BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780337|ref|YP_003064750.1| oxidoreductase protein
[Candidatus Liberibacter asiaticus str. psy62]
         (257 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780337|ref|YP_003064750.1| oxidoreductase protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040014|gb|ACT56810.1| oxidoreductase protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 257

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 257/257 (100%), Positives = 257/257 (100%)

Query: 1   MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKN 60
           MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKN
Sbjct: 1   MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKN 60

Query: 61  ALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSF 120
           ALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSF
Sbjct: 61  ALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSF 120

Query: 121 ADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
           ADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR
Sbjct: 121 ADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180

Query: 181 TWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG 240
           TWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG
Sbjct: 181 TWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG 240

Query: 241 KLFSVPQNRFVNYLTPN 257
           KLFSVPQNRFVNYLTPN
Sbjct: 241 KLFSVPQNRFVNYLTPN 257


>gi|315122237|ref|YP_004062726.1| oxidoreductase protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495639|gb|ADR52238.1| oxidoreductase protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 235

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/234 (78%), Positives = 210/234 (89%)

Query: 23  VTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNAL 82
           +TGSSRGIGYYTALELA++GA+VIAC R++SQLE+LKN LQK  K IDI +FDLRD+ AL
Sbjct: 1   MTGSSRGIGYYTALELAKAGAHVIACARNVSQLEELKNTLQKTKKSIDIMSFDLRDNKAL 60

Query: 83  ELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWL 142
           ELTKTYIAKRWGKLDILIANAGILG I+PIWQI+EK+F DV+S+NV AN N+MR+FDPWL
Sbjct: 61  ELTKTYIAKRWGKLDILIANAGILGPITPIWQIREKNFEDVMSLNVSANLNLMRTFDPWL 120

Query: 143 KKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTR 202
           KKSH GRAIILSSGAA+KCRP WGAYS SKAA+EALARTW+KET NT LR+INIDPGPTR
Sbjct: 121 KKSHYGRAIILSSGAAHKCRPFWGAYSTSKAAVEALARTWAKETSNTNLRIINIDPGPTR 180

Query: 203 TSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTP 256
           TSMRA+AMP EDPNT+PHPQK+AKIIS LC++Q IETGKLFSV + RFV Y  P
Sbjct: 181 TSMRAQAMPREDPNTIPHPQKIAKIISLLCSSQTIETGKLFSVSKERFVEYSLP 234


>gi|222085423|ref|YP_002543953.1| oxidoreductase protein [Agrobacterium radiobacter K84]
 gi|221722871|gb|ACM26027.1| oxidoreductase protein [Agrobacterium radiobacter K84]
          Length = 246

 Score =  303 bits (776), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 186/246 (75%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           + VNL +++ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE+L +A++ +     +
Sbjct: 1   MSVNLKDKIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEELDDAIKAVGGSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
             FDL D NA++     I +RWGKLDIL+ANAG+LG ISPI  I+ K F  V++VNV A 
Sbjct: 61  VPFDLADMNAIDALGASIFERWGKLDILVANAGVLGVISPIGHIEAKVFEKVMTVNVTAT 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS +P L +S  GRAIILSS AA++CRP WGAYSASKAA+EALARTW+ ET +T L
Sbjct: 121 WRLIRSVEPLLMRSDAGRAIILSSAAAHRCRPFWGAYSASKAAVEALARTWAGETQSTPL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           R+ +IDPG TRT+MRA+AMP EDP+T+PHP+ VA+ I  L      ETGKLF V +N+ V
Sbjct: 181 RITSIDPGATRTAMRAQAMPGEDPDTLPHPRDVAQAIVPLAGPNVTETGKLFVVRENKLV 240

Query: 252 NYLTPN 257
           +Y TP 
Sbjct: 241 DYRTPE 246


>gi|116251311|ref|YP_767149.1| short-chain dehydrogenase/reductase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255959|emb|CAK07040.1| putative short-chain dehydrogenase/reductase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 246

 Score =  300 bits (768), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 139/246 (56%), Positives = 185/246 (75%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           +++NL+ ++ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE L +A++ I     +
Sbjct: 1   MNINLEGKIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEDLDDAIKAIGGTATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
             FDL D NA++     I +RWGKLDIL+ANAG+LG ISPI  I+ K F  V+++NV A 
Sbjct: 61  VPFDLADMNAIDALGGSIFERWGKLDILVANAGVLGVISPIGHIEAKVFEKVMTINVTAT 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L +S  GRA+I+SSGAA+KCRP WGAYSASKAA+EALARTW+ E+ +T L
Sbjct: 121 WRLIRSVDPLLARSDAGRAVIISSGAAHKCRPFWGAYSASKAAVEALARTWAGESQSTPL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           RV ++DPG TRT+MRA+A+P EDP T+PHP +VAK I  L      ETGKLF V +N+ V
Sbjct: 181 RVTSVDPGATRTAMRAQAVPGEDPQTLPHPSEVAKAILPLLGPGVTETGKLFIVRENKLV 240

Query: 252 NYLTPN 257
           +Y  P 
Sbjct: 241 DYRLPE 246


>gi|241203924|ref|YP_002975020.1| short-chain dehydrogenase/reductase SDR [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240857814|gb|ACS55481.1| short-chain dehydrogenase/reductase SDR [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 246

 Score =  299 bits (765), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 137/246 (55%), Positives = 185/246 (75%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           +++NL+ ++ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE L +A++ +     +
Sbjct: 1   MNINLEGKIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEDLDDAIKAVGGTATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
             FDL D NA++     I +RWGKLDIL+ANAG+LG ISPI  I+ K F  V+++NV A 
Sbjct: 61  VPFDLADMNAIDALGGSIFERWGKLDILVANAGVLGVISPIGHIEAKVFEKVMTINVTAT 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L +S  GRA+I+SSGAA+KCRP WGAYSASKAA+EALARTW+ E+ +T L
Sbjct: 121 WRLIRSVDPLLARSDAGRAVIISSGAAHKCRPFWGAYSASKAAVEALARTWAGESQSTPL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           RV ++DPG TRT+MRA+A+P EDP ++PHP +VAK I  L      ETGKLF V +N+ V
Sbjct: 181 RVTSVDPGATRTAMRAQAVPGEDPQSLPHPSEVAKAILPLLGPGVTETGKLFMVRENKLV 240

Query: 252 NYLTPN 257
           +Y  P 
Sbjct: 241 DYRLPE 246


>gi|86357065|ref|YP_468957.1| oxidoreductase protein [Rhizobium etli CFN 42]
 gi|86281167|gb|ABC90230.1| probable oxidoreductase protein [Rhizobium etli CFN 42]
          Length = 246

 Score =  298 bits (763), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 139/246 (56%), Positives = 183/246 (74%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           +++NL+ R+ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE L +A++ +     +
Sbjct: 1   MNINLEGRIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEDLDDAIKAVGGSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
             FDL D NA++     I +RWGKLDIL+ANAG+LG ISPI  I+ K F  VI++NV A 
Sbjct: 61  VPFDLADMNAIDALGGSIFERWGKLDILVANAGVLGVISPIGHIEAKVFEKVITINVTAT 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L +S  GRA+ILSSGAA+KCRP W AYSASKAA+EALARTW+ ET +T L
Sbjct: 121 WRLIRSVDPLLARSDAGRAVILSSGAAHKCRPFWSAYSASKAAVEALARTWAGETQSTPL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           R+ ++DPG TRT+MRA+A+P EDP T+PHP +VAK I  L      ETGKLF V +N+  
Sbjct: 181 RITSVDPGATRTAMRAQAVPGEDPLTLPHPSEVAKAILPLLGPGVTETGKLFIVRENKLA 240

Query: 252 NYLTPN 257
           +Y  P 
Sbjct: 241 DYRLPE 246


>gi|327187991|gb|EGE55221.1| short-chain dehydrogenase/reductase SDR [Rhizobium etli CNPAF512]
          Length = 246

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 137/246 (55%), Positives = 183/246 (74%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           +++NL+ ++ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE L +A++ +     +
Sbjct: 1   MNINLEGKIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEDLDDAIKAVGGSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
             FDL D NA++     I +RWGKLDIL+ANAG+LG ISPI  I+ K F  V+++NV A 
Sbjct: 61  VPFDLADMNAIDALGGSIFERWGKLDILVANAGVLGVISPIGHIEAKVFEKVMTINVTAT 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L +S  GRA+ILSSGAA+KCRP W AYSASKAA+EALARTW+ ET +T L
Sbjct: 121 WRLIRSVDPLLARSDAGRAVILSSGAAHKCRPFWSAYSASKAAVEALARTWAGETQSTPL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           R+ ++DPG TRT+MRA+A+P EDP T+PHP +VAK I  L      ETGKLF V +N+  
Sbjct: 181 RITSVDPGATRTAMRAQAVPGEDPQTLPHPSEVAKAILPLLGPGVTETGKLFIVRENKLA 240

Query: 252 NYLTPN 257
           +Y  P 
Sbjct: 241 DYRLPE 246


>gi|209548644|ref|YP_002280561.1| short-chain dehydrogenase/reductase SDR [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209534400|gb|ACI54335.1| short-chain dehydrogenase/reductase SDR [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 246

 Score =  295 bits (754), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 182/246 (73%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           +++NL+ ++ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE L +A++ +     +
Sbjct: 1   MNINLEGKIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEDLDDAIKAVGGTATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
             FDL D NA++     I +RWGKLDIL+ANAG+LG ISPI  I+ K F  V+++NV A 
Sbjct: 61  VPFDLADMNAIDALGGSIFERWGKLDILVANAGVLGVISPIGHIEAKVFEKVMTINVTAT 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L +S  GRA+ILSSGAA+KCRP W AYSASKAA+EALARTW+ E+ +T L
Sbjct: 121 WRLIRSVDPLLARSDAGRAVILSSGAAHKCRPFWSAYSASKAAVEALARTWAGESQSTPL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           R+ ++DPG TRT+MRA+A+P EDP T+PHP +VAK I  L      ETGKLF V  N+  
Sbjct: 181 RITSVDPGATRTAMRAQAVPGEDPQTLPHPSEVAKAILPLLGPGVTETGKLFIVRDNKLA 240

Query: 252 NYLTPN 257
           +Y  P 
Sbjct: 241 DYRLPE 246


>gi|190891112|ref|YP_001977654.1| oxidoreductase [Rhizobium etli CIAT 652]
 gi|190696391|gb|ACE90476.1| probable oxidoreductase protein [Rhizobium etli CIAT 652]
          Length = 246

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 137/246 (55%), Positives = 182/246 (73%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           +++NL+ ++ALVTG+SRGIGY+TALELA++GA+VIA  R++  LE L +A++ I     +
Sbjct: 1   MNINLEGKIALVTGASRGIGYFTALELAKAGAHVIASARTVGGLEDLDDAIKAIGGSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
             FDL D NA++     I +RWGKLDIL+ANAG+LG ISPI  I+ K F  V+++NV A 
Sbjct: 61  VPFDLADMNAIDALGGSIFERWGKLDILVANAGVLGVISPIGHIEAKVFDKVMTINVTAT 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L +S  GRA+ILSSGAA+KCRP W AYSASKAA+EALARTW+ ET +T L
Sbjct: 121 WRLIRSVDPLLARSDAGRAVILSSGAAHKCRPFWSAYSASKAAVEALARTWAGETQSTPL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           R+ ++DPG TRT+MRA+A+P EDP T+PHP +VAK I  L      ETGKLF V +N+  
Sbjct: 181 RITSVDPGATRTAMRAQAVPGEDPQTLPHPSEVAKAILPLLGPGVTETGKLFIVRENKLA 240

Query: 252 NYLTPN 257
           +Y  P 
Sbjct: 241 DYRLPE 246


>gi|325292454|ref|YP_004278318.1| short-chain dehydrogenase/reductase SDR [Agrobacterium sp. H13-3]
 gi|325060307|gb|ADY63998.1| short-chain dehydrogenase/reductase SDR [Agrobacterium sp. H13-3]
          Length = 246

 Score =  291 bits (745), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 179/244 (73%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           +NL  R+ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE L +A++ +     +  
Sbjct: 3   INLKGRIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEDLDDAIKAVGGTATLVP 62

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           FDL D NA++     I +RWGKLDIL+ANAG+LG ISP+  I+ K F  V+++NV A W 
Sbjct: 63  FDLADMNAIDALGANIFERWGKLDILVANAGVLGVISPVGHIEAKVFEKVMTINVTATWR 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++RS +P L +S  GRA+ILSSGAA+ CRP WG YS SKAA+EALARTW+ ET  TALR+
Sbjct: 123 LIRSVEPLLLRSDAGRALILSSGAAHSCRPFWGVYSTSKAAVEALARTWAAETDKTALRI 182

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
            +I+PG TRT+MRA+AMP EDP  VPHP +VA  I  L + +  ETGKLF V + +F++Y
Sbjct: 183 NSINPGATRTAMRAQAMPGEDPADVPHPSEVAAAIVQLASPELTETGKLFVVREGKFLDY 242

Query: 254 LTPN 257
             P 
Sbjct: 243 RQPE 246


>gi|150395950|ref|YP_001326417.1| short-chain dehydrogenase/reductase SDR [Sinorhizobium medicae
           WSM419]
 gi|150027465|gb|ABR59582.1| short-chain dehydrogenase/reductase SDR [Sinorhizobium medicae
           WSM419]
          Length = 250

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 184/249 (73%)

Query: 9   NSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK 68
           N+ +  NL +R+A+VTG+SRGIGY+TALELA++GA+V+AC R++  LE+L +A++ +   
Sbjct: 2   NNNMMPNLKDRIAVVTGASRGIGYFTALELAKAGAHVVACARTVGGLEELDDAIKALGGS 61

Query: 69  IDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
             +  FDL D  A++     I +RWGKLDIL+ANAG+LG+ISPI  ++ K F  V+++NV
Sbjct: 62  ATLVPFDLADMTAIDKLGGAINERWGKLDILVANAGVLGTISPIGHVEAKVFEKVMAINV 121

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A W ++RS +P L +S  GRA+ILSS AA+KC+P WG YSASKAA+EALARTW+ ET  
Sbjct: 122 TATWRLIRSLEPLLTRSDTGRALILSSSAAHKCKPFWGPYSASKAAVEALARTWAYETQR 181

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQN 248
             LR++++DPG TRT+MRA+AMP EDP TVPHP ++A+ +  L   ++ ETGKLF V + 
Sbjct: 182 LPLRILSVDPGATRTAMRAQAMPGEDPETVPHPSEIAQSLMPLLGPEQTETGKLFIVREK 241

Query: 249 RFVNYLTPN 257
           + V+Y  P 
Sbjct: 242 KIVDYRMPE 250


>gi|222148120|ref|YP_002549077.1| NAD/NADP dependent oxidoreductase [Agrobacterium vitis S4]
 gi|221735108|gb|ACM36071.1| NAD/NADP dependent oxidoreductase [Agrobacterium vitis S4]
          Length = 246

 Score =  286 bits (731), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 176/240 (73%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           V+L  R+ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE L +A+        +  
Sbjct: 3   VDLKGRIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEDLDDAITSAGGSATLVP 62

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           FDL D  A++     I +RWGKLDIL+ANAG+LG+ISP+  ++ K F  V+++NV A W 
Sbjct: 63  FDLADMGAIDALGGSIFERWGKLDILVANAGVLGTISPVAHVEAKVFEKVMTINVTATWR 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++RS DP + KS  GRA+ILSS A +KC+P WG YSASKAA+EALARTW+ E     LRV
Sbjct: 123 LIRSIDPLITKSDQGRALILSSAAPHKCKPFWGPYSASKAAVEALARTWAAENQRLPLRV 182

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
           ++IDPG TRT+MRA+AMP EDP+T+PHP +VAK +  L   Q+ ETGKLF V + + V+Y
Sbjct: 183 LSIDPGATRTAMRAQAMPGEDPDTLPHPSEVAKALLPLVGPQQTETGKLFIVREQKIVDY 242


>gi|227821448|ref|YP_002825418.1| putative short-chain dehydrogenase/reductase [Sinorhizobium fredii
           NGR234]
 gi|227340447|gb|ACP24665.1| putative short-chain dehydrogenase/reductase [Sinorhizobium fredii
           NGR234]
          Length = 246

 Score =  286 bits (731), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 180/244 (73%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           +NL +R+A+VTG+SRGIGY+TALELA++GA+VIAC R++  LE+L +A++       +  
Sbjct: 3   LNLKDRIAVVTGASRGIGYFTALELAKAGAHVIACARTVGGLEELDDAIKAAGGSATLVP 62

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           FDL D  A++     I +RWGKLDIL+ANAG+LG+ISPI  ++ K F  V+S+NV A W 
Sbjct: 63  FDLADMAAIDKLGGAINERWGKLDILVANAGVLGTISPIGHVEAKVFEKVMSINVTATWR 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++RS +P L KS  GRA+ILSS AA+KC+P WG YSASKAA+EALARTW+ ET    LR+
Sbjct: 123 LIRSLEPLLVKSDAGRALILSSSAAHKCKPFWGPYSASKAAVEALARTWAYETQRLPLRI 182

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
           +++DPG TRT+MRA+A+P EDP TVPHP +VA  +  L   ++ ETGKLF V + + V+Y
Sbjct: 183 LSVDPGATRTAMRAQAVPGEDPATVPHPSEVAAALMPLLGPEQTETGKLFLVREKKIVDY 242

Query: 254 LTPN 257
             P 
Sbjct: 243 RMPE 246


>gi|15964876|ref|NP_385229.1| putative oxidoreductase protein [Sinorhizobium meliloti 1021]
 gi|307300947|ref|ZP_07580716.1| short-chain dehydrogenase/reductase SDR [Sinorhizobium meliloti
           BL225C]
 gi|307321850|ref|ZP_07601236.1| short-chain dehydrogenase/reductase SDR [Sinorhizobium meliloti
           AK83]
 gi|15074055|emb|CAC45702.1| Probable NAD/NADP dependent oxidoreductase [Sinorhizobium meliloti
           1021]
 gi|306892519|gb|EFN23319.1| short-chain dehydrogenase/reductase SDR [Sinorhizobium meliloti
           AK83]
 gi|306903902|gb|EFN34488.1| short-chain dehydrogenase/reductase SDR [Sinorhizobium meliloti
           BL225C]
          Length = 246

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 180/243 (74%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL +R+A+VTG+SRGIGY+TALELA++GA+V+AC R++  LE+L +A++       +  F
Sbjct: 4   NLKDRIAVVTGASRGIGYFTALELAKAGAHVVACARTLGGLEELDDAIKAFGGSATLVPF 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D  A++     I +RWGKLDI++ANAG+LG+ISPI  ++ K F  V+++NV A W +
Sbjct: 64  DLSDMAAIDKLGGAINERWGKLDIMVANAGVLGTISPIGHVEAKVFEKVMAINVTATWRL 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +RS +P L +S  GRA+ILSS AA+KC+P WG YSASKAA+EALARTW+ ET    LR++
Sbjct: 124 IRSLEPLLVRSDAGRALILSSSAAHKCKPFWGPYSASKAAVEALARTWAYETQRLPLRIL 183

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
           ++DPG TRT+MRA+A+P EDP T+PHP +VA+ +  L   ++ ETGKLF V + + V+Y 
Sbjct: 184 SVDPGATRTAMRAQAVPGEDPETLPHPSEVAQALLPLLGREQTETGKLFIVREKKIVDYR 243

Query: 255 TPN 257
            P 
Sbjct: 244 MPE 246


>gi|15888417|ref|NP_354098.1| NAD/NADP dependent oxidoreductase [Agrobacterium tumefaciens str.
           C58]
 gi|15156103|gb|AAK86883.1| NAD/NADP dependent oxidoreductase [Agrobacterium tumefaciens str.
           C58]
          Length = 246

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 175/244 (71%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L  R+ALVTG+SRGIGY+TALELA++GA+VIAC R++  LE+L +A++ +     +  
Sbjct: 3   IDLKGRIALVTGASRGIGYFTALELAKAGAHVIACARTVGGLEELDDAIKAVGGTATLVP 62

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           FDL D  A++     I +RWGKLDIL+ANAG+LG ISP+  I+ K F  V+++NV A W 
Sbjct: 63  FDLADMKAIDALGANIYERWGKLDILVANAGVLGVISPVGHIEAKVFERVMNINVTATWR 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++RS +P L KS  GRA+ILSSG A+ CRP WG Y+ SKAA+EALARTW+ ET  + LR+
Sbjct: 123 LIRSVEPLLLKSDAGRALILSSGVAHSCRPFWGVYATSKAAVEALARTWAAETQKSPLRI 182

