153 (382)
T COG3268         150 ALPD  153 (382)
T ss_pred             HCCC
T ss_conf             4764


No 293
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed
Probab=96.82  E-value=0.018  Score=36.64  Aligned_cols=47  Identities=26%  Similarity=0.451  Sum_probs=43.1

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHH
Q ss_conf             24889999938998688999999998899-8999978989999999999
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNAL   62 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~   62 (257)
                      +|++|.+||-|+ +-+|..+++.|.+.|+ +|.++.|+.++++++++++
T Consensus       179 ~l~~~~vlviGa-Gem~~l~~k~L~~~g~~~i~v~nRt~~ra~~la~~~  226 (429)
T PRK00045        179 DLSGKKVLVIGA-GEMGELVAKHLAEKGVRKITVANRTLERAEELAEEF  226 (429)
T ss_pred             CCCCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHC
T ss_conf             812065999767-489999999998559984999758677899999975


No 294
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=96.81  E-value=0.01  Score=38.31  Aligned_cols=69  Identities=19%  Similarity=0.210  Sum_probs=50.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             99938998688999999998899899997898999999999986499289998789999999999999999818987998
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILI  100 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDilV  100 (257)
                      ++|.|| +-+|+.+|+.|.++|+.|++.+++++.++.+.+.+     .+..+..|.++++..++      .....-|++|
T Consensus         3 IiI~Ga-G~vG~~La~~Ls~e~~dV~vID~d~~~~~~~~~~l-----Dv~~i~Gd~~~~~~L~~------Agi~~ad~~I   70 (455)
T PRK09496          3 IIILGA-GQVGGTLAERLVGENNDVTVIDTDEERLRRLQDRL-----DVRTVVGNGSHPDVLRE------AGAEDADMLI   70 (455)
T ss_pred             EEEECC-CHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHC-----CEEEEEECCCCHHHHHH------CCCCCCCEEE
T ss_conf             999998-88999999999868997999989999999988625-----86899966899999996------5998699999


Q ss_pred             E
Q ss_conf             7
Q gi|254780337|r  101 A  101 (257)
Q Consensus       101 N  101 (257)
                      .
T Consensus        71 A   71 (455)
T PRK09496         71 A   71 (455)
T ss_pred             E
T ss_conf             9


No 295
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed predominantly of bacterial LDHs and a few fungal LDHs. Bacterial LDHs may be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.80  E-value=0.028  Score=35.34  Aligned_cols=110  Identities=21%  Similarity=0.242  Sum_probs=68.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHCC---CCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             9999938998688999999998899--89999789899999999998649---928999878999999999999999981
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGA--YVIACGRSISQLEKLKNALQKIN---KKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~--~Vi~~~r~~~~l~~~~~~~~~~g---~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      |+++| |+ +++|..+|..|+..|.  .+++.|+++++++..+.+++..-   .......   .|.+           +.
T Consensus         2 KI~II-Ga-G~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~DL~~a~~~~~~~~i~~---~~~~-----------~l   65 (308)
T cd05292           2 KVAIV-GA-GFVGSTTAYALLLRGLASEIVLVDINKAKAEGEAMDLAHGTPFVKPVRIYA---GDYA-----------DC   65 (308)
T ss_pred             EEEEE-CC-CHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEE---CCHH-----------HH
T ss_conf             79999-94-888999999998679988799991889845125687662410368816840---9999-----------97


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEECC
Q ss_conf             898799876875888888676599999999999989999999999999986089-86999788
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHC-GRAIILSS  155 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~-G~IInisS  155 (257)
                      ..-|++|-.||.....+    .+   -.+.++.|..    +.+.+.+.+++... +.+++++-
T Consensus        66 ~daDvVVitaG~~rk~g----~t---R~dll~~Na~----I~~~i~~~i~~~~p~~ivivvsN  117 (308)
T cd05292          66 KGADVVVITAGANQKPG----ET---RLDLLKRNVA----IFKEIIPQILKYAPDAILLVVTN  117 (308)
T ss_pred             CCCCEEEECCCCCCCCC----CC---HHHHHHHHHH----HHHHHHHHHHHHCCCCEEEECCC
T ss_conf             79999998999999989----98---7899988899----99999999984199808997279


