BLAST/PSIBLAST alignment of GI: 254780337 and GI: 86357065 at iteration 1
>gi|86357065|ref|YP_468957.1| oxidoreductase protein [Rhizobium etli CFN 42] Length = 246
>gi|86281167|gb|ABC90230.1| probable oxidoreductase protein [Rhizobium etli CFN 42] Length = 246
 Score =  298 bits (763), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 139/246 (56%), Positives = 183/246 (74%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           +++NL+ R+ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE L +A++ +     +
Sbjct: 1   MNINLEGRIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEDLDDAIKAVGGSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
             FDL D NA++     I +RWGKLDIL+ANAG+LG ISPI  I+ K F  VI++NV A 
Sbjct: 61  VPFDLADMNAIDALGGSIFERWGKLDILVANAGVLGVISPIGHIEAKVFEKVITINVTAT 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L +S  GRA+ILSSGAA+KCRP W AYSASKAA+EALARTW+ ET +T L
Sbjct: 121 WRLIRSVDPLLARSDAGRAVILSSGAAHKCRPFWSAYSASKAAVEALARTWAGETQSTPL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           R+ ++DPG TRT+MRA+A+P EDP T+PHP +VAK I  L      ETGKLF V +N+  
Sbjct: 181 RITSVDPGATRTAMRAQAVPGEDPLTLPHPSEVAKAILPLLGPGVTETGKLFIVRENKLA 240

Query: 252 NYLTPN 257
           +Y  P 
Sbjct: 241 DYRLPE 246