HHsearch alignment for GI: 254780337 and conserved domain: pfam08643

>pfam08643 DUF1776 Fungal family of unknown function (DUF1776). This is a fungal family of unknown function. One of the proteins in this family has been localized to the mitochondria.
Probab=99.97  E-value=1.2e-28  Score=211.87  Aligned_cols=184  Identities=16%  Similarity=0.162  Sum_probs=163.4

Q ss_pred             CCEEEEEC-CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             89999938-99868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   18 NRLALVTG-SSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        18 ~K~alVTG-as~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
T Consensus         3 ~~vVli~Gs~~~pi~R~iA~dL~rrGf~Vfa~~r~~~~~~~l~~~~---~~~i~~L~lDvt~~~si~~a~~~~~~~l~~~   79 (296)
T pfam08643         3 REVVLVAGSPTEPLTRSIALDLERRGFIVFVTVTSAEEYKTVESEQ---REDIRPLWLDDTAPSSAEASLSEFLQLLETP   79 (296)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC---CCCCCEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             1299996699974589999999968978999957778899998624---4788527740788267999999999980676


Q ss_pred             --------------CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCEEEEECCHHHCC
Q ss_conf             --------------7998768758888886765999999999999899999999999999860--898699978835647
Q gi|254780337|r   97 --------------DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS--HCGRAIILSSGAAYK  160 (257)
Q Consensus        97 --------------DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~--~~G~IInisS~~g~~  160 (257)
T Consensus        80 ~~~~~g~~~~~l~L~gvi~~p~l~~p~Gpie~i~~~~~~~~~~~N~~g~i~~tq~~LPllr~~~~~~~iIv~~~Si~g~~  159 (296)
T pfam08643        80 HAPFPGAKPHVLRLRGVILVPSLSYPSGPIETIPPSSWASELNTRLLNPILTLQGLLPLLTSRSQKSKLIVFNPSISSSL  159 (296)
T ss_pred             CCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCC
T ss_conf             65557887552223247852676678785100899999999999949999999998888873468972899967631145


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCH
Q ss_conf             88983688989999999999999985443869975532883797
Q gi|254780337|r  161 CRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTS  204 (257)
Q Consensus       161 ~~~~~~~Y~asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~  204 (257)
T Consensus       160 ~~P~~~~y~ask~ale~~s~~LR~El~~~gI~V~~i~pG~i~~~  203 (296)
T pfam08643       160 NPPYHAPEALVSSALSTFFTILTRELRPHNIDVTQIKLGNLDLS  203 (296)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             68753599999999999999999874315965999944530457