No 296
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Probab=96.80  E-value=0.032  Score=34.98  Aligned_cols=81  Identities=23%  Similarity=0.318  Sum_probs=53.6

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      .|.+++|.|+ +|||...++.....|++|+.+++++++++..+    +.|.....-..|.. .+++++.+....+..| +
T Consensus       166 ~g~~V~V~G~-G~iGl~a~~~ak~~Ga~Vi~vd~~~~rle~a~----~~Ga~~~i~~~~~~-~~~~~~~~~~~~~~~G-~  238 (349)
T TIGR03201       166 KGDLVIVIGA-GGVGGYMVQTAKAMGAAVVAIDIDPEKLEMMK----GFGADLTLNPKDKS-AREVKKLIKAFAKARG-L  238 (349)
T ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HCCCCEEECCCCCC-HHHHHHHHHHHCCCCC-C
T ss_conf             9988999897-48999999999985997999949999999999----64998998787677-8999999975414567-5


Q ss_pred             C----EEEECCC
Q ss_conf             7----9987687
Q gi|254780337|r   97 D----ILIANAG  104 (257)
Q Consensus        97 D----ilVNNAG  104 (257)
                      |    +++..+|
T Consensus       239 ~~~~~~v~e~~G  250 (349)
T TIGR03201       239 RSTGWKIFECSG  250 (349)
T ss_pred             CCCCCEEEEECC
T ss_conf             655636998248


No 297
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=96.80  E-value=0.029  Score=35.31  Aligned_cols=102  Identities=16%  Similarity=0.204  Sum_probs=65.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             889999938998688999999998899-8999978989999999999864992899987899999999999999998189
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      .|++++|.|+ ++||...+..+...|+ +|+.+++++++++..+    +.|... .  .|.++.+-.++ +.+..+.+ .
T Consensus       176 ~g~~VlV~Ga-G~iGl~a~~~ak~~Ga~~Vi~~d~~~~rl~~A~----~lGa~~-~--i~~~~~~~~~~-v~~~t~g~-G  245 (358)
T TIGR03451       176 RGDSVAVIGC-GGVGDAAIAGAALAGASKIIAVDIDDRKLEWAR----EFGATH-T--VNSSGTDPVEA-IRALTGGF-G  245 (358)
T ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHH----HCCCEE-E--ECCCCCCHHHH-HHHHHCCC-C
T ss_conf             9988999673-769999999999839918999919889999999----659909-9--73998788999-99985898-8


Q ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCH
Q ss_conf             8799876875888888676599999999999989999999999999986089869997883
Q gi|254780337|r   96 LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSG  156 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~  156 (257)
                      +|+.|..+|.  +         +-|               +.++..+  +.+|+++.++-.
T Consensus       246 ~Dvvie~~G~--~---------~~~---------------~~al~~~--~~gG~iv~~G~~  278 (358)
T TIGR03451       246 ADVVIDAVGR--P---------ETY---------------KQAFYAR--DLAGTVVLVGVP  278 (358)
T ss_pred             CCEEEECCCC--H---------HHH---------------HHHHHHH--CCCCEEEEEECC
T ss_conf             7499999999--8---------999---------------9999976--279699999225


No 298
>KOG1431 consensus
Probab=96.78  E-value=0.054  Score=33.46  Aligned_cols=185  Identities=12%  Similarity=0.060  Sum_probs=98.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC---EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             9999938998688999999998899---8999978989999999999864992899987899999999999999998189
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGA---YVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK   95 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~---~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   95 (257)
                      |.+||||+++=.|.||.+.+.+.|-   +.++.+                     .-.+|+++.++++.+|+..     +
T Consensus         2 ~kIlVtGg~GLVGsAi~~vv~~q~~~~e~wvf~~---------------------skd~DLt~~a~t~~lF~~e-----k   55 (315)
T KOG1431           2 KKILVTGGTGLVGSAIVKVVQEQGFDDENWVFIG---------------------SKDADLTNLADTRALFESE-----K   55 (315)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCCEEEEC---------------------CCCCCCCCHHHHHHHHHCC-----C
T ss_conf             5599936874178999999985388876569951---------------------5544531368899998404-----8