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
            +I+PG TRT+MRA+AMP EDP TVPHP +VA  I  L +    ETGKLF V   +FV Y
Sbjct: 183 NSINPGATRTAMRAQAMPGEDPATVPHPSEVAAAILPLASPDLTETGKLFLVRDKKFVEY 242

Query: 254 LTPN 257
             P 
Sbjct: 243 RQPE 246


>gi|163760551|ref|ZP_02167632.1| NAD/NADP dependent oxidoreductase [Hoeflea phototrophica DFL-43]
 gi|162282166|gb|EDQ32456.1| NAD/NADP dependent oxidoreductase [Hoeflea phototrophica DFL-43]
          Length = 245

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 171/243 (70%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L+ R+ALVTG+SRGIGY+TAL LA+ GA+VIA  R+   LE+L + +QK      +   
Sbjct: 3   SLEGRIALVTGASRGIGYWTALALAKQGAHVIAIARTTGGLEELDDEIQKAGGSATLVPM 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D  A++     I  RWGKLDIL+ANAG+LG+ISP+  ++ K F  V++VNV A W +
Sbjct: 63  DLTDMPAIDRLGGAINDRWGKLDILVANAGVLGTISPVGHVEAKVFDKVMAVNVTATWRV 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +RS +P L KS  GRA+ILSSG A+  R  WG Y+ASKAA+E LAR W+ ET  TAL V 
Sbjct: 123 IRSVEPLLIKSEAGRALILSSGVAHSARAFWGPYAASKAAVETLARVWAAETEKTALNVN 182

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
           +IDPG TRT+MRA+AMP E+P+T+PHP +VA  +  LC T  IETGKLF V +NRF +Y 
Sbjct: 183 SIDPGATRTAMRAQAMPGENPDTLPHPSEVAAKLIPLCMTDCIETGKLFRVAENRFFDYR 242

Query: 255 TPN 257
            P 
Sbjct: 243 LPE 245


>gi|260168216|ref|ZP_05755027.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Brucella sp. F5/99]
 gi|261757677|ref|ZP_06001386.1| short-chain dehydrogenase/reductase SDR [Brucella sp. F5/99]
 gi|261737661|gb|EEY25657.1| short-chain dehydrogenase/reductase SDR [Brucella sp. F5/99]
          Length = 246

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 177/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 61  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET+   L
Sbjct: 121 WRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETMKMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 181 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFL 240

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 241 DYHMPS 246


>gi|225626954|ref|ZP_03784993.1| ribitol-5-phosphate dehydrogenase [Brucella ceti str. Cudo]
 gi|225618611|gb|EEH15654.1| ribitol-5-phosphate dehydrogenase [Brucella ceti str. Cudo]
          Length = 255

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 177/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 10  MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 69

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 70  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET+   L
Sbjct: 130 WRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETMKMKL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 190 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFL 249

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 250 DYHMPS 255


>gi|23501346|ref|NP_697473.1| short chain dehydrogenase/reductase family oxidoreductase [Brucella
           suis 1330]
 gi|62289430|ref|YP_221223.1| short chain dehydrogenase/reductase family oxidoreductase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82699357|ref|YP_413931.1| short-chain dehydrogenase/reductase SDR:glucose/ribitol
           dehydrogenase [Brucella melitensis biovar Abortus 2308]
 gi|161618417|ref|YP_001592304.1| short-chain dehydrogenase/reductase SDR [Brucella canis ATCC 23365]
 gi|163842725|ref|YP_001627129.1| short-chain dehydrogenase/reductase SDR [Brucella suis ATCC 23445]
 gi|189023681|ref|YP_001934449.1| Short-chain dehydrogenase/reductase SDR [Brucella abortus S19]
 gi|225851981|ref|YP_002732214.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis ATCC
           23457]
 gi|254693226|ref|ZP_05155054.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 3
           str. Tulya]
 gi|254696871|ref|ZP_05158699.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254701250|ref|ZP_05163078.1| short-chain dehydrogenase/reductase SDR [Brucella suis bv. 5 str.
           513]
 gi|254703797|ref|ZP_05165625.1| short-chain dehydrogenase/reductase SDR [Brucella suis bv. 3 str.
           686]
 gi|254707826|ref|ZP_05169654.1| short-chain dehydrogenase/reductase SDR [Brucella pinnipedialis
           M163/99/10]
 gi|254709593|ref|ZP_05171404.1| short-chain dehydrogenase/reductase SDR [Brucella pinnipedialis
           B2/94]
 gi|254718623|ref|ZP_05180434.1| short-chain dehydrogenase/reductase SDR [Brucella sp. 83/13]
 gi|254729776|ref|ZP_05188354.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 4
           str. 292]
 gi|256031085|ref|ZP_05444699.1| short-chain dehydrogenase/reductase SDR [Brucella pinnipedialis
           M292/94/1]
 gi|256044162|ref|ZP_05447069.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256112970|ref|ZP_05453873.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 3
           str. Ether]
 gi|256159153|ref|ZP_05456970.1| short-chain dehydrogenase/reductase SDR [Brucella ceti M490/95/1]
 gi|256254488|ref|ZP_05460024.1| short-chain dehydrogenase/reductase SDR [Brucella ceti B1/94]
 gi|256264511|ref|ZP_05467043.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 2
           str. 63/9]
 gi|256368900|ref|YP_003106406.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Brucella microti CCM 4915]
 gi|260545818|ref|ZP_05821559.1| short-chain dehydrogenase/reductase SDR [Brucella abortus NCTC
           8038]
 gi|260563520|ref|ZP_05834006.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 1
           str. 16M]
 gi|260566950|ref|ZP_05837420.1| short-chain dehydrogenase/reductase SDR [Brucella suis bv. 4 str.
           40]
 gi|260757442|ref|ZP_05869790.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 4
           str. 292]
 gi|260761267|ref|ZP_05873610.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 2
           str. 86/8/59]
 gi|261213469|ref|ZP_05927750.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 3
           str. Tulya]
 gi|261221661|ref|ZP_05935942.1| short-chain dehydrogenase/reductase SDR [Brucella ceti B1/94]
 gi|261315313|ref|ZP_05954510.1| short-chain dehydrogenase/reductase SDR [Brucella pinnipedialis
           M163/99/10]
 gi|261317121|ref|ZP_05956318.1| short-chain dehydrogenase/reductase SDR [Brucella pinnipedialis
           B2/94]
 gi|261751789|ref|ZP_05995498.1| short-chain dehydrogenase/reductase SDR [Brucella suis bv. 5 str.
           513]
 gi|261754444|ref|ZP_05998153.1| short-chain dehydrogenase/reductase SDR [Brucella suis bv. 3 str.
           686]
 gi|265983600|ref|ZP_06096335.1| short-chain dehydrogenase/reductase SDR [Brucella sp. 83/13]
 gi|265988158|ref|ZP_06100715.1| short-chain dehydrogenase/reductase SDR [Brucella pinnipedialis
           M292/94/1]
 gi|265990574|ref|ZP_06103131.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265994404|ref|ZP_06106961.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 3
           str. Ether]
 gi|265997623|ref|ZP_06110180.1| short-chain dehydrogenase/reductase SDR [Brucella ceti M490/95/1]
 gi|306839858|ref|ZP_07472656.1| short-chain dehydrogenase/reductase SDR [Brucella sp. NF 2653]
 gi|306845074|ref|ZP_07477654.1| short-chain dehydrogenase/reductase SDR [Brucella sp. BO1]
 gi|23347238|gb|AAN29388.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Brucella suis 1330]
 gi|62195562|gb|AAX73862.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Brucella abortus bv. 1 str. 9-941]
 gi|82615458|emb|CAJ10427.1| Short-chain dehydrogenase/reductase SDR:Glucose/ribitol
           dehydrogenase [Brucella melitensis biovar Abortus 2308]
 gi|161335228|gb|ABX61533.1| short-chain dehydrogenase/reductase SDR [Brucella canis ATCC 23365]
 gi|163673448|gb|ABY37559.1| short-chain dehydrogenase/reductase SDR [Brucella suis ATCC 23445]
 gi|189019253|gb|ACD71975.1| Short-chain dehydrogenase/reductase SDR [Brucella abortus S19]
 gi|225640346|gb|ACO00260.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis ATCC
           23457]
 gi|255999058|gb|ACU47457.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Brucella microti CCM 4915]
 gi|260097225|gb|EEW81100.1| short-chain dehydrogenase/reductase SDR [Brucella abortus NCTC
           8038]
 gi|260153536|gb|EEW88628.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 1
           str. 16M]
 gi|260156468|gb|EEW91548.1| short-chain dehydrogenase/reductase SDR [Brucella suis bv. 4 str.
           40]
 gi|260667760|gb|EEX54700.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 4
           str. 292]
 gi|260671699|gb|EEX58520.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260915076|gb|EEX81937.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 3
           str. Tulya]
 gi|260920245|gb|EEX86898.1| short-chain dehydrogenase/reductase SDR [Brucella ceti B1/94]
 gi|261296344|gb|EEX99840.1| short-chain dehydrogenase/reductase SDR [Brucella pinnipedialis
           B2/94]
 gi|261304339|gb|EEY07836.1| short-chain dehydrogenase/reductase SDR [Brucella pinnipedialis
           M163/99/10]
 gi|261741542|gb|EEY29468.1| short-chain dehydrogenase/reductase SDR [Brucella suis bv. 5 str.
           513]
 gi|261744197|gb|EEY32123.1| short-chain dehydrogenase/reductase SDR [Brucella suis bv. 3 str.
           686]
 gi|262552091|gb|EEZ08081.1| short-chain dehydrogenase/reductase SDR [Brucella ceti M490/95/1]
 gi|262765517|gb|EEZ11306.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 3
           str. Ether]
 gi|263001358|gb|EEZ13933.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263094844|gb|EEZ18582.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis bv. 2
           str. 63/9]
 gi|264660355|gb|EEZ30616.1| short-chain dehydrogenase/reductase SDR [Brucella pinnipedialis
           M292/94/1]
 gi|264662192|gb|EEZ32453.1| short-chain dehydrogenase/reductase SDR [Brucella sp. 83/13]
 gi|306274489|gb|EFM56284.1| short-chain dehydrogenase/reductase SDR [Brucella sp. BO1]
 gi|306405044|gb|EFM61325.1| short-chain dehydrogenase/reductase SDR [Brucella sp. NF 2653]
 gi|326408478|gb|ADZ65543.1| Short-chain dehydrogenase/reductase SDR [Brucella melitensis M28]
 gi|326538194|gb|ADZ86409.1| short-chain dehydrogenase/reductase SDR [Brucella melitensis M5-90]
          Length = 246

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 176/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 61  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 121 WRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 181 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFL 240

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 241 DYHMPS 246


>gi|17987772|ref|NP_540406.1| ribitol-5-phosphate dehydrogenase [NADP('+)] [Brucella melitensis
           bv. 1 str. 16M]
 gi|237814919|ref|ZP_04593917.1| ribitol-5-phosphate dehydrogenase [Brucella abortus str. 2308 A]
 gi|17983495|gb|AAL52670.1| short chain dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|237789756|gb|EEP63966.1| ribitol-5-phosphate dehydrogenase [Brucella abortus str. 2308 A]
          Length = 255

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 176/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 10  MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 69

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 70  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 130 WRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 190 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFL 249

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 250 DYHMPS 255


>gi|294851824|ref|ZP_06792497.1| ribitol-5-phosphate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|294820413|gb|EFG37412.1| ribitol-5-phosphate dehydrogenase [Brucella sp. NVSL 07-0026]
          Length = 246

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 176/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 61  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 121 WRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 181 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLAYPKLEVTGKLFDVRQDRFL 240

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 241 DYHMPS 246


>gi|254688743|ref|ZP_05151997.1| ribitol-5-phosphate dehydrogenase (NADP('+)) [Brucella abortus bv.
           6 str. 870]
 gi|260754222|ref|ZP_05866570.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 6
           str. 870]
 gi|260674330|gb|EEX61151.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 6
           str. 870]
          Length = 246

 Score =  265 bits (676), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 176/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 61  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 121 WRLIRSVDPLLRASDTGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 181 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFL 240

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 241 DYHMPS 246


>gi|148558912|ref|YP_001258465.1| short chain dehydrogenase/reductase family oxidoreductase [Brucella
           ovis ATCC 25840]
 gi|148370169|gb|ABQ60148.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Brucella ovis ATCC 25840]
          Length = 255

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 176/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 10  MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 69

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 70  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 130 WRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 190 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLAYPKLEVTGKLFDVRQDRFL 249

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 250 DYHMPS 255


>gi|297247843|ref|ZP_06931561.1| ribitol-5-phosphate dehydrogenase [Brucella abortus bv. 5 str.
           B3196]
 gi|297175012|gb|EFH34359.1| ribitol-5-phosphate dehydrogenase [Brucella abortus bv. 5 str.
           B3196]
          Length = 255

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 176/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 10  MNIDLRGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 69

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 70  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 130 WRLIRSVDPLLRASDTGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 190 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFL 249

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 250 DYHMPS 255


>gi|256256990|ref|ZP_05462526.1| ribitol-5-phosphate dehydrogenase (NADP('+)) [Brucella abortus bv.
           9 str. C68]
 gi|260883247|ref|ZP_05894861.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 9
           str. C68]
 gi|260872775|gb|EEX79844.1| short-chain dehydrogenase/reductase SDR [Brucella abortus bv. 9
           str. C68]
          Length = 246

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 176/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MNIDLRGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 61  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 121 WRLIRSVDPLLRASDTGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 181 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFL 240

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 241 DYHMPS 246


>gi|306842269|ref|ZP_07474932.1| short-chain dehydrogenase/reductase SDR [Brucella sp. BO2]
 gi|306287649|gb|EFM59096.1| short-chain dehydrogenase/reductase SDR [Brucella sp. BO2]
          Length = 246

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 122/246 (49%), Positives = 176/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  R+ALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MNIDLTGRIALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSGATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 61  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 121 WRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 181 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFL 240

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 241 DYHMPS 246


>gi|256060579|ref|ZP_05450747.1| short-chain dehydrogenase/reductase SDR [Brucella neotomae 5K33]
 gi|261324574|ref|ZP_05963771.1| short-chain dehydrogenase/reductase SDR [Brucella neotomae 5K33]
 gi|261300554|gb|EEY04051.1| short-chain dehydrogenase/reductase SDR [Brucella neotomae 5K33]
          Length = 246

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 122/246 (49%), Positives = 175/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 61  VPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG  + CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 121 WRLIRSVDPLLRASDAGRAIMLSSGVVHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L   +   TGKLF V Q+RF+
Sbjct: 181 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFL 240

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 241 DYHMPS 246


>gi|254712991|ref|ZP_05174802.1| short-chain dehydrogenase/reductase SDR [Brucella ceti M644/93/1]
 gi|254716655|ref|ZP_05178466.1| short-chain dehydrogenase/reductase SDR [Brucella ceti M13/05/1]
 gi|261218456|ref|ZP_05932737.1| short-chain dehydrogenase/reductase SDR [Brucella ceti M13/05/1]
 gi|261320694|ref|ZP_05959891.1| short-chain dehydrogenase/reductase SDR [Brucella ceti M644/93/1]
 gi|260923545|gb|EEX90113.1| short-chain dehydrogenase/reductase SDR [Brucella ceti M13/05/1]
 gi|261293384|gb|EEX96880.1| short-chain dehydrogenase/reductase SDR [Brucella ceti M644/93/1]
          Length = 246

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 179/247 (72%), Gaps = 2/247 (0%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++++L  RLALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ +  AL+     I +RWGKLDIL+ANAGILG+ISPI  ++ K+F  V+++NV + 
Sbjct: 61  VPLDITNMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR W++ET    L
Sbjct: 121 WRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGKLFSVPQNRF 250
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L A  K+E TGKLF V Q+RF
Sbjct: 181 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKL-ANPKLEVTGKLFDVRQDRF 239

Query: 251 VNYLTPN 257
           ++Y  P+
Sbjct: 240 LDYHMPS 246


>gi|239831317|ref|ZP_04679646.1| short-chain dehydrogenase/reductase SDR [Ochrobactrum intermedium
           LMG 3301]
 gi|239823584|gb|EEQ95152.1| short-chain dehydrogenase/reductase SDR [Ochrobactrum intermedium
           LMG 3301]
          Length = 246

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 175/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           + ++L  R+ALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MSIDLTGRIALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDDIRKLGGSATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  A++     I +RWGKLDI++ANAG+LG+ISPI  ++ K+F  V++VNV + 
Sbjct: 61  VPLDITDMEAIDRLGGSIHERWGKLDIMVANAGVLGTISPIGHVEAKTFEKVMNVNVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR+W++ET    L
Sbjct: 121 WRLIRSTDPLLRASDAGRAILLSSGVAHTCRAFWGPYAASKAAVEVMARSWAEETKQMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           +V +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L       TGKLF V Q+RF+
Sbjct: 181 KVNSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPALDVTGKLFDVRQDRFL 240

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 241 DYHLPS 246


>gi|153007904|ref|YP_001369119.1| short-chain dehydrogenase/reductase SDR [Ochrobactrum anthropi ATCC
           49188]
 gi|151559792|gb|ABS13290.1| short-chain dehydrogenase/reductase SDR [Ochrobactrum anthropi ATCC
           49188]
          Length = 246

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 118/246 (47%), Positives = 175/246 (71%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           + ++L  R+ALVTG+SRGIGY+ +LELA+ GA+VIA  R++  LE+L + ++K+     +
Sbjct: 1   MSIDLTGRIALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDDIRKLGGNATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ D  A++     I +RWGKLDI++ANAG+LG+ISPI  ++ K+F  +++VNV + 
Sbjct: 61  VPLDITDMEAIDRLGGSIHERWGKLDIMVANAGVLGTISPIGHVEAKTFEKLMNVNVTSV 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           W ++RS DP L+ S  GRAI+LSSG A+ CR  WG Y+ASKAA+E +AR+W++ET    L
Sbjct: 121 WRLIRSTDPLLRASDAGRAILLSSGVAHTCRAFWGPYAASKAAVEVMARSWAEETKQMKL 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           ++ +++PG TRT+MRA+AMP EDP T+P PQ VA+ I  L       +GKLF V Q+RF+
Sbjct: 181 KINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPNLEVSGKLFDVRQDRFL 240

Query: 252 NYLTPN 257
           +Y  P+
Sbjct: 241 DYHLPS 246


>gi|240850211|ref|YP_002971604.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii as4aup]
 gi|240267334|gb|ACS50922.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii as4aup]
          Length = 249

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/243 (49%), Positives = 169/243 (69%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  R+ALVTG+SRGIGYY ALELA  GA++IA  R++S L +L N +++      +   
Sbjct: 7   SLHGRVALVTGASRGIGYYLALELAARGAHIIALARTVSGLTELDNQIREKGAHATLVPL 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL     ++     IAKRW KLDI++ANAGILG++SPI  I+   F DV  +N+ + W +
Sbjct: 67  DLHHMENIDTLAISIAKRWKKLDIIVANAGILGTLSPIAHIENTVFEDVFQINLFSQWRL 126

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           M++ +P L++S  GRAI+LSS  A+  RP WGAY+ASKAA+E +AR W++E   T ++V 
Sbjct: 127 MKAVEPLLRESDAGRAILLSSSVAHAARPFWGAYAASKAALEMIARCWAEELKQTPIKVN 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
            ++PG TRT+MRA+AMP EDP T+P PQ+VAK I  L +    ETGKLF+V +NRFV+Y 
Sbjct: 187 CVNPGATRTAMRAEAMPGEDPQTLPSPQEVAKKIVHLLSPDLKETGKLFNVHKNRFVDYH 246

Query: 255 TPN 257
            P+
Sbjct: 247 VPD 249


>gi|49475318|ref|YP_033359.1| oxidoreductase [Bartonella henselae str. Houston-1]
 gi|49238124|emb|CAF27331.1| Oxidoreductase [Bartonella henselae str. Houston-1]
          Length = 249

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 171/247 (69%)

Query: 11  EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID 70
           ++  +L  R+ALVTG+SRGIGY+ ALELA  GA++IA  R++S L +L N +QK   +  
Sbjct: 3   KLDFSLFGRVALVTGASRGIGYHLALELAERGAHIIALARTMSGLTELDNQIQKKGARAT 62

Query: 71  IFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
           +   DL     ++   T I + W KLDI+IANAGILG++SPI  I+ K F D+  +N+++
Sbjct: 63  LIPIDLHHMENIDALATSITQDWKKLDIMIANAGILGTLSPIAHIENKVFEDIFQINLIS 122

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            W +M++ +P L+KS  GR I+LSS  A+  R  WG Y+ASKAA+E ++R W++E   T 
Sbjct: 123 QWRLMKAVEPLLRKSDAGRVILLSSSVAHVARAFWGPYAASKAALEIISRCWAEELKQTP 182

