BLAST/PSIBLAST alignment of GI: 254780337 and GI: 315122237 at iteration 1
>gi|315122237|ref|YP_004062726.1| oxidoreductase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 235
>gi|313495639|gb|ADR52238.1| oxidoreductase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 235
 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/234 (78%), Positives = 210/234 (89%)

Query: 23  VTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNAL 82
           +TGSSRGIGYYTALELA++GA+VIAC R++SQLE+LKN LQK  K IDI +FDLRD+ AL
Sbjct: 1   MTGSSRGIGYYTALELAKAGAHVIACARNVSQLEELKNTLQKTKKSIDIMSFDLRDNKAL 60

Query: 83  ELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWL 142
           ELTKTYIAKRWGKLDILIANAGILG I+PIWQI+EK+F DV+S+NV AN N+MR+FDPWL
Sbjct: 61  ELTKTYIAKRWGKLDILIANAGILGPITPIWQIREKNFEDVMSLNVSANLNLMRTFDPWL 120

Query: 143 KKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTR 202
           KKSH GRAIILSSGAA+KCRP WGAYS SKAA+EALARTW+KET NT LR+INIDPGPTR
Sbjct: 121 KKSHYGRAIILSSGAAHKCRPFWGAYSTSKAAVEALARTWAKETSNTNLRIINIDPGPTR 180

Query: 203 TSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTP 256
           TSMRA+AMP EDPNT+PHPQK+AKIIS LC++Q IETGKLFSV + RFV Y  P
Sbjct: 181 TSMRAQAMPREDPNTIPHPQKIAKIISLLCSSQTIETGKLFSVSKERFVEYSLP 234