Q ss_pred             CCEEEECCCCCCCCCCHHH--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE------ECCHHHCCC--CCCC
Q ss_conf             8799876875888888676--59999999999998999999999999998608986999------788356478--8983
Q gi|254780337|r   96 LDILIANAGILGSISPIWQ--IKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAII------LSSGAAYKC--RPLW  165 (257)
Q Consensus        96 iDilVNNAGi~~~~~~~~~--~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IIn------isS~~g~~~--~~~~  165 (257)
                      +..+|+-|+..+  +.|.+  .+.+=|...++||-.---..--+-.+....-..-+|.-      |--..-+.+  .|-.
T Consensus        56 PthVIhlAAmVG--Glf~N~~ynldF~r~Nl~indNVlhsa~e~gv~K~vsclStCIfPdkt~yPIdEtmvh~gpphpsN  133 (315)
T KOG1431          56 PTHVIHLAAMVG--GLFHNNTYNLDFIRKNLQINDNVLHSAHEHGVKKVVSCLSTCIFPDKTSYPIDETMVHNGPPHPSN  133 (315)
T ss_pred             CCEEEEHHHHHC--CHHHCCCCCHHHHHHCCEECHHHHHHHHHHCHHHHHHHCCEEECCCCCCCCCCHHHHCCCCCCCCC
T ss_conf             700010676643--044147785677764014140587888870605644413534468888888877886159999873


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCC----CCC----------CHHHHHHC--------------CCCCCCC
Q ss_conf             6889899999999999999854438699755328----837----------97798441--------------4443245
Q gi|254780337|r  166 GAYSASKAAIEALARTWSKETVNTALRVINIDPG----PTR----------TSMRAKAM--------------PAEDPNT  217 (257)
Q Consensus       166 ~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG----~v~----------T~m~~~~~--------------~~~~~~~  217 (257)
                      -.|+-+|-=+.-.++..+.+.+   -...++.|-    +-|          -.|..+..              .+.|...
T Consensus       134 ~gYsyAKr~idv~n~aY~~qhg---~~~tsviPtNvfGphDNfnpe~sHVlPali~r~h~ak~~gtd~~~VwGsG~PlRq  210 (315)
T KOG1431         134 FGYSYAKRMIDVQNQAYRQQHG---RDYTSVIPTNVFGPHDNFNPENSHVLPALIHRFHEAKRNGTDELTVWGSGSPLRQ  210 (315)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHC---CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHH
T ss_conf             0899999998777789999838---7123002344538877788343531299999999987458844899538980788


Q ss_pred             CCCHHHHHHHHHHHHCH
Q ss_conf             88889999999996197
Q gi|254780337|r  218 VPHPQKVAKIISFLCAT  234 (257)
Q Consensus       218 ~~~pediA~~v~fL~s~  234 (257)
                      +....|+|+++.|++..
T Consensus       211 Fiys~DLA~l~i~vlr~  227 (315)
T KOG1431         211 FIYSDDLADLFIWVLRE  227 (315)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             75676799999999986


No 299
>KOG1198 consensus
Probab=96.78  E-value=0.0099  Score=38.39  Aligned_cols=79  Identities=27%  Similarity=0.373  Sum_probs=55.9

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      +|+.+||.||++|.|.+..+.....|+..+++.++.+.++-+    .++|..   ...|..+++-++...+..   .+++
T Consensus       157 ~g~~vLv~ggsggVG~~aiQlAk~~~~~~v~t~~s~e~~~l~----k~lGAd---~vvdy~~~~~~e~~kk~~---~~~~  226 (347)
T KOG1198         157 KGKSVLVLGGSGGVGTAAIQLAKHAGAIKVVTACSKEKLELV----KKLGAD---EVVDYKDENVVELIKKYT---GKGV  226 (347)
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHH----HHCCCC---CCCCCCCHHHHHHHHHHC---CCCC
T ss_conf             998699993874899999999987497479998155416899----972996---512488577999987622---7885