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRF 250
           +++  +DPG TRT+MRA+AMP EDP T+P PQ+VA+ I+ L +    ETGKLF+V +NRF
Sbjct: 183 IKINCVDPGATRTAMRAQAMPGEDPQTLPPPQEVAEKIAHLLSPDLKETGKLFNVRKNRF 242

Query: 251 VNYLTPN 257
           +NY  PN
Sbjct: 243 MNYHAPN 249


>gi|163868007|ref|YP_001609211.1| short chain dehydrogenase/reductase family oxidoreductase
           [Bartonella tribocorum CIP 105476]
 gi|161017658|emb|CAK01216.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella tribocorum CIP 105476]
          Length = 250

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 118/243 (48%), Positives = 171/243 (70%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  R+ALVTG+SRGIGYY ALELA  GA++IA  R++S L +L N ++K      +   
Sbjct: 8   SLHGRVALVTGASRGIGYYLALELAARGAHIIALARTVSGLTELDNKIRKKGAYATLVPL 67

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL     ++     IAKRW KLDI++ANAGILG++SPI  I+   F DV  +N+++ W +
Sbjct: 68  DLHHMENIDTLALSIAKRWKKLDIIVANAGILGTLSPIAHIENTVFEDVFQINLISQWRL 127

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +++ +P L++S  GRAI+LSS  A+  RP WGAY+ASKAA+E +AR W++E   T++++ 
Sbjct: 128 IKALEPLLRESDAGRAILLSSSVAHVARPFWGAYAASKAALEMIARCWAEELKQTSIKIN 187

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
            ++PG TRT++RA+AMP EDP T+P PQ+VAK I  L +    ETGKLF+V +N+FV+Y 
Sbjct: 188 CVNPGATRTAIRAEAMPGEDPQTLPSPQEVAKKIVHLLSPDLKETGKLFNVRKNQFVDYH 247

Query: 255 TPN 257
            P+
Sbjct: 248 APH 250


>gi|13476497|ref|NP_108067.1| oxidoreductase [Mesorhizobium loti MAFF303099]
 gi|14027258|dbj|BAB54212.1| probable oxidoreductase [Mesorhizobium loti MAFF303099]
          Length = 246

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 164/244 (67%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L  R+A+VTG+SRGIGY+ A ELA +GA+VIA  R++  LE+L + ++    +  +  
Sbjct: 3   LDLTGRVAVVTGASRGIGYFIARELAAAGAHVIAVARTVGGLEELDDQIKAAGGQATLVP 62

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DL D   ++     I +RWGKLDIL+ANAG+LG ISPI  ++ K+F  V+++NV + W 
Sbjct: 63  LDLADMAGIDRLGGAIHERWGKLDILVANAGVLGVISPIGHVEAKTFEKVMTINVTSTWR 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++RS DP L+ S  GRAIILSS AA+  R  W  Y+ASKAA+E + R+W+ ET +  LRV
Sbjct: 123 LIRSVDPLLRLSDAGRAIILSSNAAHSARAFWAPYAASKAAVETMMRSWAHETQSLPLRV 182

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
              DPG TRT+MRA+A+P EDP T+PHP ++AK I  L + +  ETG +F    NRFV Y
Sbjct: 183 NAADPGATRTAMRAQAVPGEDPETLPHPSEIAKRIVPLASPELKETGLIFQAKHNRFVAY 242

Query: 254 LTPN 257
             P 
Sbjct: 243 RQPE 246


>gi|319784448|ref|YP_004143924.1| short-chain dehydrogenase/reductase SDR [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170336|gb|ADV13874.1| short-chain dehydrogenase/reductase SDR [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 246

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 163/244 (66%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L  R+A+VTG+SRGIGY+ A ELA +GA+VIA  R++  LE+L + ++    +  +  
Sbjct: 3   LDLSGRVAVVTGASRGIGYFIAKELAAAGAHVIAVARTVGGLEELDDQIKAAGGQATLVP 62

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DL D   ++     I +RWGKLDIL+ANAG+LG ISPI  ++ K+F  V+++NV + W 
Sbjct: 63  LDLADMAGIDRLGGAIHERWGKLDILVANAGVLGVISPIGHVEAKTFEKVMTINVTSTWR 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++RS DP L+ S  GRAIILSS AA+  R  W  Y+ASKAA+E + R+W+ ET +  LRV
Sbjct: 123 LIRSVDPLLRLSDAGRAIILSSNAAHSARAFWAPYAASKAAVETMMRSWAHETQSLPLRV 182

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
              DPG TRT+MRA+A+P EDP T+PHP ++AK I  L +    ETG +F    NRFV Y
Sbjct: 183 NAADPGATRTAMRAQAVPGEDPETLPHPSEIAKRIVPLASPDLKETGLIFQAKHNRFVAY 242

Query: 254 LTPN 257
             P 
Sbjct: 243 RQPE 246


>gi|110633335|ref|YP_673543.1| short-chain dehydrogenase/reductase SDR [Mesorhizobium sp. BNC1]
 gi|110284319|gb|ABG62378.1| short-chain dehydrogenase/reductase SDR [Chelativorans sp. BNC1]
          Length = 248

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 168/244 (68%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L  R+ALVTG+SRGIGY+ A  LA +GA+VIA  R++  LE+L + ++    +  +  
Sbjct: 5   MDLSGRIALVTGASRGIGYFLAKGLAAAGAHVIAVARTVGGLEELDDEIKAAGGQATLVP 64

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DL D  A++     I +RWGKLDIL+ANAGILG ISPI  ++ K+F  V++VNV + W 
Sbjct: 65  LDLTDMPAIDRLGGAIHERWGKLDILVANAGILGVISPIGHVEAKTFEKVMAVNVTSTWR 124

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++RS DP L+ S  GRAI++SSGAA+  R  WG Y+ASKAA+EAL R+W+ ET N  +RV
Sbjct: 125 LIRSVDPLLRASDAGRAIVMSSGAAHSARAFWGPYAASKAAVEALVRSWADETKNMPIRV 184

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
             +DPG TRT+MRA+AMP EDP+T+PHP+ VA+ I  L +    ETG +++V   RF  Y
Sbjct: 185 NAVDPGATRTAMRAQAMPGEDPDTLPHPRDVAEKILPLASPSITETGLIYNVRLGRFTRY 244

Query: 254 LTPN 257
             P 
Sbjct: 245 SMPE 248


>gi|260466973|ref|ZP_05813155.1| short-chain dehydrogenase/reductase SDR [Mesorhizobium
           opportunistum WSM2075]
 gi|259029270|gb|EEW30564.1| short-chain dehydrogenase/reductase SDR [Mesorhizobium
           opportunistum WSM2075]
          Length = 246

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 163/244 (66%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L  R+A+VTG+SRGIGY+ A ELA +GA+VIA  R++  LE+L + ++    +  +  
Sbjct: 3   LDLTGRVAVVTGASRGIGYFIAKELAAAGAHVIAVARTVGGLEELDDQIKAAGGQATLVP 62

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DL D   ++     I +RWGKLDIL+ANAG+LG ISPI  ++ K+F  V+++NV + W 
Sbjct: 63  LDLADMAGIDRLGGAIHERWGKLDILVANAGVLGVISPIGHVEAKTFEKVMTINVTSTWR 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++RS DP L+ S  GRAI+LSS AA+  R  W  Y+ASKAA+E + R+W+ ET +  LRV
Sbjct: 123 LIRSVDPLLRLSDAGRAILLSSNAAHSARAFWAPYAASKAAVETMMRSWAHETQSLPLRV 182

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
              DPG TRT+MRA+A+P EDP T+PHP ++AK I  L +    ETG +F    NRFV Y
Sbjct: 183 NAADPGATRTAMRAQAVPGEDPATLPHPSEIAKRIVPLASPDLKETGLIFQAKHNRFVAY 242

Query: 254 LTPN 257
             P 
Sbjct: 243 RQPE 246


>gi|254473407|ref|ZP_05086804.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Pseudovibrio sp. JE062]
 gi|211957523|gb|EEA92726.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Pseudovibrio sp. JE062]
          Length = 248

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 109/239 (45%), Positives = 159/239 (66%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ R+A+VTG+SRGIGY+ A +LA  GA++IA  R++  LE+L + +Q++     +   D
Sbjct: 6   LEGRVAVVTGASRGIGYFAAKKLAEEGAHIIAVARTVGGLEELDDEIQQLGSSATLVPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D +A++     I +RW KLDIL+ NAGILG  SP+  +  K F +V+ +NV ANW ++
Sbjct: 66  LTDFDAIDRLGAAIFERWKKLDILVGNAGILGPTSPLGHVAPKKFDEVMQINVTANWRLI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RS DP L++S  GR + L+SGA +KCR  WG YS SKAA+EAL RT+  ET  T ++ + 
Sbjct: 126 RSLDPLLRQSDAGRTVFLTSGAPHKCRAYWGPYSMSKAALEALVRTYVNETRKTNVKSML 185

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
           I+PGP RT MRAKAMP EDP T+PHP ++++ I   C  +  E G+L+  P     +++
Sbjct: 186 INPGPMRTGMRAKAMPGEDPKTLPHPSEISEDIVRFCLPENEENGRLYDFPSKELRDFV 244


>gi|319405472|emb|CBI79091.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella sp. AR 15-3]
          Length = 249

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 116/243 (47%), Positives = 164/243 (67%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L   +ALVTG+S+GIGY+ ALELA  GA++IA  R+IS L+ L N ++K      +   
Sbjct: 7   DLTGCVALVTGASKGIGYHLALELATRGAHIIALARTISGLKTLNNEIRKKGASATLIPL 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL +  A++   T I KRW KLDIL+ANA ILG +SPI  I+   F D++ +N+ + W +
Sbjct: 67  DLHNMEAIDALNTSIEKRWKKLDILVANAAILGVLSPITHIENAMFEDILQINLTSQWRL 126

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           M++ +P L KS  GRAI+LSS  A+  R  WG Y+ASKAA+E LAR W++E   T ++V 
Sbjct: 127 MKAIEPLLLKSDAGRAILLSSSVAHCARAFWGPYAASKAALELLARCWAEELKQTPIKVN 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
            ++PG TRT+MR +A+P EDP T+P PQ+VA  I +L +    ETG+LF V + RF+NY 
Sbjct: 187 CVNPGATRTAMRVQALPGEDPQTLPSPQEVAAEIVYLSSPHLQETGRLFDVRKKRFMNYH 246

Query: 255 TPN 257
           TP+
Sbjct: 247 TPD 249


>gi|319408298|emb|CBI81951.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella schoenbuchensis R1]
          Length = 249

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 166/243 (68%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL  R+ALVTG+SRGIGY+ ALELA  GA++IA  R+IS L  L   +Q+      +   
Sbjct: 7   NLSGRVALVTGASRGIGYHLALELAARGAHIIALARTISDLTTLDTKIQEKGSSTTLVPL 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL ++ A++   T IA+ W KLDI++ NAGILG +SP+  I+   F +V  VN++  W +
Sbjct: 67  DLHNTQAIDTLSTSIAECWKKLDIMVVNAGILGILSPMAHIESTVFEEVFQVNLINQWRL 126

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           M++ +P L+KS  GRAI LSS  A+  R  WG Y+ASKAA+E +AR W++E   T++++ 
Sbjct: 127 MKAVEPLLRKSDAGRAIFLSSSVAHCARAFWGPYAASKAALEIIARCWAEELKETSIKIN 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
            ++PG TRT+MRA+AMP E+P T+P PQ+VA+ I  L +    ETG+LF V +N+F+NY 
Sbjct: 187 CVNPGATRTAMRAQAMPNENPQTLPSPQEVAEKIVHLSSPYLKETGRLFDVRKNQFINYH 246

Query: 255 TPN 257
           TP+
Sbjct: 247 TPH 249


>gi|49474080|ref|YP_032122.1| oxidoreductase [Bartonella quintana str. Toulouse]
 gi|49239584|emb|CAF25941.1| Oxidoreductase [Bartonella quintana str. Toulouse]
          Length = 249

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/248 (45%), Positives = 169/248 (68%)

Query: 10  SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI 69
           +++  +L  R+ALV G+SRGIGY+ ALELA   A++IA  R++S L +L N +++     
Sbjct: 2   TKVDFSLFGRVALVIGASRGIGYHLALELAARDAHIIALARTMSGLTELDNKIREKGASA 61

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            +   DL     ++     IAKRW KLDI++ANA ILG++SPI  I+ + F DV  +N++
Sbjct: 62  TLIPLDLYHMENIDALSVSIAKRWEKLDIMVANAAILGTLSPIAHIENRVFEDVFQINLI 121

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           + W ++++ DP L+KS  GRAI+LSS  A+  R  WGAY+ASKAA+E +AR W++E   T
Sbjct: 122 SQWRLIKAIDPLLRKSDAGRAILLSSSVAHVARAFWGAYAASKAALEMIARCWAEELKQT 181

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNR 249
            +++  +DPG TRT+MRA+AMP EDP T+P  Q+VA+ I  L +    ETGKLF+V +NR
Sbjct: 182 PIKINCVDPGATRTAMRAQAMPDEDPQTLPSAQEVAEKIVHLLSPDLKETGKLFNVRKNR 241

Query: 250 FVNYLTPN 257
           F++Y  P+
Sbjct: 242 FMDYHAPD 249


>gi|319898710|ref|YP_004158803.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella clarridgeiae 73]
 gi|319402674|emb|CBI76220.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella clarridgeiae 73]
          Length = 249

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 163/243 (67%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL  R+ALVTG+SRGIGY+ ALELA  GA++IA  R+++ L  L N ++K      +   
Sbjct: 7   NLAGRVALVTGASRGIGYHLALELAVRGAHIIALARTMNGLTALDNEIKKKGGSATLVPV 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL +  A++     I +RW KLDIL+ANA ILG +SPI  I+   F +++ +N+ + W +
Sbjct: 67  DLNNMEAIDALNISIDERWKKLDILVANAAILGILSPIAHIENMMFENILQINLTSQWRL 126

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           M++ +P L+KS  GRAI LSS  A+  RP WG Y+ASKAA+E LAR W++E   T+++V 
Sbjct: 127 MKAVEPLLRKSDAGRAIFLSSSVAHCARPFWGPYAASKAALELLARCWAEELKQTSIKVN 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
            ++PG T T+MRA+AMP EDP T+P PQKVA  I+ L +    ETG LF V Q RF+NY 
Sbjct: 187 CVNPGATCTTMRAQAMPGEDPQTLPSPQKVAAEIAHLLSPHLKETGGLFDVRQKRFMNYH 246

Query: 255 TPN 257
            P+
Sbjct: 247 IPD 249


>gi|319407047|emb|CBI80684.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella sp. 1-1C]
          Length = 249

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 113/243 (46%), Positives = 170/243 (69%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L   +ALVTG+S+GIGY+ ALELA+ GA++IA  R++S L+ L N ++K      + +F
Sbjct: 7   HLTGCVALVTGASKGIGYHLALELAKRGAHIIALARTLSGLKTLNNEIKKKGGSATLVSF 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DLR+   ++     I K W KLDIL+ANA ILG++SPI   +   F +++ +N+ + W +
Sbjct: 67  DLRNMEVIDELNVSIDKCWKKLDILVANAAILGTLSPIAHTENAMFEEILQINLTSQWRL 126

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           M++ +P L+KS+ GRAI+LSS  A+  R  WG+Y+ASKAA+E LAR W++E   T+++V 
Sbjct: 127 MKAVEPLLRKSNAGRAILLSSSVAHCARASWGSYAASKAALELLARCWAEELKQTSIKVN 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
            ++PG TRT+MRA+A+P EDP T+P PQ+VA  I++L +    ETGKLF V + RF+NY 
Sbjct: 187 CVNPGATRTTMRAQALPDEDPQTLPSPQEVAAEIAYLSSPHLKETGKLFDVRKKRFMNYH 246

Query: 255 TPN 257
            P+
Sbjct: 247 IPD 249


>gi|298291072|ref|YP_003693011.1| short-chain dehydrogenase/reductase SDR [Starkeya novella DSM 506]
 gi|296927583|gb|ADH88392.1| short-chain dehydrogenase/reductase SDR [Starkeya novella DSM 506]
          Length = 254

 Score =  239 bits (609), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 162/242 (66%), Gaps = 1/242 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R+ALVTG++RGIG  TAL LA +GA+V+A GR+   LE+L +A+ K      +   D
Sbjct: 12  LAGRIALVTGATRGIGRATALALAEAGAHVVAVGRTAGALEELDDAIVKAGSTATLVPLD 71

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           ++D   ++     + +R+GKLD+ + NAG+LG I+P+ Q++   + D I+VN+ ANW ++
Sbjct: 72  MKDGAGIDRLGGALFERFGKLDVFVGNAGVLGPITPLAQVEPNEWDDAIAVNLTANWRLI 131

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRVI 194
           RS DP L+ S  GRA+++SSGAA+K R  WGAYS SKAA+E LARTW+ E +N ++L+V 
Sbjct: 132 RSLDPLLRLSTAGRAVLVSSGAAHKARAFWGAYSVSKAAVEVLARTWATEVMNISSLKVN 191

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
            I+PGP RT MRAKA P+EDP T+P P++VA  I  LC     ETGKL+  P      + 
Sbjct: 192 LINPGPIRTRMRAKAFPSEDPETLPAPEEVAAAILSLCLPSFEETGKLYDFPSRGLKEFP 251

Query: 255 TP 256
            P
Sbjct: 252 VP 253


>gi|121602443|ref|YP_988800.1| short chain dehydrogenase/reductase family oxidoreductase
           [Bartonella bacilliformis KC583]
 gi|120614620|gb|ABM45221.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Bartonella bacilliformis KC583]
          Length = 249

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/243 (45%), Positives = 166/243 (68%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL  R+AL+TG+SRGIGY+ A+ELA  GA++IA  R+++ L +L+  +Q I     +   
Sbjct: 7   NLSGRVALITGASRGIGYHLAIELAARGAHIIAIARTLNSLTELEKKIQNIGSSATLVPL 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           +L++  A++     IA+RW KLDI++ NA ILG++S I  ++   F +VI VN++++W +
Sbjct: 67  NLQNLEAIDDLSILIAERWKKLDIMVVNASILGTLSSISHVENVVFEEVIQVNLISSWRL 126

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           M++ +P L++S  GRAI+LSS  A+  R  WG Y+ASKA +E +AR W++E   T ++V 
Sbjct: 127 MKTVEPLLRQSDAGRAILLSSSVAHSARASWGPYAASKAGLEIIARCWAEELKQTHIKVN 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
            ++PG TRT MRA+A P EDP T+P PQ+VAK I+ L      ETGKLF V +NRF+NY 
Sbjct: 187 CVNPGATRTKMRAQAFPDEDPQTLPSPQEVAKKIAHLSLPDLKETGKLFDVRKNRFMNYC 246

Query: 255 TPN 257
            P+
Sbjct: 247 VPD 249


>gi|217976601|ref|YP_002360748.1| short-chain dehydrogenase/reductase SDR [Methylocella silvestris
           BL2]
 gi|217501977|gb|ACK49386.1| short-chain dehydrogenase/reductase SDR [Methylocella silvestris
           BL2]
          Length = 249

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/248 (46%), Positives = 170/248 (68%), Gaps = 3/248 (1%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           +  +L  R+ALVTG+SRGIG   ALELAR+GA++IA  R+   LE+L + ++    +  +
Sbjct: 1   MSASLQGRIALVTGASRGIGRAVALELARAGAHIIALARTQGALEELDDEIRAAGGQATL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D++D +AL+     I +RWGKLDIL+ NAG+LG ++P+  I+ K + DV +VNV AN
Sbjct: 61  TPCDIKDFDALDRLGGAIFQRWGKLDILVGNAGVLGPVTPLGHIEPKQWDDVFAVNVTAN 120

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAY--KCRPLWGAYSASKAAIEALARTWSKETVN- 188
           W ++RS DP L+ S  GRA+ +SSG A+  + RP WG Y+ASKAA+EALART++ ET N 
Sbjct: 121 WRLIRSLDPLLRASEAGRAVFISSGVAHTAETRPYWGPYAASKAALEALARTYAAETKNI 180

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQN 248
           T +RV+ ++PGP RT MRA AMP E+P T+  P+ +A  I+ +CA +   TGKL+  PQ+
Sbjct: 181 TPVRVMIVNPGPLRTKMRALAMPGENPLTLRTPEDLAPKIAEICAPEWTSTGKLYDFPQD 240