Q ss_pred             CEEEECCCC
Q ss_conf             799876875
Q gi|254780337|r   97 DILIANAGI  105 (257)
Q Consensus        97 DilVNNAGi  105 (257)
                      |+++-+.|-
T Consensus       227 DvVlD~vg~  235 (347)
T KOG1198         227 DVVLDCVGG  235 (347)
T ss_pred             EEEEECCCC
T ss_conf             099988889


No 300
>PRK08306 dipicolinate synthase subunit A; Reviewed
Probab=96.73  E-value=0.016  Score=37.06  Aligned_cols=122  Identities=19%  Similarity=0.238  Sum_probs=81.2

Q ss_pred             CCEEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             73265248899999389986889999999988998999978989999999999864992899987899999999999999
Q gi|254780337|r   10 SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        10 ~~m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
                      +.+...+.|-.++|+|.+ -+|+.+|+.|...|++|.+.+|+.+.+...    .+.|-+..    ++          ++.
T Consensus       144 ~~tp~ti~gs~~lVlG~G-r~G~~lA~~l~~lGA~V~V~aR~~~~~a~a----~~~G~~~v----~~----------~~L  204 (296)
T PRK08306        144 EHTPITIHGSNVLVLGFG-RTGMTLARTLKALGAKVKVGARKSAHLARI----TEMGYSPV----HL----------SEL  204 (296)
T ss_pred             HCCCCCCCCCCEEEECCC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHH----HHCCCEEE----EH----------HHH
T ss_conf             659963247658998986-899999999997799699997999999999----97698587----19----------999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             99818987998768758888886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
                      .+.....|+++|-.    + .+                     .+++..+..|  ++...||-++|      .|+..-|.
T Consensus       205 ~~~~~~~D~i~NTI----P-a~---------------------Vlt~~~l~~~--~~~avIIDLAS------~PGG~Df~  250 (296)
T PRK08306        205 AEEVGEADIIFNTI----P-AL---------------------VLTKNVLSKM--PPHALIIDLAS------KPGGTDFE  250 (296)
T ss_pred             HHHHCCCCEEEECC----C-HH---------------------HCCHHHHHCC--CCCCEEEEECC------CCCCCCHH
T ss_conf             97735699999898----5-25---------------------4399999418--99969999477------99973889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCC
Q ss_conf             8999999999999998544386997553288
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGP  200 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~  200 (257)
                      ++|               ++||++.- +||.
T Consensus       251 ~A~---------------~~Gika~l-apgL  265 (296)
T PRK08306        251 YAK---------------KLGIKALL-APGL  265 (296)
T ss_pred             HHH---------------HHCCEEEE-CCCC
T ss_conf             999---------------83985997-2899


No 301
>PRK06849 hypothetical protein; Provisional
Probab=96.70  E-value=0.0095  Score=38.52  Aligned_cols=83  Identities=20%  Similarity=0.210  Sum_probs=54.7

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      +-|++|||||..=-++++|+.|.+.|.+|++++-..-.+-.    .+..-.+...++.--.|++.-.+.+-.+.++ -++
T Consensus         3 ~p~tvLiTg~r~~~aL~laR~l~~~Gh~V~~aD~~~~~l~r----~Sr~v~~~~~vP~P~~d~~~y~~~Ll~Iv~~-e~i   77 (387)
T PRK06849          3 TPKTVLITGARAPAALQLARSFHNAGHTVILADSLKYPLSR----FSRAVDGFYTIPSPKWDPNAYIQALLSIVKR-HNI   77 (387)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCC----HHHCEEEEEECCCCCCCHHHHHHHHHHHHHH-HCC
T ss_conf             98779995886078999999998789979998489877542----0000112798699978989999999999998-389


Q ss_pred             CEEEECCC
Q ss_conf             79987687
Q gi|254780337|r   97 DILIANAG  104 (257)
Q Consensus        97 DilVNNAG  104 (257)
                      |++|-..-
T Consensus        78 dl~IP~~e   85 (387)
T PRK06849         78 DLLIPTCE   85 (387)
T ss_pred             CEEEECCC
T ss_conf             99997776


No 302
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family. Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains
Probab=96.70  E-value=0.033  Score=34.92  Aligned_cols=115  Identities=18%  Similarity=0.219  Sum_probs=71.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHCC----CEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             9993899868899999999889----989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSG----AYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G----~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
                      +.|+||++.+|..+|..|+..+    -.+++.|+++++++....+++..-........-.++         ...+.+..-
T Consensus         1 V~IIGA~G~VG~~~a~~l~~~~~~~~~el~L~Di~~~~~~g~a~Dl~~~~~~~~~~~v~~~~---------~~~~~~~da   71 (263)
T cd00650           1 IAVIGAGGNVGPALAFGLADGSVLLAIELVLYDIDEEKLKGVAMDLQDAVEPLADIKVSITD---------DPYEAFKDA   71 (263)
T ss_pred             CEEECCCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCCCCEEEECC---------CHHHHHCCC
T ss_conf             98987797799999999982899999889999589872087999998545235787399748---------738983799


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEECC
Q ss_conf             7998768758888886765999999999999899999999999999860-8986999788
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS-HCGRAIILSS  155 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~-~~G~IInisS  155 (257)
                      |++|--||.....+    .+..   +.+..|..    +.+...+.+.+. +.+.+++++-
T Consensus        72 DvVVitag~~~k~g----~~R~---dll~~N~~----I~~~i~~~i~~~~p~a~iivvtN  120 (263)
T cd00650          72 DVVIITAGVGRKPG----MGRL---DLLKRNVP----IVKEIGDNIEKYSPDAWIIVVSN  120 (263)
T ss_pred             CEEEEECCCCCCCC----CCHH---HHHHCHHH----HHHHHHHHHHHCCCCCEEEECCC
T ss_conf             89999057788999----8765---66403288----99999888873299836997389


No 303
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase; InterPro: IPR011848    In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis. These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This entry describes proteins from the genera Streptococcus and Enterococcus homologous to the C-terminal region of IPR005252 from INTERPRO, corresponding to phosphopantothenate--cysteine ligase activity ..
Probab=96.69  E-value=0.0026  Score=42.32  Aligned_cols=89  Identities=15%  Similarity=0.225  Sum_probs=63.8

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC--CCEEEEC
Q ss_conf             998688999999998899899997-8989999999999864992899987899999999999999998189--8799876
Q gi|254780337|r   26 SSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGK--LDILIAN  102 (257)
Q Consensus        26 as~GIG~a~a~~la~~G~~Vi~~~-r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~--iDilVNN  102 (257)
                      +|+++|+.|||.|+++|+.|.+.- .+.-+-        ....     .+-+..-+.++.++.+..+.+..  .|+|||.
T Consensus        24 StG~LGK~IaE~fL~~Gh~VtlvTTK~A~kP--------~~~~-----~Lsi~Eie~~~~L~~~L~~~v~~kq~d~liHs   90 (253)
T TIGR02114        24 STGGLGKIIAEKFLAAGHEVTLVTTKRALKP--------EPQL-----NLSIKEIETVKDLLTTLKELVAEKQHDILIHS   90 (253)
T ss_pred             CCCCCHHHHHHHHHHCCCEEEEEECCCCCCC--------CCCC-----CCCEEEECCHHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             7687217999999865878978753612188--------8888-----86248642778999998875012554388885


Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHH
Q ss_conf             87588888867659999999999998
Q gi|254780337|r  103 AGILGSISPIWQIKEKSFADVISVNV  128 (257)
Q Consensus       103 AGi~~~~~~~~~~~~e~~~~~~~vNl  128 (257)
                      .++. ++.|..=.+.|++...|.-.|
T Consensus        91 MAVS-DYTpvym~~~E~v~~SfaqqL  115 (253)
T TIGR02114        91 MAVS-DYTPVYMTDLEQVKDSFAQQL  115 (253)
T ss_pred             ECCC-CCCHHHHCCHHHHHHHHHHHH
T ss_conf             1126-885100011678999998755