Query: 249 RFVNYLTP 256
             +++  P
Sbjct: 241 SVLSFSAP 248


>gi|182679268|ref|YP_001833414.1| short-chain dehydrogenase/reductase SDR [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635151|gb|ACB95925.1| short-chain dehydrogenase/reductase SDR [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 261

 Score =  234 bits (597), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 167/244 (68%), Gaps = 3/244 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L   +ALVTG+SRGIG+  AL+LAR+GA+VIA  R+   LE+L + ++    +  +   D
Sbjct: 17  LAGSIALVTGASRGIGHALALDLARAGAHVIALARTQGALEELDDEIRDAGSEATLVPCD 76

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L+D  AL+     I  RWGKLDI I NAG+LG +SP+  +  K + DV++VNV ANW ++
Sbjct: 77  LKDFEALDRLGHAIFSRWGKLDIFIGNAGLLGPVSPLAHVDPKQWEDVLAVNVTANWRLI 136

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKC--RPLWGAYSASKAAIEALARTWSKETVNTA-LR 192
           RS DP L+ S  GRA+ ++SG  ++   +P WG Y+ SKAA++ALART++ ETVN + +R
Sbjct: 137 RSLDPLLRASDAGRAVFITSGVGHRADFKPYWGPYATSKAALDALARTYAAETVNVSPVR 196

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVN 252
           V+ ++PGP RT+MRAKAMP EDP T+  P+ ++  +  LC+ +  ETGKL+  PQ+R ++
Sbjct: 197 VMLVNPGPLRTAMRAKAMPGEDPLTLRTPEDLSPKVLTLCSPEWTETGKLYDFPQDRILS 256

Query: 253 YLTP 256
           +  P
Sbjct: 257 FQGP 260


>gi|90419479|ref|ZP_01227389.1| short-chain dehydrogenase/reductase SDR [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336416|gb|EAS50157.1| short-chain dehydrogenase/reductase SDR [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 246

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 160/242 (66%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L +R+ALVTG+SRGIGY  A  LA  GA+VIA  R++  LE+L + ++ +     +   
Sbjct: 4   QLQDRVALVTGASRGIGYQIAKGLAAEGAHVIAVARTVGGLEELDDEIKALGGSATLVPL 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D   ++     I +RWGKLD+L+ANAG+LG ++PI  I+ K F   ++VNV A W +
Sbjct: 64  DLTDMGGIDRLGGAIHERWGKLDVLVANAGLLGVLAPIGHIEAKVFDKTMTVNVNATWRL 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R+ DP L+KS  GRAII+SSGAA+  +  W  Y+A+KAA EAL ++W+ ET N  LRV 
Sbjct: 124 IRTTDPLLRKSDAGRAIIMSSGAAHSAKAYWSLYAATKAACEALVKSWANETENLPLRVN 183

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
           +++PG TRT+MRA AMP ED  ++P P++VA  I  L       TGKLF V Q+RF++Y 
Sbjct: 184 SVNPGATRTAMRALAMPGEDAKSLPTPREVAAKIVPLAFADVTATGKLFDVRQDRFLDYR 243

Query: 255 TP 256
            P
Sbjct: 244 DP 245


>gi|319404035|emb|CBI77623.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 251

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 169/245 (68%), Gaps = 2/245 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L   +ALVTG+S+GIGY+ ALELA+ GA++IA  R+IS L+ L N ++K      + + 
Sbjct: 7   DLTGCVALVTGASKGIGYHLALELAKRGAHIIALARTISGLKTLNNEIKKKGGSATLVSL 66

Query: 75  DLRDSNALELTKTYIAK--RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL +  A++     I +  +W KLDIL+ANA ILG++SPI  I+   F D++ +N+ + W
Sbjct: 67  DLHNMEAIDELNVSIDECWKWKKLDILVANAAILGTLSPIAHIENAMFEDILQINLTSQW 126

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            +M++ +P L KS+ GRAI+LSS  A+  R  WG Y+ASKAA+E LAR W++E  +T+++
Sbjct: 127 RLMKAVEPLLLKSNAGRAILLSSSVAHCARASWGPYAASKAALELLARCWAEELKHTSIK 186

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVN 252
           V  ++PG TRT+MRA+A+P EDP T+P PQ+VA  I +L +    ETGKLF V + RF+N
Sbjct: 187 VNCVNPGATRTTMRAQALPDEDPQTLPSPQEVAAEIVYLSSPHLKETGKLFDVRKKRFMN 246

Query: 253 YLTPN 257
           Y  P+
Sbjct: 247 YHIPD 251


>gi|328544033|ref|YP_004304142.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [polymorphum gilvum SL003B-26A1]
 gi|326413777|gb|ADZ70840.1| Oxidoreductase, short-chain dehydrogenase/reductase family
           [Polymorphum gilvum SL003B-26A1]
          Length = 249

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 160/240 (66%), Gaps = 1/240 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI-DIFAF 74
            +NR+A+VTG+SRGIGY+ A  L  +GA+V+A  R++  LE+L + ++        +   
Sbjct: 6   FENRIAVVTGASRGIGYFVARALGAAGAHVVALARTVGGLEELDDEIRAAGGPAPTLVPL 65

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D + ++     + +R+G+LD+LI NAGILG++SP+  +  K++  V+++NV ANW +
Sbjct: 66  DLTDYDGIDRLGAALYERFGRLDVLIGNAGILGTLSPLGHVDIKTWDQVMAINVTANWRL 125

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +RS DP L++S  GRA+ LSSGAA KC+  WG YS SKAA+EAL RT++ ET+ T ++  
Sbjct: 126 IRSLDPLLRRSDAGRAVFLSSGAAQKCKAYWGPYSVSKAAVEALVRTYAAETLQTPIKAN 185

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
            ++PGP RT+MRAKAMP EDP T+PHP ++A  I  L A     TGKL+  P      +L
Sbjct: 186 LVNPGPMRTAMRAKAMPGEDPETLPHPSEIASAILDLSAPACTVTGKLYDHPSREIREFL 245


>gi|170750290|ref|YP_001756550.1| short-chain dehydrogenase/reductase SDR [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656812|gb|ACB25867.1| short-chain dehydrogenase/reductase SDR [Methylobacterium
           radiotolerans JCM 2831]
          Length = 249

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 118/248 (47%), Positives = 160/248 (64%)

Query: 10  SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI 69
           +E    L+ R+A+VTG+SRGIG   AL LA +GA+VIA  R++  LE+L +A++      
Sbjct: 2   AESQRTLEGRVAVVTGASRGIGRAAALALAGAGAHVIAVARTVGALEELDDAIRAAGSSA 61

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            +  FDL D +A++     I +RW +LDIL+ANAGILG++ PI  I  K +  V+ VNV 
Sbjct: 62  TLVPFDLADYDAIDRLGAAINERWKRLDILVANAGILGALMPIGHITPKIWGQVMDVNVT 121

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           ANW ++RS DP L+ S  GRAI +SSGAA KCRP WG YS SKAA+EAL RT++ E   T
Sbjct: 122 ANWRLIRSLDPLLRMSDAGRAIFVSSGAASKCRPYWGPYSVSKAALEALVRTYAAENETT 181

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNR 249
           A+R + ++PGP RT MR  AMP EDP T+  P+ +A     L A    ETGKL+  P +R
Sbjct: 182 AIRAMLLNPGPLRTGMRRSAMPGEDPETLRTPEDLAPHFVRLAAPDWAETGKLYDFPTDR 241

Query: 250 FVNYLTPN 257
            + +  P 
Sbjct: 242 VLRFRAPE 249


>gi|254502871|ref|ZP_05115022.1| KR domain superfamily [Labrenzia alexandrii DFL-11]
 gi|222438942|gb|EEE45621.1| KR domain superfamily [Labrenzia alexandrii DFL-11]
          Length = 242

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 152/239 (63%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           + + R+ALVTG+SRGIGY  A +LA  GA+VIA  R++  LE L + +Q    +  +   
Sbjct: 4   DFEGRVALVTGASRGIGYQLAKQLAARGAHVIAIARTVGGLEDLDDEIQSAGGQATLVPV 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D +AL+     I +RW KLD+ I NAG+LG +SP+  I  K F  V+SVNV ANW +
Sbjct: 64  DLTDHDALDRLGAAIYERWKKLDVFIGNAGMLGILSPLGHISPKDFEKVMSVNVTANWRL 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +RS DP L++S  GRA+ L+S  A  C   WG  S SKA +EA+ARTW+ E++ T++++ 
Sbjct: 124 IRSLDPLLRQSDAGRALFLTSVQASTCPAFWGLQSISKAGVEAMARTWASESLKTSMKIN 183

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
             DPGP RT +RAKAMP E P  +PHP+ +A  +  L  T   ETGKL+      +V++
Sbjct: 184 LADPGPVRTGLRAKAMPGEPPENLPHPRDIAPELVELVKTDVYETGKLYDRVSREWVSF 242


>gi|114704688|ref|ZP_01437596.1| probable oxidoreductase [Fulvimarina pelagi HTCC2506]
 gi|114539473|gb|EAU42593.1| probable oxidoreductase [Fulvimarina pelagi HTCC2506]
          Length = 246

 Score =  224 bits (571), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 157/242 (64%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD R+ALVTG+SRGIG   A  LA  GA+V    R++  LE+L + ++  +    +   D
Sbjct: 5   LDGRIALVTGASRGIGCELAELLAGEGAHVYCVARTVGGLEELDDRIKAASGSATLVPLD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D   ++     I +R GKLD+ +ANAG+LG +SPI  I+ K+F   ++ NV + W  +
Sbjct: 65  LLDFEGIDRLGAAIYERHGKLDVFVANAGMLGVLSPIGHIEAKTFEKTMATNVTSVWRQI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RSFDP L++S  GRAI++SSGAA+  +  W  Y+A+KA++EALA++W+ ET  TALRV +
Sbjct: 125 RSFDPLLRRSDAGRAILMSSGAAHSAKAYWSLYAATKASVEALAKSWANETQKTALRVNS 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
           ++PG TRT MRA+AMP EDP T+P  ++VA  I  L      ETG LF V + RF+ Y  
Sbjct: 185 VNPGATRTKMRAQAMPGEDPETLPSAREVAAKIVPLALPDLAETGHLFDVRKGRFLTYHN 244

Query: 256 PN 257
           P+
Sbjct: 245 PD 246


>gi|118588132|ref|ZP_01545542.1| NAD/NADP dependent oxidoreductase [Stappia aggregata IAM 12614]
 gi|118439754|gb|EAV46385.1| NAD/NADP dependent oxidoreductase [Stappia aggregata IAM 12614]
          Length = 242

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/229 (46%), Positives = 148/229 (64%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           + + R+ALVTG+SRGIGY  A +L   GA+VIA  R++  LE L + ++    +  +   
Sbjct: 4   DFEGRIALVTGASRGIGYQIAKQLGERGAHVIALARTVGGLEDLDDEVRSAGGETTLVPL 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D +AL+     I +RW KLDI +ANAG+LG +SPI  I  K F  V +VNV+ANW +
Sbjct: 64  DLTDFDALDRLGAAIYERWKKLDIFVANAGMLGVLSPIGHISPKDFEKVTAVNVVANWRL 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +RS DP L++S  GRA+ LSS  A  C P WG  S SKA++EA+ARTW+KE++ T +++ 
Sbjct: 124 IRSLDPLLRQSDAGRALFLSSVHASTCTPFWGLQSISKASVEAMARTWAKESLQTKMKIN 183

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLF 243
             DPGPTRT +RAKAMP E    +P P +VA  +  L     +ETG L+
Sbjct: 184 IADPGPTRTGLRAKAMPGELATNLPAPDEVAADLLPLLMPDVLETGSLY 232


>gi|163853330|ref|YP_001641373.1| short-chain dehydrogenase/reductase SDR [Methylobacterium
           extorquens PA1]
 gi|163664935|gb|ABY32302.1| short-chain dehydrogenase/reductase SDR [Methylobacterium
           extorquens PA1]
          Length = 247

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 161/242 (66%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD R+A+VTG+SRGIG   AL LA +GA+V+A  R+   LE+L +A++       +   D
Sbjct: 6   LDGRVAVVTGASRGIGRAAALALASAGAHVVAVARTQGGLEELDDAIRSAGGHATLVPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D +A++     + +RWG+LDI++ NAGILG++ P+  +  K +  V+++NV ANW ++
Sbjct: 66  LTDYDAIDRLGAALNERWGRLDIVVGNAGILGNLMPVSHVTPKVWDQVMAINVTANWRLI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RSFDP L++S  GRAI +SSGAA KCR  WG YS SKAA+EA+ RT++ E  +T +R + 
Sbjct: 126 RSFDPLLRRSDAGRAIFVSSGAAAKCRAYWGPYSVSKAALEAMVRTYAAENESTGVRAML 185

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
           ++PGP RTSMRA AMP EDP T+  P+++A     L +    ETGKL+  P +R + +  
Sbjct: 186 LNPGPLRTSMRAAAMPGEDPATLKTPEELAPHFVRLASPAWNETGKLYDFPSDRVLAFSA 245

Query: 256 PN 257
           P 
Sbjct: 246 PQ 247


>gi|240140746|ref|YP_002965226.1| Short-chain dehydrogenase/reductase SDR [Methylobacterium
           extorquens AM1]
 gi|240010723|gb|ACS41949.1| Short-chain dehydrogenase/reductase SDR [Methylobacterium
           extorquens AM1]
          Length = 252

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 160/242 (66%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD R+A+VTG+SRGIG   AL LA +GA+V+A  R+   LE+L +A++       +   D
Sbjct: 11  LDGRVAVVTGASRGIGRAAALALASAGAHVVAVARTQGGLEELDDAIRSAGGHATLVPLD 70

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D +A++     + +RWG+LD ++ NAGILG++ P+  +  K +  V+++NV ANW ++
Sbjct: 71  LTDYDAIDRLGAALNERWGRLDAMVGNAGILGNLMPVSHVTPKVWDQVMAINVTANWRLI 130

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RSFDP L++S  GRAI +SSGAA KCR  WG YS SKAA+EA+ RT++ E  +T +R + 
Sbjct: 131 RSFDPLLQRSDAGRAIFVSSGAAAKCRAYWGPYSVSKAALEAMVRTYAAENESTGVRAML 190

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
           ++PGP RTSMRA AMP EDP T+  P+++A     L +    ETGKL+  P +R + +  
Sbjct: 191 LNPGPLRTSMRAAAMPGEDPATLKTPEELAPHFVRLASPAWNETGKLYDFPSDRVLAFSA 250

Query: 256 PN 257
           P 
Sbjct: 251 PQ 252


>gi|254563256|ref|YP_003070351.1| short-chain dehydrogenase/reductase SDR [Methylobacterium
           extorquens DM4]
 gi|254270534|emb|CAX26537.1| Short-chain dehydrogenase/reductase SDR [Methylobacterium
           extorquens DM4]
          Length = 247

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 161/242 (66%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD R+A+VTG+SRGIG   AL LA +GA+V+A  R+   LE+L +A++       +   D
Sbjct: 6   LDGRVAVVTGASRGIGRAAALALASAGAHVVAVARTQGGLEELDDAIRSAGGHATLVPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D +A++     + +RWG+LDI++ NAGILG++ P+  +  K +  V+++NV ANW ++
Sbjct: 66  LTDYDAIDRLGAALNERWGRLDIVVGNAGILGNLMPVSHVTPKVWDQVMAINVTANWRLI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RSFDP L++S  GRAI +SSGAA KCR  WG YS SKAA+EA+ RT++ E  +T +R + 
Sbjct: 126 RSFDPLLQRSDGGRAIFVSSGAAAKCRAYWGPYSVSKAALEAMVRTYAAENESTRVRAML 185

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
           ++PGP RTSMRA AMP EDP T+  P+++A     L +    ETGKL+  P +R + +  
Sbjct: 186 LNPGPLRTSMRAAAMPGEDPATLKTPEELAPHFVRLASPAWNETGKLYDFPSDRVLAFSA 245

Query: 256 PN 257
           P 
Sbjct: 246 PQ 247


>gi|188583596|ref|YP_001927041.1| short-chain dehydrogenase/reductase SDR [Methylobacterium populi
           BJ001]
 gi|179347094|gb|ACB82506.1| short-chain dehydrogenase/reductase SDR [Methylobacterium populi
           BJ001]
          Length = 247

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 158/242 (65%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD R+A+VTG+SRGIG   AL LA +GA+V+A  R+   LE+L +A+Q+      +   D
Sbjct: 6   LDGRVAVVTGASRGIGRAAALALAGAGAHVVAVARTQGGLEELDDAIQRAGGSATLVPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D +A++     + +RWG+LD ++ NAGILG++ P+  +  K +  V+++NV ANW ++
Sbjct: 66  LTDYDAIDRLGAALNERWGRLDAVVGNAGILGNLMPVSHVTPKVWDQVMAINVTANWRLI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RSFDP L++S  GRAI +SSGAA KCR  WG YS SKAA+EA+ RT++ E   T +R + 
Sbjct: 126 RSFDPLLQRSDAGRAIFVSSGAAAKCRAYWGPYSVSKAALEAMVRTYAAENERTGVRAML 185

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
           ++PGP RT MRA AMP EDP T+  P+ +A     L +    ETGKL+  P +R + +  
Sbjct: 186 LNPGPLRTRMRAAAMPGEDPATLRTPEDLAPHFVRLASPDWNETGKLYDFPSDRVLAFSA 245

Query: 256 PN 257
           P 
Sbjct: 246 PQ 247


>gi|27379170|ref|NP_770699.1| NAD/NADP dependent oxidoreductase [Bradyrhizobium japonicum USDA
           110]
 gi|27352320|dbj|BAC49324.1| NAD/NADP dependent oxidoreductase [Bradyrhizobium japonicum USDA
           110]
          Length = 246

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 156/241 (64%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +R+ALVTG+SRGIG+ TA  LA++GA+++A  R+   LE+L + ++K      +   +
Sbjct: 5   LADRIALVTGASRGIGFATAKALAKAGAHIVAVARTQGGLEELDDEIRKEGGSATLVPLN 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L DS+ +      + +R+GKLDIL+ NAG+LG  SPI  I+ K+F DV++VNV AN+ ++
Sbjct: 65  LTDSDGIARLGAGLHERYGKLDILVGNAGVLGPSSPIGHIELKAFNDVMAVNVSANFQLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R  +P LK+S  GRA+ ++SGAA K       Y+ASKAA+E LAR W++ET NT LRV  
Sbjct: 125 RCMEPLLKQSDAGRAVFITSGAANKATAYVSPYAASKAALETLARAWAQETANTPLRVNL 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
            +PGP RT MRA  MP EDP T+   ++VA+ I  +CA    ETGK +       +++  
Sbjct: 185 FNPGPVRTRMRATLMPGEDPATLDTAEQVAEFIVPMCAPDWTETGKFYDYKTRTLMSFRP 244

Query: 256 P 256
           P
Sbjct: 245 P 245


>gi|218532187|ref|YP_002423003.1| short-chain dehydrogenase/reductase SDR [Methylobacterium
           chloromethanicum CM4]
 gi|218524490|gb|ACK85075.1| short-chain dehydrogenase/reductase SDR [Methylobacterium
           chloromethanicum CM4]
          Length = 247

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 108/242 (44%), Positives = 159/242 (65%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD R+A+VTG+SRGIG   AL LA +GA+V+A  R+   LE+L +A++       +   D
Sbjct: 6   LDGRVAVVTGASRGIGRAAALALAEAGAHVVAVARTQGGLEELDDAIRSAGGHATLVPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D +A++     + +RWG+LD ++ NAGILG++ P+  +  K +  V+++NV ANW ++
Sbjct: 66  LTDYDAIDRLGAALNERWGRLDAVVGNAGILGNLMPVSHVTPKVWDQVMAINVTANWRLI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RSFDP L++S  GRAI +SSGAA KCR  WG YS SKAA+EA+ RT++ E  +T +R + 
Sbjct: 126 RSFDPLLQRSDAGRAIFVSSGAAAKCRAYWGPYSVSKAALEAMVRTYAAENESTGVRAML 185

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
           ++PGP RT MRA AMP EDP T+  P+++A     L +    ETGKL+  P +R + +  
Sbjct: 186 LNPGPLRTGMRAAAMPGEDPATLKTPEELAPHFVRLASPAWNETGKLYDFPSDRVLAFSA 245

Query: 256 PN 257
           P 
Sbjct: 246 PQ 247


>gi|154253920|ref|YP_001414744.1| short-chain dehydrogenase/reductase SDR [Parvibaculum
           lavamentivorans DS-1]
 gi|154157870|gb|ABS65087.1| short-chain dehydrogenase/reductase SDR [Parvibaculum
           lavamentivorans DS-1]
          Length = 239