No 304
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=96.64  E-value=0.017  Score=36.73  Aligned_cols=192  Identities=14%  Similarity=0.061  Sum_probs=96.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHH--HHHHHHHHHHCCC
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999--9999999981898
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALE--LTKTYIAKRWGKL   96 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~--~~~~~~~~~~g~i   96 (257)
                      |++-|-|+ +=||..+|..|+..|++|.+.+++++..+.+.+.+.+.-....  ...+......+  .+...+.+.....
T Consensus         8 k~VaVIGa-G~MG~giAa~~a~~G~~V~l~D~~~~a~~~~~~~i~~~~~~l~--~~~~~~~~~~~~l~~~~~l~~av~~a   84 (321)
T PRK07066          8 KTFAAIGS-GVIGSGWVARALAHGLDVVAWDPAPGAEAALRANVANAWPALE--RQGLAPGASPARLRFVATIEACVADA   84 (321)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHH--HCCCCCHHHHHHHHCCCCHHHHHCCC
T ss_conf             87999888-7888999999994798599996988899999999999999998--66899631696501468889986359


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHH---HH-----HHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHH
Q ss_conf             799876875888888676599999999999---98-----9999999999999986089869997883564788983688
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISV---NV-----MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAY  168 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~v---Nl-----~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y  168 (257)
                      |.++-|+  ...    .++..+-|.+.-.+   +.     ++.+..+ .+...+  ++..|++..        .|+.++|
T Consensus        85 D~ViEav--pE~----l~lK~~lf~~ld~~~~~~aIiASnTS~l~is-~l~~~~--~~peR~i~~--------HfFNP~~  147 (321)
T PRK07066         85 DFIQESA--PER----EALKLELHERISRAAKPDAIIASSTSGLLPT-DFYARA--THPERCVVG--------HPFNPVY  147 (321)
T ss_pred             CEEEECC--EEC----HHHHHHHHHHHHHHCCCCCEEEECCCCCCHH-HHHHHC--CCCCEEEEE--------EECCCCC
T ss_conf             9899877--665----9999999999997679886785257657899-998736--997026876--------1058753


Q ss_pred             -----------HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCC---CCCCCCCHHHHHHHHHHH
Q ss_conf             -----------989999999999999985443869975532883797798441444---324588889999999996
Q gi|254780337|r  169 -----------SASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE---DPNTVPHPQKVAKIISFL  231 (257)
Q Consensus       169 -----------~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~---~~~~~~~pediA~~v~fL  231 (257)
                                 .+|.. ....++.+...++..-|.++-=.||++-.-++...+.+.   -...+..||||=.++.+=
T Consensus       148 lmPLVEVV~g~~Ts~~-tv~~a~~~~~~iGk~PV~v~ke~pGFi~NRL~~al~rEA~~Lv~eGvAs~edID~a~~~G  223 (321)
T PRK07066        148 LLPLVEVLGGERTAPE-AVDAAMGIYRALGMRPLHVRKEVPGFIADRLLEALWREALHLVNEGVATTGEIDDAIRFG  223 (321)
T ss_pred             CCCCEEECCCCCCCHH-HHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHC
T ss_conf             2542444289999799-999999999981997889927784259999999999999999981899999999999808


No 305
>PRK13656 trans-2-enoyl-CoA reductase; Provisional
Probab=96.63  E-value=0.019  Score=36.46  Aligned_cols=181  Identities=15%  Similarity=0.165  Sum_probs=107.4

Q ss_pred             CCEEEEECCCCHHHHHHHHHHH-HCCCEEEEE--ECCHHH----------HHHHHHHHHHCCCCEEEEECCCCCHHHHHH
Q ss_conf             8999993899868899999999-889989999--789899----------999999998649928999878999999999
Q gi|254780337|r   18 NRLALVTGSSRGIGYYTALELA-RSGAYVIAC--GRSISQ----------LEKLKNALQKINKKIDIFAFDLRDSNALEL   84 (257)
Q Consensus        18 ~K~alVTGas~GIG~a~a~~la-~~G~~Vi~~--~r~~~~----------l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~   84 (257)
                      -|.+||-|+|+|-|+|.-..++ ..|+.-+-.  .|....          -....+..++.|-.+..+-.|.-+.+.-++
T Consensus        41 pK~VLViGaStGyGLAsRI~aaFg~gA~TiGV~fEr~~~~~k~gtaGWYN~~aF~~~A~~~Gl~a~~~ngDAFS~e~K~~  120 (400)
T PRK13656         41 PKKVLVIGASSGYGLASRITAAFGSGADTLGVFFERPGSEKKPGTAGWYNSAAFDKFAKAAGLYAKSINGDAFSDEIKQK  120 (400)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEECCCCCCCHHHHHH
T ss_conf             96389994687631999999985489872678851588899877864316899999999779721214520067899999