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 145/206 (70%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +RLA++TG+SRGIG   AL +A  GA+VI   R++  LE++ N ++K+  K  +   D
Sbjct: 5   LQDRLAVITGASRGIGRAVALGMAAEGAHVILVARTVGGLEEVDNEIRKVGGKATLVPLD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D   ++     I +RWGKLDIL+ NAG+LG+++P+  ++ K +   ++VNV AN+ ++
Sbjct: 65  LTDMPGIDRLGATIFERWGKLDILVGNAGLLGTLTPMAHLEPKDWDKTLAVNVTANYRLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RS +P LK+S  GRAI ++SGAA KC+P WG+YS +KAA++A+ +TW+ E   +A+RV +
Sbjct: 125 RSLEPLLKRSDAGRAIFVTSGAAQKCKPYWGSYSVTKAALDAMMKTWAAEVETSAIRVNS 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHP 221
           + PGPTRT+MR KAMP EDP T+  P
Sbjct: 185 VSPGPTRTAMRKKAMPGEDPTTLTKP 210


>gi|158422160|ref|YP_001523452.1| NAD/NADP dependent oxidoreductase [Azorhizobium caulinodans ORS
           571]
 gi|158329049|dbj|BAF86534.1| NAD/NADP dependent oxidoreductase [Azorhizobium caulinodans ORS
           571]
          Length = 247

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 154/239 (64%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +++A+VTG++RGIG   A  L   GA+V+A GR+   LE+L +A+        +   D+ 
Sbjct: 8   DKIAVVTGATRGIGAAVARALGAGGAHVVALGRTQGALEELDDAITAAGGTATLVPMDVT 67

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D +A++     + +R+G+LD+ + NAG LG ++P+  ++ K +   +++N+ AN+  +RS
Sbjct: 68  DYDAIDRLGGALYERYGRLDVFVGNAGFLGPLTPMRDVELKDWDKAVNINLTANYRFIRS 127

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
            DP L+ +  GRA+ +SSGAA+K R  WG Y+ +KA +EA+ RTW+ ETV TAL+V   +
Sbjct: 128 LDPLLRMAPAGRAVFISSGAAHKGRAYWGPYAITKAGVEAMGRTWAAETVTTALKVNLFN 187

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTP 256
           PGP RT MRAKA P EDP T+P P++ A+ I  +C T   ETG+L+  P   + ++ +P
Sbjct: 188 PGPIRTLMRAKAFPGEDPMTLPTPEEAAEAIVAMCRTDVAETGRLYDFPTRSWQDFRSP 246


>gi|296446419|ref|ZP_06888363.1| short-chain dehydrogenase/reductase SDR [Methylosinus trichosporium
           OB3b]
 gi|296256054|gb|EFH03137.1| short-chain dehydrogenase/reductase SDR [Methylosinus trichosporium
           OB3b]
          Length = 244

 Score =  211 bits (537), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 156/239 (65%), Gaps = 1/239 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R+ALVTG+SRGIG   AL+LAR GA+V+A  R+   LE L + +     +  I   D
Sbjct: 4   LVGRVALVTGASRGIGRAVALQLAREGAHVVALARAQGPLEFLYDEITGFGGEATIVPLD 63

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + + + L+     I +RW KLDIL+ NAG+LG ++P+  ++ + +A ++ VNV ANW ++
Sbjct: 64  VAEFDNLDRLGACIHERWKKLDILVGNAGLLGPLTPLPHVEPQQWARIMDVNVTANWRLV 123

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRVI 194
           R+ D  L+ S  GR + ++SGAA++ +  WG Y+ SKAA+ ALART++ ETVNT+ ++V+
Sbjct: 124 RAMDMLLRASDAGRCVFVTSGAAWRIKAYWGPYAVSKAAVNALARTYAAETVNTSNVKVM 183

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
             +PGP RT MRA AMP EDP T+  P++ A  ++ LC     ETGKL+  P +R + +
Sbjct: 184 LANPGPLRTDMRAAAMPGEDPQTLRTPEEFAPRLAALCRPDWAETGKLYDFPTDRLIEF 242


>gi|154246340|ref|YP_001417298.1| short-chain dehydrogenase/reductase SDR [Xanthobacter autotrophicus
           Py2]
 gi|154160425|gb|ABS67641.1| short-chain dehydrogenase/reductase SDR [Xanthobacter autotrophicus
           Py2]
          Length = 248

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 162/241 (67%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +++ALVTG++RGIG  TA+ LAR+GA+V+  GRS   L+ + + ++ +     +   D
Sbjct: 7   LADKIALVTGATRGIGAATAIALARAGAHVVCVGRSDGGLQDIDDNIRAVGGTATLVPLD 66

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L+DS A++     + +R+ +LD+ +ANAG+LG +SP+  +  K + D+++VN+ ANW  +
Sbjct: 67  LKDSEAIDRLGGVLFERYRRLDVFVANAGVLGPLSPLGHVYPKDWDDIVAVNLTANWRCV 126

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RSFDP LK S  GR +++SSGAA+K R  WG Y+ +KA +E +ARTW+ E+V+  L+V  
Sbjct: 127 RSFDPLLKLSPAGRVVMISSGAAHKARAYWGPYALTKAGLEVMARTWAAESVSGNLKVNL 186

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
            +PGP RT MRAKA P EDP T+P P++ A  I  LC    +ETGKL+  PQ + +++  
Sbjct: 187 FNPGPIRTLMRAKAFPGEDPMTLPAPEEAAAAILPLCLPTFMETGKLYDFPQGKLLSFQM 246

Query: 256 P 256
           P
Sbjct: 247 P 247


>gi|220924496|ref|YP_002499798.1| short-chain dehydrogenase/reductase SDR [Methylobacterium nodulans
           ORS 2060]
 gi|219949103|gb|ACL59495.1| short-chain dehydrogenase/reductase SDR [Methylobacterium nodulans
           ORS 2060]
          Length = 254

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 156/240 (65%)

Query: 9   NSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK 68
           N +    L +R+A+VTG+SRGIG   AL LA +GA+VIA  R+   LE+L +A+++    
Sbjct: 6   NPQTSKPLADRIAVVTGASRGIGRAAALALAEAGAHVIAVARTQGALEELDDAIRQTGGS 65

Query: 69  IDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
             +   DL D +A++     I +RWG+LDIL+ NAG+LG + P+  ++ K +A V+ VN+
Sbjct: 66  ATLVPLDLTDYDAIDRLGAAIHERWGRLDILVGNAGVLGRLMPLGHVEPKLWASVMDVNL 125

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            ANW ++RS DP L++S  GRAI ++SGAA+ C+  WG Y+ SKAA+EAL RT++ ET  
Sbjct: 126 TANWRLIRSLDPLLRRSEAGRAIFITSGAAWSCKAYWGPYAVSKAALEALVRTYAAETAT 185

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQN 248
           T +R + ++PGP RT+MR  AMP EDP T+  P+ +A  I  L      E+G ++  P +
Sbjct: 186 TPIRAMLVNPGPLRTAMRRAAMPGEDPETLRTPEDLAPHIVRLANPAWTESGLIYDFPTD 245


>gi|316933678|ref|YP_004108660.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           DX-1]
 gi|315601392|gb|ADU43927.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           DX-1]
          Length = 247

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/241 (44%), Positives = 148/241 (61%), Gaps = 2/241 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ALVTG+SRGIGY TA  LA++GA+VIA  R+   LE+L + ++K     + +   
Sbjct: 5   LASRIALVTGASRGIGYATAKALAKAGAHVIAVARTQGGLEELDDEVRKDGGHPLTLVPL 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D  A+      I +R GKLD+L+ NAGI G  SP+  I  K + DVI +N+  N+ +
Sbjct: 65  DLTDYQAIGRLGGTIYERHGKLDVLVGNAGIAGPSSPLGHIDLKPWLDVIGINLNVNFQL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R  +P L+ S  GRA+ L+S A  K     G Y+ASKAA+E L + W+KET NT    I
Sbjct: 125 VRCMEPLLRASDAGRAVFLTSRAGGKAPAYRGPYAASKAALETLVQVWAKETANTTPIRI 184

Query: 195 NI-DPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
           N+ DPGPTRT +RA  MP EDP T+P P + A+++  LC     ETGKLF  P     + 
Sbjct: 185 NLFDPGPTRTKLRANVMPGEDPETLPTPDQAAELLLPLCLPSFTETGKLFDGPSRSLKDP 244

Query: 254 L 254
           L
Sbjct: 245 L 245


>gi|39936155|ref|NP_948431.1| putative oxidoreductase [Rhodopseudomonas palustris CGA009]
 gi|192291873|ref|YP_001992478.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           TIE-1]
 gi|39650010|emb|CAE28533.1| putative oxidoreductase [Rhodopseudomonas palustris CGA009]
 gi|192285622|gb|ACF02003.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           TIE-1]
          Length = 247

 Score =  202 bits (513), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 107/233 (45%), Positives = 147/233 (63%), Gaps = 2/233 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ALVTG+SRGIGY TA  LA++GA+VIA  R+   LE+L + ++K     + +   
Sbjct: 5   LASRIALVTGASRGIGYATAKALAKAGAHVIAVARTQGGLEELDDEVRKDGGHPLTLVPL 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D  A+      I +R GKLD+L+ NAGI G  SP+  I+ K + DVI +N+  N+ +
Sbjct: 65  DLTDYQAIGRLGGTIYERHGKLDVLVGNAGIGGPSSPLGHIELKPWLDVIGINLNVNFQL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R  +P L+ S  GRA+ L+S A  K     G Y+ASKAA+E L + W+KE VNT    I
Sbjct: 125 VRCMEPLLRASDAGRAVFLTSRAGGKAPGYRGPYAASKAALETLVQVWAKEVVNTTPIRI 184

Query: 195 NI-DPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
           N+ DPGPTRT +RA  MP EDP T+P P + A+++  LC     ETGKLF  P
Sbjct: 185 NLFDPGPTRTKLRASVMPGEDPETLPTPDQAAELLLPLCLPSFTETGKLFDGP 237


>gi|323137729|ref|ZP_08072805.1| short-chain dehydrogenase/reductase SDR [Methylocystis sp. ATCC
           49242]
 gi|322397026|gb|EFX99551.1| short-chain dehydrogenase/reductase SDR [Methylocystis sp. ATCC
           49242]
          Length = 246

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 154/241 (63%), Gaps = 2/241 (0%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R+ALVTG+SRG+G   ALELA +GA+V+A  R+   LE+L + ++ +  +  +   DL D
Sbjct: 6   RIALVTGASRGVGRALALELAGAGAHVVALARTQGALEELDDEIRALGGEATLVPCDLAD 65

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
            +AL+     + +RWGKLD+ + NAG+LG +SP+  +  K +  V++VNV ANW ++RS 
Sbjct: 66  FDALDRLGRALFERWGKLDVFVGNAGVLGPLSPLAHVDVKDWTRVMAVNVTANWRLIRSL 125

Query: 139 DPWLKKSHCGRAIILSSGAAYKC--RPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
           D  L+ S  GR   ++S AA++   +P WG Y+ SKAA+EA+ART++ E     + V+  
Sbjct: 126 DLLLRASGNGRVAFITSAAAHRAAMKPFWGPYAISKAALEAMARTYAVEAAGDGVTVMLA 185

Query: 197 DPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTP 256
           +PGP RT MRA+AMP EDP T+  P++ A+    L   +  E+ +L+  P +R +++  P
Sbjct: 186 NPGPLRTRMRAQAMPGEDPMTLKTPEEFARKCLALLTPEWRESARLYDFPTDRLLDFQAP 245

Query: 257 N 257
           +
Sbjct: 246 S 246


>gi|86749571|ref|YP_486067.1| Short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           HaA2]
 gi|86572599|gb|ABD07156.1| Short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           HaA2]
          Length = 247

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 105/230 (45%), Positives = 149/230 (64%), Gaps = 2/230 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAF 74
           L +R+ALVTG+SRGIGY TA  LAR+GA+VIA  ++   LE+L +A++ +      +   
Sbjct: 5   LASRIALVTGASRGIGYATARALARAGAHVIAVAKTQGGLEELDDAIRAEGGHAATLVPL 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D +A+      I +R GKLD+L+ NAGI G  SP+  I+ KS+  VI +N+ AN+ +
Sbjct: 65  DLTDFDAIGRLGASIHERHGKLDVLVGNAGIAGPSSPLGHIEMKSWTGVIGINLTANFQL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R  +P L+ S  GRA+ L+S A  +     G Y+ASKAA+E L + W+KE VNT    I
Sbjct: 125 IRCMEPLLRMSDAGRAVFLTSRAGGRAPAYRGPYAASKAALETLVQVWAKEVVNTTPIRI 184

Query: 195 NI-DPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLF 243
           N+ DPGPTRT +R   MP EDP T+P P+++A+++  LC     ETGKLF
Sbjct: 185 NLFDPGPTRTKLRGTIMPGEDPETLPSPEQIAELLVPLCLPSWSETGKLF 234


>gi|16125902|ref|NP_420466.1| short chain dehydrogenase/reductase family oxidoreductase
           [Caulobacter crescentus CB15]
 gi|221234665|ref|YP_002517101.1| short chain dehydrogenase [Caulobacter crescentus NA1000]
 gi|13423062|gb|AAK23634.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Caulobacter crescentus CB15]
 gi|220963837|gb|ACL95193.1| short chain dehydrogenase [Caulobacter crescentus NA1000]
          Length = 251

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 144/223 (64%), Gaps = 3/223 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNA-LQKINKKIDIFAF 74
           L  R+ALVTG++RGIG   AL LA++GA+VIA GR+   LE L +A LQ   ++  +   
Sbjct: 9   LAGRIALVTGATRGIGEAVALGLAKAGAHVIAVGRTQGALEALDDAILQATGERATLVPL 68

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DLR+++ L+     I KRWGKLDIL+  AG+LG ++P+  ++ K +  ++S N+ ANW +
Sbjct: 69  DLREADGLDHLGAAIHKRWGKLDILVGAAGVLGPLTPVSHLEPKGWDMILSTNLTANWRL 128

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRP-LWGAYSASKAAIEALARTWSKETVNTALRV 193
           +RS DP L+ S  GRA+  SS  A K RP  WGAY+A+KAA+EAL   ++ E  NT +R 
Sbjct: 129 IRSMDPLLRASDAGRAVFFSSSVA-KSRPAFWGAYAATKAALEALVDVYADEMENTTVRA 187

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQK 236
             +DPG  RT MR+ A P E+P TVP P+ +A  +  L  T +
Sbjct: 188 FCVDPGAMRTKMRSAAFPGENPATVPAPETIAPFMVDLLRTDR 230


>gi|92117235|ref|YP_576964.1| short-chain dehydrogenase/reductase SDR [Nitrobacter hamburgensis
           X14]
 gi|91800129|gb|ABE62504.1| short-chain dehydrogenase/reductase SDR [Nitrobacter hamburgensis
           X14]
          Length = 247

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 152/242 (62%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +R+ALV+G+SRGIGY TA  LA++GA+VIA  R+   LE+L + ++K      +   +
Sbjct: 5   LASRIALVSGASRGIGYATARALAKAGAHVIAVARTQGGLEELDDDIRKDGGSATLVPLN 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D + +      + +R GKLDIL+ NAGI G  SP+  I+ K + DV+++NV AN+ ++
Sbjct: 65  LTDFDGIARLGAALNERHGKLDILVGNAGIAGPSSPLGHIELKPWQDVMAINVTANFQLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R  +P L++S  GRA+ ++SGAA K     G Y+ASKAA++ L R W+ ET +T LRV  
Sbjct: 125 RCMEPLLRQSDAGRAVFVTSGAASKANAYRGPYAASKAALDTLVRCWANETASTPLRVNL 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
            DPGP RT MRA   P EDP  +  P++VA+ I  +C     ETGKL+     + +++  
Sbjct: 185 FDPGPIRTRMRAAVFPGEDPMRLDTPEQVAEFIVPMCLPSWNETGKLYDYNSRKVMSFHP 244

Query: 256 PN 257
           P+
Sbjct: 245 PS 246


>gi|114800463|ref|YP_759444.1| short chain dehydrogenase/reductase family oxidoreductase
           [Hyphomonas neptunium ATCC 15444]
 gi|114740637|gb|ABI78762.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Hyphomonas neptunium ATCC 15444]
          Length = 238

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 140/222 (63%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           RL LVTG+SRGIG   +LELAR G  V+A  RS + LEKL + ++K+  +  +   DL+D
Sbjct: 6   RLVLVTGASRGIGRAISLELARQGNIVVAIARSKAALEKLDDEIRKLGSEAVLVPMDLKD 65

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           +  +E     IA+++GKLD  +ANAG+LG++ P+     +SF + I VN+ AN +++R+ 
Sbjct: 66  TKGIETLGKIIAEKFGKLDGFVANAGLLGTLGPLETCGPRSFEETIQVNLTANAHLIRAL 125

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P L +S   RA+ ++SG   + R  WG Y ASKA +EAL + W+ E+   ALRV   DP
Sbjct: 126 GPSLHRSESPRAVFITSGVVPRPRAFWGPYQASKAGLEALVKAWADESEKMALRVNLFDP 185

Query: 199 GPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG 240
           G  RT MRA+AMP EDP T+P P  VAK +  L   ++  TG
Sbjct: 186 GAVRTGMRAEAMPGEDPMTLPTPDDVAKELVKLLTPEETRTG 227


>gi|146340255|ref|YP_001205303.1| putative Short-chain dehydrogenase/reductase SDR [Bradyrhizobium
           sp. ORS278]
 gi|146193061|emb|CAL77072.1| Putative Short-chain dehydrogenase/reductase SDR [Bradyrhizobium
           sp. ORS278]
          Length = 247

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/242 (42%), Positives = 147/242 (60%), Gaps = 1/242 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK-INKKIDIFAF 74
           L NR+ALVTG+SRGIG+ TA  LAR+GA+V+A  R+   LE+L + ++K       +   
Sbjct: 5   LANRIALVTGASRGIGHATARALARAGAHVVAVARTQGGLEELDDEIRKETGHGATLVPL 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
            + DS+ +      + +R GKLDIL+ NA + G  SP+  I  K + DV++VN+ AN+ +
Sbjct: 65  SMTDSDGIARLGAALHERHGKLDILVGNAAVPGPSSPLGHIDLKPWNDVVTVNLSANFQL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R  +P LK S  GRA+ L+SGAA + +   G Y+ +KAA+E LAR W+ ET  TALRV 
Sbjct: 125 IRCMEPLLKASDAGRAVFLTSGAAQRAQAYLGPYAVTKAALETLARVWAHETERTALRVN 184

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
              PGP RT MRA   P EDP T+  P++VA+ I  LC     ETGKL+        ++ 
Sbjct: 185 LFSPGPIRTRMRATVFPGEDPMTLDTPEQVAEFIVPLCLPSWTETGKLYEYKTRTLKSFQ 244

Query: 255 TP 256
            P
Sbjct: 245 LP 246


>gi|307946722|ref|ZP_07662057.1| NAD/nadp dependent oxidoreductase [Roseibium sp. TrichSKD4]
 gi|307770386|gb|EFO29612.1| NAD/nadp dependent oxidoreductase [Roseibium sp. TrichSKD4]
          Length = 241

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 144/231 (62%), Gaps = 1/231 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFA 73
           + + R+ALVTG+SRGIG+  A +L   GA VIA  R++  LE+L +A+ K       +  
Sbjct: 4   DFEGRVALVTGASRGIGFELARQLGSRGAQVIALARTVGGLEELDDAITKAGGPSATLVP 63

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DL+D +AL+     I +RW KLDILI NA +  ++SP+  IK K+F + ++ NV AN+ 
Sbjct: 64  VDLKDFDALDRLGAAIFERWKKLDILIGNAAMAVTLSPVSHIKVKTFDEAMATNVTANYR 123

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++RS D  L++S  GRA+ L+ G  +   P WG  + +KAA+EA+ +T++ E   T LRV
Sbjct: 124 LLRSLDVLLRQSDAGRALFLTDGHLHTTTPFWGLQATTKAALEAMVKTYAAEAEKTPLRV 183

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFS 244
             +DPGP RT +RAK MP EDP T+P  + VA  +  L  T   ETG++F 
Sbjct: 184 NLVDPGPVRTGLRAKTMPGEDPETLPTAETVATDLVKLVGTDVAETGRMFD 234


>gi|115525342|ref|YP_782253.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           BisA53]
 gi|115519289|gb|ABJ07273.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           BisA53]
          Length = 246

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 149/241 (61%), Gaps = 1/241 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK-INKKIDIFAF 74
           L +R+ALVTG+SRGIG+ TAL LA++GA+++A  R+   LE+L + ++        +   
Sbjct: 5   LASRIALVTGASRGIGFATALALAKAGAHIVAVARTQGGLEELDDEIRNATGAAATLVPL 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D   +      + +R GKLD+++ANA I G  SP+  I  K + DV+++N+ AN+ +
Sbjct: 65  DLTDIEGIARLGAALHERHGKLDVMVANAAIAGPSSPLGHIAPKPWGDVLAINLTANFQL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R  +P L++S  GRA++L+S  A K     G  +ASKA +EALAR W+ E + T L+V 
Sbjct: 125 IRCMEPLLRESDAGRAVVLTSSDARKAPAYRGPSAASKAGLEALARVWAAENMTTRLKVN 184

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
             DPGP RT +RA  MP EDP T+P P +VA++I  LC  + IE GKL+        ++ 
Sbjct: 185 LFDPGPVRTKLRATIMPGEDPETLPTPAQVAELIVPLCTPECIEVGKLYDYASGTLRDFA 244

Query: 255 T 255
           T
Sbjct: 245 T 245


>gi|209885505|ref|YP_002289362.1| short-chain dehydrogenase/reductase SDR [Oligotropha
           carboxidovorans OM5]
 gi|209873701|gb|ACI93497.1| short-chain dehydrogenase/reductase SDR [Oligotropha
           carboxidovorans OM5]
          Length = 247

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/241 (42%), Positives = 144/241 (59%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +R+ALVTG+SRGIG+ TA  LAR+GA+VIA  R+   LE+L + ++       +   D
Sbjct: 6   LASRIALVTGASRGIGHATARALARAGAHVIAVARTQGGLEELDDEIRSEGGSTTLVPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D + L      + +R GKLDILI NAG+ G  SP+  I  K + DVI +N+ AN+ ++
Sbjct: 66  LTDYDGLARLGAALNERHGKLDILIGNAGVAGPSSPLGHIDLKPWMDVIDINLTANFQLI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R  +P L  S  GRA+ ++SG A K     G Y+ SKA +EALAR W+ ET  + +RV  
Sbjct: 126 RCMEPLLIHSDAGRAVFITSGTASKASAYRGPYAVSKAGLEALARVWAHETATSTIRVNL 185

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
            +PGP RT MRA  MP EDP T+  P++ A+ I  LC     ETGK++       +N+  
Sbjct: 186 FNPGPIRTRMRATVMPGEDPMTLDTPEQAAEHILPLCMPDWTETGKVYDYRTRSLMNFRP 245

Query: 256 P 256
           P
Sbjct: 246 P 246


>gi|75676209|ref|YP_318630.1| short-chain dehydrogenase/reductase SDR [Nitrobacter winogradskyi
           Nb-255]
 gi|74421079|gb|ABA05278.1| short-chain dehydrogenase/reductase SDR [Nitrobacter winogradskyi
           Nb-255]
          Length = 250

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 148/237 (62%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +R+ALVTG+SRGIGY TA  LA++GA+VIA  R+   LE+L + ++       +   +
Sbjct: 5   LTSRVALVTGASRGIGYATARALAKAGAHVIAVARTQGGLEELDDDIRDGGGSATLVPLN 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D + +      + +R GKLDIL+ NAGI G  SP+  I+ K + DV+++NV AN+ ++
Sbjct: 65  LSDFDGIARLGAALNERHGKLDILVGNAGIAGPSSPLGHIEMKPWQDVMAINVTANFQLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R  +P L++S  GRA+ ++SGAA K     G Y+ASKAA++ L R W+ ET  T +RV  
Sbjct: 125 RCMEPLLRQSDAGRAVFVTSGAAGKANAYRGPYAASKAALDTLVRCWASETATTGMRVNL 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVN 252
            DPGP RT +RA   P EDP T+  P+++A++I  +C     ETGKL+     R  +
Sbjct: 185 FDPGPVRTRLRAIVFPGEDPMTLDTPEQIAELIIPMCLPSWSETGKLYDYKSRRLTD 241


>gi|300023242|ref|YP_003755853.1| short-chain dehydrogenase/reductase SDR [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525063|gb|ADJ23532.1| short-chain dehydrogenase/reductase SDR [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 261

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 142/227 (62%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R+ALVTG+SRGIG   AL LA++GA+V+   RS+  LE L + ++       +   D
Sbjct: 10  LKGRIALVTGASRGIGRAVALGLAKAGAHVVITARSLGALESLDDDIRAAGGAATLLQLD 69

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L   + ++     I +RW  LDI +ANAGILG +SP+    E+ F   I +N+ ANW ++
Sbjct: 70  LSKGDRVDQLGPTIYQRWQHLDIFVANAGILGPLSPLGHTTEEGFLATIDINLNANWRLI 129

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R+ DP +K+S  GRAI ++SGAA      WG Y+ASKA +EALA++W+ E VNT +RV  
Sbjct: 130 RTLDPLMKRSDAGRAIFVTSGAASGKYAYWGPYAASKAGLEALAKSWAAELVNTNVRVNL 189

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKL 242
           I+PG TRT+MRA+A P EDP ++P P+++  +   L +      G L
Sbjct: 190 INPGATRTNMRARAFPGEDPASLPAPEEIVPLFLELASPHCTLNGDL 236


>gi|85716393|ref|ZP_01047365.1| short-chain dehydrogenase/reductase SDR [Nitrobacter sp. Nb-311A]
 gi|85696750|gb|EAQ34636.1| short-chain dehydrogenase/reductase SDR [Nitrobacter sp. Nb-311A]
          Length = 247

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/238 (42%), Positives = 148/238 (62%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +R+ALV+G+SRGIGY TA  LA++GA+VIA  R+   LE+L + ++K      +   +
Sbjct: 5   LASRIALVSGASRGIGYATARALAKAGAHVIAVARTQGGLEELDDDIRKDGGSATLVPLN 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D   +      + +R GKLDIL+ NAGI G  SP+  I+ K + DVI+VNV AN+ ++
Sbjct: 65  LTDFEGIARLGAALNERHGKLDILVGNAGIAGPSSPLGHIELKPWQDVIAVNVTANFQLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R  +P L++S  GRA+ ++S AA       G Y+ASKAA++ L R W+ ET  T +RV  
Sbjct: 125 RCMEPLLQQSDAGRAVFVTSSAAGSANAYRGPYAASKAALDTLVRCWANETATTRIRVNL 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
            DPGP RT MRA   P EDPNT+  P+++A+ +  +C     ETG+LF     R V++
Sbjct: 185 FDPGPVRTRMRAIVFPGEDPNTLDTPEQIAEFMVPMCLPSWGETGQLFDYISRRVVSF 242


>gi|148255184|ref|YP_001239769.1| putative Short-chain dehydrogenase/reductase SDR [Bradyrhizobium
           sp. BTAi1]
 gi|146407357|gb|ABQ35863.1| Putative Short-chain dehydrogenase/reductase SDR [Bradyrhizobium
           sp. BTAi1]
          Length = 247

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 147/242 (60%), Gaps = 1/242 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK-INKKIDIFAF 74
           L NR+ALVTG+SRGIGY TA  LAR+GA+V+A  R+   LE+L + ++K       +   
Sbjct: 5   LANRIALVTGASRGIGYATARALARAGAHVVAVARTQGGLEELDDEIRKETGNGATLVPL 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
            + D++ +      + +R G+LDIL+ NA + G  SP+  I  K++ DV++VN+ AN  +
Sbjct: 65  SMADTDGIARLGAALHERHGQLDILVGNAAVPGPSSPLGHIDLKAWNDVLTVNLTANVQL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R  +P LK S  GRA+ L+SGAA+K +   G Y+ +KAA+E LAR W+ ET  T LRV 
Sbjct: 125 IRCMEPLLKASDAGRAVFLTSGAAHKAQAYLGPYAVTKAAVETLARVWAHETERTPLRVN 184

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYL 254
              PGP RT MRA   P EDP T+  P++VA+ I  +C     ETGKL+        ++ 
Sbjct: 185 LFSPGPIRTRMRATVFPGEDPMTLETPEQVAEFIVPMCLPSWTETGKLYEYKSRALKSFQ 244

Query: 255 TP 256
            P
Sbjct: 245 PP 246


>gi|114569755|ref|YP_756435.1| short-chain dehydrogenase/reductase SDR [Maricaulis maris MCS10]
 gi|114340217|gb|ABI65497.1| short-chain dehydrogenase/reductase SDR [Maricaulis maris MCS10]
          Length = 238

 Score =  198 bits (503), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 149/235 (63%), Gaps = 6/235 (2%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIF 72
             +LD RLALV+G+SRGIG   ALELA++GA+VIA  R+   LE+L + + K      I 
Sbjct: 3   QTDLDGRLALVSGASRGIGRAMALELAKAGAHVIATARTTGGLEELDDDIVKAGGSCTIV 62

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             DL   + +E     I +RW KLDIL+ANAG LG ++P  Q+K K++ DVI VN+MA  
Sbjct: 63  PLDLMSPDGIEKLGGVITERWEKLDILLANAGSLGVLTPASQVKSKTWHDVIGVNLMAPA 122

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            ++R+F+P L  S  GRA+ +SSGAA   R  W  Y+ASKAA++AL  +W+ E VN   +
Sbjct: 123 RMIRAFEPLLLASDAGRAVFISSGAASSRRAFWAPYAASKAALDALVESWANEHVNNPNI 182

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQ----KVAKIISFLCATQKIETGKL 242
           R+  + PG  RT MR+KA P E+P+T+P P      +A+++S  C T+  ET K 
Sbjct: 183 RINTVYPGALRTQMRSKAFPGENPDTLPEPSALWPTIAELVSPDC-TRNGETVKF 236


>gi|83945267|ref|ZP_00957616.1| probable oxidoreductase [Oceanicaulis alexandrii HTCC2633]
 gi|83851437|gb|EAP89293.1| probable oxidoreductase [Oceanicaulis alexandrii HTCC2633]
          Length = 239

 Score =  197 bits (502), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 96/230 (41%), Positives = 150/230 (65%), Gaps = 1/230 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R+ALVTG+SRG+GY  AL+LA +GA VIA  R+ + LE+L +A++ +  K  +   D
Sbjct: 7   LAGRVALVTGASRGLGYAIALKLAEAGAEVIATARTQAGLEELDDAIKAMGGKAALVPLD 66

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L   + +E     +A RW KLDI++ANAG LG ++P  Q+  K + +V++ N++A   ++
Sbjct: 67  LNSQDGIEKLAEAVAGRWKKLDIMVANAGALGVLTPAAQLTSKVWNEVLATNLIAPARMI 126

Query: 136 RSFDPWLKKSHCGRAIILSSG-AAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           R+F+  LK S  GRA+ ++SG  + + +  WGAY ASKA ++ L ++W++E  +T LR  
Sbjct: 127 RAFESLLKASDAGRAVFMTSGVGSRRAKAYWGAYGASKAGLDNLVQSWAQELTDTPLRAN 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFS 244
            +DPG TRT MRAKA+P EDP+T+P P ++A  +  LC   +   G++ S
Sbjct: 187 LLDPGATRTRMRAKAVPGEDPDTLPTPAEIAPKVVELCLPSETRNGEIVS 236


>gi|295689705|ref|YP_003593398.1| short-chain dehydrogenase/reductase SDR [Caulobacter segnis ATCC
           21756]
 gi|295431608|gb|ADG10780.1| short-chain dehydrogenase/reductase SDR [Caulobacter segnis ATCC
           21756]
          Length = 251

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 142/226 (62%), Gaps = 3/226 (1%)

Query: 9   NSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNA-LQKINK 67
            S+    L  R+ALVTG++RGIG   AL LA++GA+VIA GR+   LE L +A +    +
Sbjct: 2   TSDSQKPLAGRIALVTGATRGIGEAVALGLAKAGAHVIAVGRTQGALEALDDAIMTATGE 61

Query: 68  KIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
              +   DLR+++ L+     I +RWGKLDIL+  A +LG ++P+  ++ K +  V+S N
Sbjct: 62  HATLVPLDLREADGLDHLGAAIHQRWGKLDILVGAAALLGPLTPVSHLEPKGWDMVLSTN 121

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRP-LWGAYSASKAAIEALARTWSKET 186
           + ANW ++RS DP L+ S  GRA+  SS  A + RP  WG Y+A+KAA+EAL   ++ ET
Sbjct: 122 LTANWRLIRSMDPLLRASDAGRAVFFSSSVA-RTRPAFWGVYAATKAALEALVDVYADET 180

Query: 187 VNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
            NTA+R + +DPG  RT MRA A P EDP TVP P+ +   I  L 
Sbjct: 181 ENTAIRALCVDPGAMRTKMRAGAFPGEDPKTVPAPETIVPFIVDLV 226


>gi|91977466|ref|YP_570125.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           BisB5]
 gi|91683922|gb|ABE40224.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           BisB5]
          Length = 247

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/230 (45%), Positives = 146/230 (63%), Gaps = 2/230 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ALVTG+SRGIGY TA  LA++GA+VIA  ++   LE+L +A++      I +   
Sbjct: 5   LASRIALVTGASRGIGYATARALAKAGAHVIAVAKTQGGLEELDDAVRNDGGHAITLVPV 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D  A+      I +R GKLD+L+ NAGI G  SP+  I+ KS+  VI +N+ AN+ +
Sbjct: 65  DLTDFEAIARLGASIHERHGKLDVLVGNAGIAGPSSPLGHIEMKSWTGVIGLNLTANFQL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRV 193
           +R  +P L+ S  GRA+ L+S A  K     G Y+ASKAA++ L + W+KE VNT  +RV
Sbjct: 125 IRCMEPLLRMSDAGRAVFLTSRAGGKAPAYRGPYAASKAALDTLVQVWAKEVVNTTPIRV 184

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLF 243
              DPGPTRT +R   MP EDP T+  P +VA+++  LC     ETGKLF
Sbjct: 185 NLFDPGPTRTKLRGTIMPGEDPETLQTPDQVAELLVPLCLPSWTETGKLF 234


>gi|170740818|ref|YP_001769473.1| short-chain dehydrogenase/reductase SDR [Methylobacterium sp. 4-46]
 gi|168195092|gb|ACA17039.1| short-chain dehydrogenase/reductase SDR [Methylobacterium sp. 4-46]
          Length = 253

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 103/241 (42%), Positives = 157/241 (65%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +R+A+VTG+SRGIG   AL LA +GA+V+A  R+   LE+L +A+++      +   D
Sbjct: 12  LADRIAVVTGASRGIGRAAALALAAAGAHVVAVARTQGALEELDDAIRQGGGTATLVPLD 71

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D +A++     I +RWG+LD+LI NAG LG + P+  ++ K +A V+ VN+ ANW ++
Sbjct: 72  VTDYDAIDRLGAAIHERWGRLDVLIGNAGNLGRLMPLGHVEPKLWASVMDVNLTANWRLI 131

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RS DP L++S  GRAI ++SGAA  C+  WG Y+ SKAA+EAL RT++ ET +T +R + 
Sbjct: 132 RSLDPLLRRSDAGRAIFITSGAAASCKAYWGPYAVSKAALEALVRTYAAETASTPIRAML 191

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
           ++PGP RT+MR  AMP EDP T+  P+ +A  +  L +    ETG ++  P +R +    
Sbjct: 192 VNPGPLRTAMRRAAMPGEDPETLRTPEDLAPHVVRLASPSWQETGLIYDFPSDRVLTPQR 251

Query: 256 P 256
           P
Sbjct: 252 P 252


>gi|315499688|ref|YP_004088491.1| short-chain dehydrogenase/reductase sdr [Asticcacaulis excentricus
           CB 48]
 gi|315417700|gb|ADU14340.1| short-chain dehydrogenase/reductase SDR [Asticcacaulis excentricus
           CB 48]
          Length = 245

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 140/223 (62%), Gaps = 1/223 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
              R+AL+TG+SRGIG  TAL LARSGA+VIAC R+   LE L + +  +  +   +  F
Sbjct: 6   FQGRIALITGASRGIGRATALGLARSGAHVIACARTTGALEDLDDQIFAETGRHATLIPF 65

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D  ALE     I +R+ KLDI +  A  LGS++P+   + K F  VI++N+ A + +
Sbjct: 66  DLADGAALERIGGAIYERFKKLDIFVHAAATLGSLTPVSHYEPKDFNRVITLNLNATYRL 125

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R  +P +K S   RAI +SSGAA   R  WGAY+ASKA +EAL RTW+ E   T++R  
Sbjct: 126 IRQLEPVMKLSDAARAIFVSSGAASNARAFWGAYAASKAGMEALVRTWADEMEVTSIRCA 185

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
            ++PG  RT MRA+A P EDP T+P P+++  ++  L +  ++
Sbjct: 186 LVNPGAMRTRMRAEAFPGEDPETLPRPEEIIPLMVELASADRV 228


>gi|312113728|ref|YP_004011324.1| short-chain dehydrogenase/reductase SDR [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311218857|gb|ADP70225.1| short-chain dehydrogenase/reductase SDR [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 247

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 144/231 (62%), Gaps = 2/231 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
            D ++ALVTG+SRGIG   A  LA  GA+V+A  R+   LE+L + ++      + +  F
Sbjct: 10  FDGKVALVTGASRGIGRAIAKALALQGAHVVATARTQGALEELDDEVRTAGGVPLSLMPF 69

Query: 75  DL-RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           DL +  + ++     + +RW KLDI + NAG+LG +SP+  IKE  +A  + +N+ ANW 
Sbjct: 70  DLDKQLDEIDTLGPTLYQRWQKLDIFVGNAGLLGPLSPLGHIKEGDWALTLQINLTANWR 129

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++R+ DP LK S  GR + L+SGAA + R  WG YS SKA ++ALA+T++ E  +T +RV
Sbjct: 130 LIRTLDPVLKLSPAGRVLFLTSGAAQRARAYWGPYSVSKAGLDALAKTYAHENASTNIRV 189

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFS 244
             +DPG  RT MRAKA P E+PNT+P P  +  +   L   +   +G++F+
Sbjct: 190 NLLDPGKVRTHMRAKAYPGEEPNTLPAPDALVPLALSLLTPETTASGEIFT 240


>gi|90423432|ref|YP_531802.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           BisB18]
 gi|90105446|gb|ABD87483.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           BisB18]
          Length = 245

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 148/226 (65%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +R+ALVTG+SRGIGY  AL LA +GA+++A  R+   LE+L +A++ I     +   DL 
Sbjct: 7   SRIALVTGASRGIGYAAALALAEAGAHIVAVARTQGGLEELDDAIRGIGGSATLVPLDLT 66

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D  A+      + +R G+LD+++A+AGI G  SP+  I  K ++DVI++N+ AN+ ++R 
Sbjct: 67  DFEAIARLGAALNERHGRLDVMVASAGIAGPSSPLGHIPMKPWSDVIAINLTANFQLIRC 126

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
            +P L+ S  GRA+ L+S AA       G Y+AS AA++ LAR W++ET  T +++   D
Sbjct: 127 MEPLLRNSDAGRAVFLTSAAAAGAPAYRGPYAASHAALQTLARVWARETAITKIKINLFD 186

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLF 243
           PGPTRT +RA  MP EDP T+P PQ+VA+ I  LCA    E+GKL+
Sbjct: 187 PGPTRTKLRATVMPGEDPQTLPTPQQVAEQIVPLCAADFAESGKLY 232


>gi|254294309|ref|YP_003060332.1| short-chain dehydrogenase/reductase SDR [Hirschia baltica ATCC
           49814]
 gi|254042840|gb|ACT59635.1| short-chain dehydrogenase/reductase SDR [Hirschia baltica ATCC
           49814]
          Length = 235

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 90/220 (40%), Positives = 142/220 (64%), Gaps = 1/220 (0%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAFD 75
           D R+ LVTG+S+GIG  TA  LA  GA++IA  RS   LEKL + ++ +  +   +   D
Sbjct: 3   DKRIILVTGASKGIGRATAKVLAAEGAHIIALARSTEALEKLDDEVRAETGENATLITLD 62

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L+D ++++     + +R+G++D L+ANAGILG++ P+  +  +SF D I++N+ ANW ++
Sbjct: 63  LKDGSSIDRIAAPLMERFGRIDGLVANAGILGTLGPLETVSPRSFEDTININLTANWRLI 122

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R+ DP L+KS  GRA+ L+SG A   R  WG Y ASKA +EAL + W+ ET  ++L V  
Sbjct: 123 RALDPLLRKSDAGRAVFLTSGVAENPRAFWGPYQASKAGLEALIKAWAFETEQSSLNVNL 182

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
            +PG T+T MR  A+P ED + +P P+ VA  +++  + +
Sbjct: 183 FNPGATKTDMRFSAVPGEDQSLLPTPEDVASKLAYYVSKE 222