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCC------------CC---------------------HHHCCHHHHHHHHHHHHHHH
Q ss_conf             9999999818987998768758888------------88---------------------67659999999999998999
Q gi|254780337|r   85 TKTYIAKRWGKLDILIANAGILGSI------------SP---------------------IWQIKEKSFADVISVNVMAN  131 (257)
Q Consensus        85 ~~~~~~~~~g~iDilVNNAGi~~~~------------~~---------------------~~~~~~e~~~~~~~vNl~g~  131 (257)
                      .++.+.++||++|.+|-.-+--...            +|                     ++--++||...++.|-=---
T Consensus       121 vI~~Ik~~~G~vDlvVYSLAaprR~~P~tG~~~~S~lKpig~~~t~~tld~~~~~i~~~tiepAt~eEi~~TvkVMGGED  200 (400)
T PRK13656        121 VIELIKQDLGQVDLVVYSLASPRRKDPKTGEVIRSVLKPIGETVTGRTLDTDKDVIIEATVEPATEEEIADTVKVMGGED  200 (400)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHCCCCHH
T ss_conf             99999986598467999645777779999878877632478756577321689828887517899789973411338758


Q ss_pred             HHHHHHHHHHHHHCC----CCEEEEECCHHHCCCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEE-EECCCCC
Q ss_conf             999999999998608----98699978835647889--8368898999999999999998544386997-5532883
Q gi|254780337|r  132 WNIMRSFDPWLKKSH----CGRAIILSSGAAYKCRP--LWGAYSASKAAIEALARTWSKETVNTALRVI-NIDPGPT  201 (257)
Q Consensus       132 ~~l~~~~~~~m~~~~----~G~IInisS~~g~~~~~--~~~~Y~asKaal~~lt~~la~E~~~~gIrvn-~I~PG~v  201 (257)
                      |.+   -+..+.+.+    +-.-|..|=+....-+|  ..+.-+.+|.-|..-++.|..+++..|-+.. +++...|
T Consensus       201 We~---Wi~aL~~A~vLA~g~~TvAySYIG~elT~pIY~~GTIG~AK~dLe~ta~~i~~~L~~~~G~A~VsV~KAlV  274 (400)
T PRK13656        201 WEL---WIDALDEAGVLADGAKTVAYSYIGPELTWPIYWNGTIGKAKKDLDRTALALNEKLAALGGDAYVSVLKAVV  274 (400)
T ss_pred             HHH---HHHHHHHCCCCCCCCEEEEEEEECCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEHHHC
T ss_conf             999---99999868752369678888733664550112377175889999999999999988649808999723430


No 306
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family; InterPro: IPR014188   This entry represents a subfamily of the alcohol dehydrogenase, a superfamily in which some members are zinc-binding medium-chain alcohol dehydrogenases while others are quinone oxidoreductases with no bound zinc. This entry includes YhdH from Escherichia coli and YhfP from Bacillus subtilis both of which bind NADPH or NAD, but not zinc. Both proteins have been studied crystallographically for insight into function. .
Probab=96.57  E-value=0.005  Score=40.39  Aligned_cols=60  Identities=25%  Similarity=0.369  Sum_probs=39.9

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             248899999389986889999999988998999-9789899999999998649928999878999
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIA-CGRSISQLEKLKNALQKINKKIDIFAFDLRD   78 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~-~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d   78 (257)
                      .-+.--+||||||.|-|.=-..-|++.||+|+. ++|.+++.+-|    ++.|.+-...+.|+++
T Consensus       146 ~P~~GpVlVTGAtGGVGS~Av~~L~~lGY~V~A~tGk~~~~~~yL----~~LGA~evi~R~~l~~  206 (330)
T TIGR02823       146 TPEDGPVLVTGATGGVGSLAVAILSKLGYEVVASTGKAEEEVEYL----KELGASEVIDREELSE  206 (330)
T ss_pred             CCCCCCEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HHCCCCCCCCHHHCCC
T ss_conf             888887887067787789999999837976999737837788999----8658110577112276