>gi|167646462|ref|YP_001684125.1| short-chain dehydrogenase/reductase SDR [Caulobacter sp. K31]
 gi|167348892|gb|ABZ71627.1| short-chain dehydrogenase/reductase SDR [Caulobacter sp. K31]
          Length = 250

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 90/221 (40%), Positives = 137/221 (61%), Gaps = 1/221 (0%)

Query: 9   NSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNA-LQKINK 67
            S+    L  R+ALVTG++RGIG   AL LA++GA+VIA GR+   LE L +A L    +
Sbjct: 2   TSDSDTPLAGRIALVTGATRGIGEAIALGLAQAGAHVIAVGRTQGALEALDDAILAATGE 61

Query: 68  KIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
              +   DLR+++ L+     + +R+GKLDIL+  AG+LG+++P+  +  K +  +++ N
Sbjct: 62  HATLVPLDLREADGLDQLGAALHERYGKLDILVGAAGVLGALTPVGHLDPKGWDMIMATN 121

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           + ANW ++R+ DP L+++  GRAI L+S  A      WG Y+ASKA +EA+   +  E  
Sbjct: 122 LTANWRLIRAMDPLLRRAEAGRAIFLTSSVAKTHPAFWGGYAASKAGLEAVVACYDDEME 181

Query: 188 NTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKII 228
           N+ +R + +DPG  RT MRA A P EDP TVP P  +  +I
Sbjct: 182 NSTVRAVCVDPGAMRTRMRAGAFPGEDPQTVPAPDTIVPLI 222


>gi|304392037|ref|ZP_07373979.1| NAD/nadp dependent oxidoreductase [Ahrensia sp. R2A130]
 gi|303296266|gb|EFL90624.1| NAD/nadp dependent oxidoreductase [Ahrensia sp. R2A130]
          Length = 245

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 146/236 (61%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ R+ALVTG+SRGIGY  AL LAR+GA+VIA  R++  LE L +A++K      +   D
Sbjct: 6   LEGRVALVTGASRGIGYEAALGLARAGAHVIAVARTVGGLEDLDDAIRKDGGTATLVPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D +A++     I +RWGKLDIL+ NAG LG ++P+ Q K   F  V ++NV AN+ ++
Sbjct: 66  LTDFDAIDRLGGSINERWGKLDILVGNAGALGVLTPLAQNKPAVFEQVFALNVTANYRLI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RS DP L+KS  GRAI L+SGAA   +   G YSASKAA+EAL R+++ E    AL    
Sbjct: 126 RSLDPLLQKSDAGRAIFLTSGAARNSKAFVGPYSASKAALEALVRSYAAENRLNALNTNL 185

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           +DPG  RT MRA+  P EDP TV     +   +  L +      G ++S+ +  F+
Sbjct: 186 LDPGHLRTKMRAQYAPGEDPKTVTEASAIIPAVLELASEDCDTNGGVYSLSKQGFL 241


>gi|296532295|ref|ZP_06895034.1| short-chain dehydrogenase/reductase family oxidoreductase
           [Roseomonas cervicalis ATCC 49957]
 gi|296267371|gb|EFH13257.1| short-chain dehydrogenase/reductase family oxidoreductase
           [Roseomonas cervicalis ATCC 49957]
          Length = 248

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/227 (38%), Positives = 146/227 (64%), Gaps = 1/227 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++AL+TG+SRGIG  TA+ELAR GA+ +   R+   LE+  +A++ +  +  +  F+
Sbjct: 16  LAGQIALLTGASRGIGAATAVELARLGAHCVLIARTQGGLEETDDAIRAVGGQATLLPFN 75

Query: 76  L-RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           L +D++ +++    + +R+G+LDILI NAG LG+++P+  I  + + DVI  N+ A W +
Sbjct: 76  LVKDADKIDMVGPSLVERFGRLDILIHNAGALGALTPVAHITPRDWNDVIGTNLTAAWRL 135

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R+ DP L+ +  GRA+ +++G   + +  WG Y ASKA +E L +TW++E  +TALRV 
Sbjct: 136 IRTCDPPLRAAPAGRAVFVTTGRVQRPKAFWGLYGASKAGMEHLVQTWAQEVEHTALRVN 195

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGK 241
             DP    T MRA+AMP EDP+++  P+ VA  ++ LC   +   G+
Sbjct: 196 LFDPDVVATKMRAQAMPGEDPDSIAQPRDVAPALAALCLPAESRHGQ 242


>gi|90423784|ref|YP_532154.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           BisB18]
 gi|90105798|gb|ABD87835.1| short-chain dehydrogenase/reductase SDR [Rhodopseudomonas palustris
           BisB18]
          Length = 257

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 96/229 (41%), Positives = 141/229 (61%), Gaps = 1/229 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK-IDIFAF 74
           L +R+ALVTG+SRG+GY TA  LA++GA+V+A  R+   LE+L + ++K + +   +   
Sbjct: 15  LASRIALVTGASRGLGYATARALAKAGAHVVAVARTQGGLEELDDEIRKASGEGATLVPL 74

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D  A+      + +R GKLDI + NAGI G  SP+  I  K + DV+++N+ AN+ +
Sbjct: 75  DLTDLEAIARLGGALHERHGKLDIFVGNAGIAGPSSPLGHIAPKPWGDVMAINLNANFQL 134

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R  +P L+ S  GRA+++S   A +     G  +ASKAA+E L R W+ E   TALRV 
Sbjct: 135 IRCMEPLLRVSDAGRAVMISCDEARRAPAYRGPAAASKAALETLTRVWAAENATTALRVN 194

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLF 243
             DPGP RT +RA  MP EDP T+P   +VA+ +  LC     + GKL+
Sbjct: 195 LFDPGPVRTRLRATIMPGEDPETLPTAAEVAEALLPLCLPSCDDNGKLY 243


>gi|83591743|ref|YP_425495.1| short-chain dehydrogenase/reductase sDR [Rhodospirillum rubrum ATCC
           11170]
 gi|83574657|gb|ABC21208.1| Short-chain dehydrogenase/reductase SDR [Rhodospirillum rubrum ATCC
           11170]
          Length = 237

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 137/212 (64%), Gaps = 1/212 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R   +TG+SRGIG   A   A  GA+VIA  R+   LE+L + ++        +   
Sbjct: 5   LQDRHCFITGASRGIGKAVAKLFAAEGAHVIALARTQGGLEELDDEIRSAGGTPPTLITE 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL + +A++     + +R+GK+D+L+AN GILGS++P+  IK K + +VI+ N+ A++ +
Sbjct: 65  DLTNFDAIDQIGAALFERFGKIDVLVANGGILGSLTPVSHIKPKEWDEVIATNLTASYRL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +RSF+P L++S  GRAI ++SGAA   RP W  Y  SK A+E + +TWS+E + T ++  
Sbjct: 125 IRSFEPLLRQSDAGRAIFVTSGAADGARPYWATYGISKGALEVMVKTWSQEILKTKIKAN 184

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAK 226
            ++PG TRT MRAKA P EDP T+P P+ +AK
Sbjct: 185 LLNPGRTRTPMRAKAFPGEDPATLPTPEDIAK 216


>gi|163797499|ref|ZP_02191450.1| Short-chain dehydrogenase/reductase SDR [alpha proteobacterium
           BAL199]
 gi|159177248|gb|EDP61807.1| Short-chain dehydrogenase/reductase SDR [alpha proteobacterium
           BAL199]
          Length = 236

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 138/217 (63%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ R+AL+TG+SRGIG   A   AR GA++I   R++  LE+  + ++ +     +   D
Sbjct: 5   LEGRIALITGASRGIGAAVAEAYAREGAHLILVARTVGGLEETDDRVKAVGGSATLVPLD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D  A++     I +RW KLD+L+AN G LG ++PI   + K + +V++VN+ +   ++
Sbjct: 65  LTDYPAIDRLGASIFERWKKLDVLVANHGSLGVLTPIAMYEPKMWDEVMAVNLSSCHRLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           RS DP L++S  GRAI ++SGAA   RP WGAY+ SKAA+EA+ R+++ ET  T LRV  
Sbjct: 125 RSLDPLLRQSDAGRAIFVTSGAAVGERPNWGAYAVSKAALEAMVRSYAGETRKTKLRVNL 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
           ++PG TRT MRA A P EDP T+  P+ +A +   L 
Sbjct: 185 LNPGGTRTKMRATAFPGEDPMTLKTPEDIAPVFVDLA 221


>gi|294084221|ref|YP_003550979.1| NAD/NADP dependent oxidoreductase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663794|gb|ADE38895.1| NAD/NADP dependent oxidoreductase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 241

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 96/230 (41%), Positives = 144/230 (62%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +LD +L LVTG+SRGIG   A+  A++GA +I  GR++  LE+  +A++    K  I   
Sbjct: 5   DLDGKLILVTGASRGIGRAVAIAAAQAGAELIITGRTMGALEETDDAIKSAGSKATIVEL 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ D+ A+    + I  RWG LD L+ANAG++G ++P+   +E  + + I +N+ A W++
Sbjct: 65  DMADTPAIPRLASAIQGRWGHLDGLVANAGMIGPLTPVSHHEESVWNNTIMINLTAQWHL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +++ +P L +S  GRAI++SSGAA   R  WGAY+ASKA +EAL   W+ ET  T LRV 
Sbjct: 125 IKAMEPLLLQSDAGRAILVSSGAASNPRAFWGAYAASKAGLEALGICWAAETEQTNLRVN 184

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFS 244
            I+PG T T MRA A P EDP+T+P P+ +A     L +      GK+ +
Sbjct: 185 MINPGATATLMRASAFPGEDPSTIPAPEDIAPAFVTLLSPACTSHGKVVA 234


>gi|329850906|ref|ZP_08265751.1| short chain dehydrogenase family protein [Asticcacaulis
           biprosthecum C19]
 gi|328841221|gb|EGF90792.1| short chain dehydrogenase family protein [Asticcacaulis
           biprosthecum C19]
          Length = 245

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 131/209 (62%), Gaps = 2/209 (0%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAFDL 76
            R+ALVTG+SRGIG   AL LA++GA VIAC RS + LE+L + +     +   +  FDL
Sbjct: 8   GRIALVTGASRGIGRACALGLAKAGAQVIACARSKAGLEELDDEIFAATGRHATLVPFDL 67

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
            D  A++     I +R+G+LD ++  A +LG+++P+   + K F  VI+VNV A W ++R
Sbjct: 68  SDGEAIDRLSAVILERFGRLDSVVHAAAVLGTLTPVTHHEPKDFDKVIAVNVTATWRLLR 127

Query: 137 SFDPWLKKSHCGRAIILSSGAAY-KCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           + +P ++ S  GR ++ ++GA+  K R  WG Y A+KAA+E L R W+ E   T +R   
Sbjct: 128 AIEPLMRLSPSGRLVVFTTGASVTKGRAFWGLYGATKAAVETLVRAWADELDITPIRAAL 187

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           + PG  RT MRA A P EDP ++PHP ++
Sbjct: 188 LAPGAMRTRMRAVAYPGEDPMSLPHPSEI 216


>gi|299133686|ref|ZP_07026880.1| short-chain dehydrogenase/reductase SDR [Afipia sp. 1NLS2]
 gi|298591522|gb|EFI51723.1| short-chain dehydrogenase/reductase SDR [Afipia sp. 1NLS2]
          Length = 246

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 142/241 (58%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +R+ALVTG+SRGIG+  A  LAR+GA+VIA  R+   LE+L + ++       +   D
Sbjct: 5   LASRIALVTGASRGIGHAAARALARAGAHVIAVARTQGGLEELDDEIRSEGGSTTLVPLD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D + +      +  R GKLDILI NAG+ G  SP+  I  K + D I VN+ AN+ ++
Sbjct: 65  ITDYDGVARLGAALNDRHGKLDILIGNAGVAGPSSPLGHIDLKPWMDAIGVNLTANFQLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R  +P L  S  GRA+ ++SG A K     G Y+ASKA +EALAR W+ ET  + +RV  
Sbjct: 125 RCMEPLLIHSDAGRAVFITSGTASKASAYRGPYAASKAGLEALARVWAHETATSEIRVNL 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255
            +PGP RT MRA  MP EDP T+  P++ A+ I  +C     ETGK++       +++  
Sbjct: 185 FNPGPIRTRMRASVMPGEDPMTLDTPEQAAEYILPMCMPDWNETGKVYDYRTRSLMHFRP 244

Query: 256 P 256
           P
Sbjct: 245 P 245


>gi|23014162|ref|ZP_00053994.1| COG1028: Dehydrogenases with different specificities (related to
           short-chain alcohol dehydrogenases) [Magnetospirillum
           magnetotacticum MS-1]
          Length = 239

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 132/220 (60%), Gaps = 3/220 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ R+ALVTG+SRGIG   A  LA  GA ++A  R+   LE+L + ++ +  K + +   
Sbjct: 5   LEGRVALVTGASRGIGAAVARRLAAEGAEIVAIARTQGALEELDDQIRSMGGKPLVLVPE 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAG-ILGSISPIWQIKEKSFADVISVNVMANWN 133
           DLR    +E     I +R+G+LDIL+ NAG I G ++P+ Q     + +  +VNV ANW 
Sbjct: 65  DLRKPGLIEQVAAAIFQRFGRLDILVGNAGAIGGGLTPVAQHSPDDWEEAFAVNVTANWR 124

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALR 192
           ++R+ DP L+ +  GRA+  +SGAA    P WGAY+AS+AA+E + RTW+ E    TA++
Sbjct: 125 LIRACDPLLRMAPLGRAVFTTSGAAQGAEPFWGAYAASQAALETMVRTWAAEIAKVTAVK 184

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
              +DPG   T +R+ A P EDP+ +  P  VA     LC
Sbjct: 185 ANLLDPGVVATRLRSIAFPGEDPSKLAQPDDVAGAFLELC 224


>gi|103487027|ref|YP_616588.1| short-chain dehydrogenase/reductase SDR [Sphingopyxis alaskensis
           RB2256]
 gi|98977104|gb|ABF53255.1| short-chain dehydrogenase/reductase SDR [Sphingopyxis alaskensis
           RB2256]
          Length = 244

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 138/234 (58%), Gaps = 2/234 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L  ++ALVTG+SRGIG   A  LA  GA+V+   R+   LE+L++ +        I   
Sbjct: 7   ELAGQIALVTGASRGIGAAIAESLAARGAHVVITARTAGGLEELEDRIHAAGGSATIAPL 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D +++    + +A+RW  LD+L+ NA +LG+++P+  I  K F   +++N++A   +
Sbjct: 67  DLTDGDSIARLASAMAERWQHLDMLVLNAAMLGTLTPVAAIDGKEFNRTLTLNLIAQQAL 126

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRV 193
           + +FDP L+++  GR + LS+  A   R  WGAY+ASKAA E L  ++  E  N + +R 
Sbjct: 127 IANFDPLLRRAANGRLLALSTSVARTPRAYWGAYAASKAAFEVLVTSYGAEMRNISGVRT 186

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQ 247
             +DPGPTRT MRA+A P EDP ++  P  V + ++ L   Q  ++    ++P+
Sbjct: 187 AILDPGPTRTQMRARAYPGEDPQSIKEPAAVGEYVADLM-VQGFDSTAFHALPK 239


>gi|197105000|ref|YP_002130377.1| short-chain dehydrogenase/reductase SDR [Phenylobacterium zucineum
           HLK1]
 gi|196478420|gb|ACG77948.1| short-chain dehydrogenase/reductase SDR [Phenylobacterium zucineum
           HLK1]
          Length = 248

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/218 (40%), Positives = 139/218 (63%), Gaps = 1/218 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK-INKKIDIFAF 74
           L +R+ALVTG+SRGIG   AL LA++GA+V+A  R+   LE+L + ++    K   +   
Sbjct: 6   LTDRIALVTGASRGIGRAAALALAKAGAHVVAVARTQGGLEELDDEIRAATGKSATLVPM 65

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ +  AL+     + +R+G+LDIL+  A ILG I+P+  I+ K +A V+ VN+ A++ +
Sbjct: 66  DIAEEGALDQLGLAVHQRFGRLDILVHAAAILGPITPVSHIEPKHWARVMDVNLTASYRL 125

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +RS +P L+ S   RAI L++  A+  +  WG Y ASKAA+E L RTW+ E   T +R +
Sbjct: 126 IRSAEPLLRASERPRAIFLTTSRAHNPKAFWGPYGASKAALENLVRTWADELEQTKIRAV 185

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
            ++PG  RT MRA+AMP EDP ++P P ++  ++  L 
Sbjct: 186 LLEPGAMRTKMRAEAMPGEDPMSLPDPSEIGPLVVELA 223


>gi|304319800|ref|YP_003853443.1| putative oxidoreductase protein [Parvularcula bermudensis HTCC2503]
 gi|303298703|gb|ADM08302.1| putative oxidoreductase protein [Parvularcula bermudensis HTCC2503]
          Length = 236

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 122/196 (62%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           RL LVTG+SRGIG    + LA +G + IA  R+   LE L + +     ++ +   DL D
Sbjct: 8   RLILVTGASRGIGRALTVALAAAGHHPIALARTQGALEALDDEITAAGGRVTMIPADLTD 67

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
             A+      +A R+G+LD  +ANAG LG ++PI  I+EK +   +++NV AN  ++   
Sbjct: 68  REAMARLPEALAARFGRLDGFVANAGSLGDLTPIADIQEKMWDRTMALNVTANAFLLTGL 127

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
           DP L++S  GR + ++S  A K +P WG YSASKAA EA+  T++ ET  +ALRV  ++P
Sbjct: 128 DPLLRQSAAGRVVGITSSRARKFKPFWGPYSASKAAFEAVFLTYAAETEESALRVNLVNP 187

Query: 199 GPTRTSMRAKAMPAED 214
           GP RT+MR KAMP ED
Sbjct: 188 GPMRTAMREKAMPGED 203


>gi|288958540|ref|YP_003448881.1| short-chain dehydrogenase/reductase SDR [Azospirillum sp. B510]
 gi|288910848|dbj|BAI72337.1| short-chain dehydrogenase/reductase SDR [Azospirillum sp. B510]
          Length = 235

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/210 (39%), Positives = 130/210 (61%), Gaps = 1/210 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  R+ALVTG+SRGIG   A   A  GA+++   R++  LE+  +A+QKI+ +   +   
Sbjct: 4   LSGRIALVTGASRGIGAAVAKRFAAEGAHLVLVARTVGGLEETDDAIQKISGQSATLVPM 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DLRD + ++     + +R+GKLD+++ NAG L ++ P+ Q   K ++ V+ +NV AN+ +
Sbjct: 64  DLRDYDKIDQLGHALYQRFGKLDVVVGNAGALEALGPVAQYDPKLWSRVMDLNVTANYRL 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +RS DP L+ S  GRAI ++S AA   +  W  Y ASKAA+E + +T++ E   ++LRV 
Sbjct: 124 IRSMDPLLRASGSGRAIYVTSAAAQAPQHYWMPYGASKAALEMIVKTYAMEVAGSSLRVN 183

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
            IDPG   + +R +A P EDP  V  P +V
Sbjct: 184 LIDPGIVASKLRTQAFPGEDPTKVAQPDQV 213


>gi|83311187|ref|YP_421451.1| dehydrogenase [Magnetospirillum magneticum AMB-1]
 gi|82946028|dbj|BAE50892.1| Dehydrogenase with different specificities [Magnetospirillum
           magneticum AMB-1]
          Length = 239

 Score =  165 bits (417), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 89/231 (38%), Positives = 132/231 (57%), Gaps = 3/231 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ R+ALVTG+SRGIG   A  LA  GA ++A  R+   LE+L + ++K   K + +   
Sbjct: 5   LEGRVALVTGASRGIGAAVARRLAAEGAEIVAIARTQGALEELDDQIRKAGGKPLVLVPE 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAG-ILGSISPIWQIKEKSFADVISVNVMANWN 133
           DL     +E     I +RW +LDIL+ NAG I G ++P+ Q     + +  +VNV ANW 
Sbjct: 65  DLCKPGLIEQVAAAIFQRWARLDILVGNAGAIGGGLTPVAQHAPDDWEEAFAVNVTANWR 124

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALR 192
           ++R+ DP L+ +  GRA+  ++ AA    P WGAY+ASKAA+E + RTW+ E  N T+++
Sbjct: 125 LIRACDPLLRMAPAGRAVFTTADAARHAEPFWGAYAASKAALETMVRTWAAEIANVTSVK 184