No 307
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed
Probab=96.56  E-value=0.0084  Score=38.87  Aligned_cols=71  Identities=28%  Similarity=0.359  Sum_probs=52.2

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
                      ..+++|.++|-|| +|-+++++-.|...|++|.+..|+.++++++++.+.   .+..    ++.   .+        ..+
T Consensus       328 ~~~~~~~~~vlGa-GGaarAi~~~l~~~g~~i~I~nRt~~ka~~La~~~~---~~~~----~~~---~l--------~~~  388 (477)
T PRK09310        328 ISLNNQHVAIVGA-GGAAKAIATTLARQGAELLIFNRTKAHAEALASRCQ---GKAF----PLG---SL--------PEL  388 (477)
T ss_pred             CCCCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC---CCEE----EHH---HH--------HHC
T ss_conf             9944462244247-507999999998679979999799899999998748---8675----356---65--------316


Q ss_pred             CCCCEEEECC
Q ss_conf             8987998768
Q gi|254780337|r   94 GKLDILIANA  103 (257)
Q Consensus        94 g~iDilVNNA  103 (257)
                      ..+|++||+-
T Consensus       389 ~~~dliIn~t  398 (477)
T PRK09310        389 HTIDIIINCL  398 (477)
T ss_pred             CCCCEEEECC
T ss_conf             7789899898


No 308
>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343   Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway . The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin .   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.   The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.   Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) .   This entry represents glutamyl-tRNA reductase (1.2.1.70 from EC), which reduces glutamyl-tRNA to glutamate-1-semialdehyde during the first stage of tetrapyrrole biosynthesis by the C5 pathway , . This enzyme required NADPH as a coenzyme.; GO: 0008883 glutamyl-tRNA reductase activity, 0050661 NADP binding, 0033014 tetrapyrrole biosynthetic process.
Probab=96.55  E-value=0.038  Score=34.51  Aligned_cols=79  Identities=27%  Similarity=0.364  Sum_probs=59.9

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             2488999993899868899999999889-9899997898999999999986-4992899987899999999999999998
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSG-AYVIACGRSISQLEKLKNALQK-INKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G-~~Vi~~~r~~~~l~~~~~~~~~-~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
                      +|++|++||-||+. .|.=.|++|.+.| ..|.++.|+.+++++++++++. ..-+        -++-+++++.    +.
T Consensus       182 rL~~~~~LliGAGe-Mg~Lva~~L~~~~v~~~~i~NRt~~rA~~LA~e~~~P~~~~--------f~~La~~~L~----~~  248 (436)
T TIGR01035       182 RLKGKKVLLIGAGE-MGELVAKHLREKGVGKVLIANRTYERAEKLAKELGGPEAVK--------FEALALEKLE----EA  248 (436)
T ss_pred             CCCCCEEEEEECCH-HHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCCCC--------CCHHHHHHHH----HH
T ss_conf             11664189982745-79999999964895289885567789999998707866454--------4455489999----99


Q ss_pred             HCCCCEEEECCCCC
Q ss_conf             18987998768758
Q gi|254780337|r   93 WGKLDILIANAGIL  106 (257)
Q Consensus        93 ~g~iDilVNNAGi~  106 (257)
                      .-.-||+|.+-|-.
T Consensus       249 L~~~DivissTgA~  262 (436)
T TIGR01035       249 LAEADIVISSTGAP  262 (436)
T ss_pred             HHHCCEEEEECCCC
T ss_conf             74288999855765


No 309
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional
Probab=96.54  E-value=0.036  Score=34.67  Aligned_cols=79  Identities=16%  Similarity=0.275  Sum_probs=51.0

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
Q ss_conf             48899999389986889999999988998-99997898999999999986499289998789999999999999999818
Q gi|254780337|r   16 LDNRLALVTGSSRGIGYYTALELARSGAY-VIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWG   94 (257)
Q Consensus        16 l~~K~alVTGas~GIG~a~a~~la~~G~~-Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g   94 (257)
                      ..|