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLF 243
              +DPG   T +R+ A P EDP  +  P  VA     LC       G++ 
Sbjct: 185 ANLLDPGVVATRLRSIAFPGEDPAKLAQPDDVAGAFLDLCLPDCTRQGEII 235


>gi|117923591|ref|YP_864208.1| short-chain dehydrogenase/reductase SDR [Magnetococcus sp. MC-1]
 gi|117607347|gb|ABK42802.1| short-chain dehydrogenase/reductase SDR [Magnetococcus sp. MC-1]
          Length = 243

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/223 (40%), Positives = 134/223 (60%), Gaps = 5/223 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+NR+ALVTG+  GIG   A   A +GA V+  GR+  +LE + +A+ +   K  I   D
Sbjct: 3   LENRIALVTGAGSGIGKAIAEGYAAAGATVLLLGRTQKKLENVYDAITQAGGKATIVPMD 62

Query: 76  LRDSNAL--ELTK-TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           L        EL K TY  +R+G+LDIL+ NA +LG++SP+   + + +  V+ VNV A +
Sbjct: 63  LETGLGAIPELVKNTY--ERYGRLDILVNNAALLGTLSPLANYRPQEWEQVMRVNVTAPF 120

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            +MR F P L +S     I LSSG  ++ R  WGAY+ASKAA+  L+ T ++E   + +R
Sbjct: 121 FLMREFIPLLTQSDDASIINLSSGVGHQGRAFWGAYAASKAALINLSETLAQELEKSPIR 180

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           V  ++PG T T+MRAKA P EDP T+P  Q +  +  +L + Q
Sbjct: 181 VNTVNPGATATTMRAKAFPGEDPTTLPSAQAILPVFLYLASQQ 223


>gi|209964887|ref|YP_002297802.1| NAD/NADP dependent oxidoreductase, putative [Rhodospirillum
           centenum SW]
 gi|209958353|gb|ACI98989.1| NAD/NADP dependent oxidoreductase, putative [Rhodospirillum
           centenum SW]
          Length = 240

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 85/230 (36%), Positives = 129/230 (56%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R+AL+TG+SRGIG   A   A  GA+V+   R+   LE++ + ++       +   D
Sbjct: 10  LAGRIALITGASRGIGAAVAERFAAEGAHVVLVARTQGGLEEVDDRIRAAGGTATLIPQD 69

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D   L++    + +++G+LDI +ANA  LG   P+     K +    +VNV AN  ++
Sbjct: 70  LADLEKLDVIGPALFEKFGRLDIFVANAAQLGYHGPLGHAAPKDWDKTFTVNVTANHRLI 129

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R+ DP L+ S  GRAI+++    +     W AY+ASKAA+E +AR W+ ET+ T LRV  
Sbjct: 130 RTLDPLLRASDAGRAILVTDRVGHVPTAYWNAYAASKAAVEMMARLWAAETLRTNLRVNL 189

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSV 245
           +DPGP  T++R KA P E+P +   P  VA     L AT     G+L ++
Sbjct: 190 LDPGPVATALRGKAFPGEEPASQRQPADVAAAFVDLAATDCTRHGELVTL 239


>gi|87199779|ref|YP_497036.1| short-chain dehydrogenase/reductase SDR [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135460|gb|ABD26202.1| short-chain dehydrogenase/reductase SDR [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 243

 Score =  161 bits (407), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 136/237 (57%), Gaps = 10/237 (4%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            +LALVTG+SRGIG  TA  LA  GA+V+   R+  +LEK++  + +      I   DL 
Sbjct: 13  GQLALVTGASRGIGAATAKALAAQGAHVVLVARTAKELEKVEEEIFEAGGSATIAPVDLS 72

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +   +    T I+ RW  LD+L+ NA    +++P+WQI  + F + +++NV+A   ++  
Sbjct: 73  EPEGIARLATAISGRWSALDVLVINAAAFPTLTPVWQIDSREFNNALTLNVLATQALLAG 132

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-ALRVINI 196
           FD  LKKS   R I ++S      R  WGAY ASKAA + L   +++E  NT A+RV  +
Sbjct: 133 FDGMLKKSKDARVIGVTSSVGATPRAYWGAYGASKAAFDVLLDCYAQEVRNTSAVRVAIL 192

Query: 197 DPGPTRTSMRAKAMPAEDPNTVPHPQKVA-KIISFLCATQKIETGKLFSVPQNRFVN 252
           DPG TRT MRA+A P E+P +V  P+ VA ++++ L        G+ FS P    VN
Sbjct: 193 DPGATRTKMRARAYPGENPESVKAPEVVAERMVALL--------GEQFSSPHRERVN 241


>gi|332186104|ref|ZP_08387850.1| short chain dehydrogenase family protein [Sphingomonas sp. S17]
 gi|332013919|gb|EGI55978.1| short chain dehydrogenase family protein [Sphingomonas sp. S17]
          Length = 235

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 130/218 (59%), Gaps = 1/218 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  +LALVTG+SRGIG  TA+ LA  GA+V+   R+   LE+++  +        I   D
Sbjct: 5   LAGKLALVTGASRGIGAATAIALAAEGAHVVLTARTPKGLEEVEETIFNAGGAATIAPLD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L ++ ++      I +RW  LDI++ NAG+LGS++ +  I  K FA V+++NV A   ++
Sbjct: 65  LTENESIGRLAGAIGERWQALDIMVLNAGMLGSLAAVPAIDPKEFARVLTLNVSAQGALI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRVI 194
            +FDP L++S   R I ++S      R  WGAY ASKAA E L   +  ET + +A+R  
Sbjct: 125 AAFDPMLRRSAGARVIGVTSSVGRNPRAYWGAYGASKAAFETLLGAYGDETADISAIRTA 184

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
            +DPG TRT MRAKA P EDP +V  P+ VA+ I+ L 
Sbjct: 185 IVDPGATRTQMRAKAYPGEDPASVKAPEVVAERITALA 222


>gi|90412192|ref|ZP_01220198.1| short chain dehydrogenase [Photobacterium profundum 3TCK]
 gi|90326916|gb|EAS43301.1| short chain dehydrogenase [Photobacterium profundum 3TCK]
          Length = 247

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 136/225 (60%), Gaps = 5/225 (2%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFA 73
           +L +R+ LVTG+  GIG   A+  A  GA VI  GR++++LE + + ++ +  K+  I  
Sbjct: 9   SLQDRVILVTGAGDGIGRQAAISYAAHGATVILLGRTVAKLEAVYDEIETLGYKQPAIIP 68

Query: 74  FDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
            DLR +   + +++ +T I++++G+LD ++ NAG+LG +SP  Q+ E +F DV+ VNV A
Sbjct: 69  LDLRGATKQHYIDMVET-ISEQFGRLDGVLHNAGLLGVLSPFDQLGEDTFDDVMHVNVKA 127

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            + + ++  P +KKS  GR I  +S   ++ R  WGAYS SK A E +    + E  NT 
Sbjct: 128 QFLMTQAIMPLIKKSEDGRMIFTTSTVGHEGRAFWGAYSMSKFATEGMMEILANEMCNTT 187

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           +RV  I+PG TRT MRAKA PAED   +  P+ +  +  +L   +
Sbjct: 188 VRVNAINPGGTRTGMRAKAFPAEDSGLLKTPKDIMPLYLYLMGPE 232


>gi|54309645|ref|YP_130665.1| short chain dehydrogenase [Photobacterium profundum SS9]
 gi|46914083|emb|CAG20863.1| putative oxidoreductase, short-chain dehydrogenase/reductase family
           [Photobacterium profundum SS9]
          Length = 247

 Score =  158 bits (399), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 134/225 (59%), Gaps = 5/225 (2%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFA 73
           +L +R+ LVTG+  GIG   A+  A  GA VI  GR++++LE + + ++ +   +  I  
Sbjct: 9   SLKDRVILVTGAGDGIGRQAAISYAAHGATVILLGRTVAKLEAVYDDIETLGYSQAAIIP 68

Query: 74  FDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
            DLR +   + +++ +T I+ ++G+LD ++ NAG+LG +SP  Q+ E +F DV+ VNV A
Sbjct: 69  LDLRGATKQHYIDMVET-ISDQFGRLDGVLHNAGLLGVLSPFDQLGEDTFDDVMHVNVKA 127

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            + + ++  P +KKS  GR I  SS   ++ R  WGAYS SK A E +    + E  NT 
Sbjct: 128 QFLMTQAIMPLIKKSEDGRIIFTSSTVGHEGRAFWGAYSMSKFATEGMMEILANEMCNTT 187

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           +RV  I+PG TRT MRAKA PAED   +  P+ +  +  +L   +
Sbjct: 188 VRVNAINPGGTRTGMRAKAFPAEDSGLLKTPKDIMPLYLYLMGPE 232


>gi|302383470|ref|YP_003819293.1| short-chain dehydrogenase/reductase SDR [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194098|gb|ADL01670.1| short-chain dehydrogenase/reductase SDR [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 251

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/220 (39%), Positives = 129/220 (58%), Gaps = 3/220 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           LD+R+ALV G+SRGIGY  AL LA +GA+V+A  R+   LE+L +A+     +   +  F
Sbjct: 7   LDDRIALVVGASRGIGYQAALALAVAGAHVVATARTQGGLEELDDAIYAATGRHATLVPF 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGS--ISPIWQIKEKSFADVISVNVMANW 132
           DL D   ++     I  R+GKLDI +  A  LG+  ++P+  I  + FA +   N  A +
Sbjct: 67  DLVDGGGIDRLGGAIFGRFGKLDIWVNAAATLGAQGLTPVSHIDPRGFAKIEKTNFTATY 126

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            ++RS +P L+ S   R I L++  A   +  WG Y+A+KA  EA+   W  E  +T++R
Sbjct: 127 RLIRSLEPLLRGSDAARVIHLTTSLARDPKAFWGLYAATKAGAEAMMLAWGDEIESTSIR 186

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
           V  +DPG  RT MRA+A P EDP T+PHP ++  +I  L 
Sbjct: 187 VSVLDPGRMRTQMRAQAFPGEDPQTLPHPSELGPLIVELA 226


>gi|296283770|ref|ZP_06861768.1| oxidoreductase [Citromicrobium bathyomarinum JL354]
          Length = 237

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 133/226 (58%), Gaps = 2/226 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
            + R+ALVTG+SRGIG  TA  LA  GA+VI   R  + LE++++A+        I   D
Sbjct: 7   FEGRVALVTGASRGIGAATAQALAAKGAHVILTARDDAALERVEDAIHNDGGTATIAPVD 66

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L +++ +      I+ RW  LD+L+ +A  L +++P+ QI+ K F + I+VN++A   ++
Sbjct: 67  LTENDGVARLAQAISSRWDALDMLVISAAYLPTLTPVTQIEPKQFNNAITVNLLATQALL 126

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-ALRVI 194
               P LK++  GR I L+S      R  W AY ++KAA + L   +++E  NT A+RV 
Sbjct: 127 AGLHPMLKRADAGRVIGLTSSVGATPRAYWSAYGSTKAAFDNLLECYAQEVANTGAIRVA 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG 240
            +DPG TRT+MR KA P EDP TV  P++VA  I+ L      ETG
Sbjct: 187 LVDPGATRTAMREKAYPGEDPQTVKPPEEVASRIAELF-EGDFETG 231


>gi|149184692|ref|ZP_01863010.1| probable oxidoreductase [Erythrobacter sp. SD-21]
 gi|148832012|gb|EDL50445.1| probable oxidoreductase [Erythrobacter sp. SD-21]
          Length = 235

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 131/219 (59%), Gaps = 2/219 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L ++LALVTG+S+GIG  TAL LA +G +V+   R +  LE +++ +        I   D
Sbjct: 5   LHDKLALVTGASKGIGAATALALAEAGTHVVLTSRDVRALEAVEDRIHDAGGASTIAPVD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L +S+ +    + IA RW KLDIL+ +A  L +++P+ QI  K F+  ++ N++A   ++
Sbjct: 65  LGESDGIARLASAIASRWDKLDILVISAAYLPALTPVTQIDGKQFSQAVTTNLLATQALL 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRVI 194
            +FDP LK++  GR I L+S      R  W AY A+KAA + L  ++++E      +RV 
Sbjct: 125 ANFDPLLKRAEAGRVIGLTSSVGKDPRAYWSAYGATKAAFDNLLDSYAQEVEKIGNVRVA 184

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVA-KIISFLC 232
            +DPG TRT+MRAKA P EDP TV  P+ V  +I+  L 
Sbjct: 185 VLDPGATRTAMRAKAYPGEDPKTVKGPEVVGNRIVELLL 223


>gi|90581224|ref|ZP_01237022.1| short chain dehydrogenase [Vibrio angustum S14]
 gi|90437595|gb|EAS62788.1| short chain dehydrogenase [Vibrio angustum S14]
          Length = 257

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 136/225 (60%), Gaps = 5/225 (2%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFA 73
           +L +R+ LVTG+  GIG   A++ A  GA VI  GR++++LE + + ++ +  K+  I  
Sbjct: 9   SLKDRVILVTGAGDGIGREAAIQYAAHGATVILLGRTVAKLEAVYDEIETLGYKQPAIIP 68

Query: 74  FDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
            DL  +   + L++  T I +++G+LD ++ NAGILG +SP+ QI+E +F DV+ VNV A
Sbjct: 69  LDLMGATKQHYLDMVDT-IEQQFGRLDGVLHNAGILGVLSPLEQIEESTFDDVMQVNVKA 127

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            + + ++  P +KKS  GR I  SS   +  R  WG+Y+ SK A E + +  + E  NT 
Sbjct: 128 QFLLTQAVIPLIKKSPDGRIIFTSSTVGHSGRAFWGSYAISKFATEGMMQVLADELSNTN 187

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           ++V  I+PG TRT MRAKA PAED   +  P+ +  +  +L   +
Sbjct: 188 VKVNAINPGGTRTGMRAKAFPAEDAMQLKTPKDIIPLYVYLMGPE 232


>gi|296114506|ref|ZP_06833159.1| short-chain dehydrogenase/reductase SDR [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295978862|gb|EFG85587.1| short-chain dehydrogenase/reductase SDR [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 254

 Score =  154 bits (390), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 84/234 (35%), Positives = 131/234 (55%), Gaps = 9/234 (3%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKN--------ALQKINKK 68
           +  +ALVTG+SRGIG   A  LA +GA+ I   R++  LE+  +        A  +  ++
Sbjct: 10  EGSVALVTGASRGIGRAMACALAEAGAHCILVARTVGGLERTDDLIAARHGDAGDRTAQR 69

Query: 69  IDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
             +   DL D  AL+L    +  R+G+LDIL+  A  LG ++P+  +   ++ D +++N 
Sbjct: 70  ATLLPMDLTDGAALDLLGPSVMARFGRLDILVHCAATLGVLTPVTHMDVAAWQDCLALNT 129

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A W ++R+  P L+ +  GRA+ L+   A    P WG  +AS+AA +AL RTW+ E   
Sbjct: 130 TAAWRLIRTTAPLLEGAAHGRAVFLTDAHACVPAPFWGMVAASRAAQDALVRTWACEIPA 189

Query: 189 TA-LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGK 241
           T+ LRV   DPG   T MR +AMP  DP  +P P++VA+ I  LC   ++  G+
Sbjct: 190 TSGLRVNLFDPGIVATRMRRQAMPGGDPAPLPRPEQVARQIVPLCLPGEMRHGQ 243


>gi|89074058|ref|ZP_01160559.1| short chain dehydrogenase [Photobacterium sp. SKA34]
 gi|89050196|gb|EAR55707.1| short chain dehydrogenase [Photobacterium sp. SKA34]
          Length = 255

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 136/225 (60%), Gaps = 5/225 (2%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFA 73
           +L +R+ LVTG+  GIG   A++ A  GA VI  G+++S+LE + + ++ +   +  I  
Sbjct: 9   SLKDRVILVTGAGDGIGREAAIQYAAHGATVILLGKTVSKLEAVYDEIEDLGYIQPAIIP 68

Query: 74  FDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
            DL  +   + L++  T I +++G+LD ++ NAGILG +SP+ QI+E +F DV+ VNV A
Sbjct: 69  LDLMGATKQHYLDMVDT-IEQQFGRLDGVLHNAGILGVLSPLEQIEESTFDDVMQVNVKA 127

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            + + ++  P++KKS  GR I  SS   +  R  WG+Y+ SK A E + +  + E  NT 
Sbjct: 128 QFLLTQAVIPFIKKSPDGRIIFTSSTVGHSGRAFWGSYAISKFATEGMMQVLADELSNTN 187

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           ++V  I+PG TRT MRAKA PAED   +  P+ +  +  +L   +
Sbjct: 188 VQVNAINPGGTRTGMRAKAFPAEDAKQLKTPKDIIPLYVYLMGPE 232


>gi|85374231|ref|YP_458293.1| oxidoreductase [Erythrobacter litoralis HTCC2594]
 gi|84787314|gb|ABC63496.1| probable oxidoreductase [Erythrobacter litoralis HTCC2594]
          Length = 237

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 128/213 (60%), Gaps = 1/213 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  ++ALVTG+S+GIG  TA  L  +GA+VI   R +  LE++++A+        I   
Sbjct: 6   SLSGKIALVTGASKGIGAATAKALGAAGAHVILTARDVRGLEEVEDAIHDAGSSSTIAPV 65

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL +++ +    + +A RW  LDIL+ +A  L  ++P+ QI +K F   +++NV+A   +
Sbjct: 66  DLTETDGVARLASAVAGRWDALDILVISAAYLPHLTPVTQIDQKQFNQALTINVLATQAL 125

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRV 193
           + +FDP LK++  GR I L+S      R  W AY +SKAA + L  ++++E      +RV
Sbjct: 126 LANFDPLLKRAEAGRVIGLTSSVGATPRAFWSAYGSSKAAFDNLLDSYAQEVEKVGNIRV 185

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAK 226
             +DPG TRT MRAKA P EDP TV  P +VA+
Sbjct: 186 AIVDPGATRTQMRAKAYPGEDPKTVKSPDEVAE 218


>gi|144899030|emb|CAM75894.1| short-chain dehydrogenase/reductase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 243

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 84/217 (38%), Positives = 123/217 (56%), Gaps = 7/217 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-----KID 70
           L  R+ALVTG+SRGIG   A   A  GA VI   R+   LE+L + +    K     K  
Sbjct: 5   LQGRVALVTGASRGIGRAVAKRFAAEGAEVICVARTQGALEELDDEIANAAKEGGGGKAV 64

Query: 71  IFAFDLRDSNALELTKTYIAKRWGKLDILIANAG-ILGSISPIWQIKEKSFADVISVNVM 129
           +   +LR+ + ++     + +R+G+LDIL+ NAG I G ++PI  + +K F +   VNV 
Sbjct: 65  LCPLNLREFDKIDQVAAALYQRFGRLDILVGNAGDIGGGLAPIGHVDQKHFQEAFDVNVT 124

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           AN+ ++R+F P LK S  G A+ ++S  A+   P WG Y+A KAA+E++  TW+ E  N 
Sbjct: 125 ANYRLIRAFAPLLKASDHGPAVFVTSDVAHANMPYWGVYAAGKAALESIVLTWAAEIANI 184

Query: 190 A-LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVA 225
           + ++   IDPG   T MR  A P ED  T+  P  VA
Sbjct: 185 SNIKANLIDPGAVATRMRTIAFPGEDAATLAQPDDVA 221


>gi|269102961|ref|ZP_06155658.1| short chain dehydrogenase [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268162859|gb|EEZ41355.1| short chain dehydrogenase [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 253

 Score =  151 bits (382), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 133/224 (59%), Gaps = 5/224 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L +R+ LVTG+  GIG   A++ A  GA VI  GR++++LE + + +++       I   
Sbjct: 10  LKDRVILVTGAGDGIGREAAMQYAAHGATVILLGRTVAKLEAVYDEIEQQGFPTPAIIPM 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL  +   N  ++  T I +++G+LD ++ +AG+LG +SP  QI E SF DV+ VNV A 
Sbjct: 70  DLLGATKQNYQDMADT-IKQQFGRLDGVLHSAGLLGVLSPFDQIDEASFDDVMKVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P LK++  GR I  SS   +  R  WG+Y+ SK A E + +  + E  NT +
Sbjct: 129 FLMTQALLPLLKQASDGRIIFTSSTVGHIGRAFWGSYAISKFATEGMMQVLADELTNTNV 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           +V  I+PG TRT MRA+A PAEDPN +  P+ +  +  +L A +
Sbjct: 189 KVNAINPGGTRTGMRAQAFPAEDPNQLKTPKDIMPLYLYLMAPE 232


>gi|330445594|ref|ZP_08309246.1| putative oxidoreductase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489785|dbj|GAA03743.1| putative oxidoreductase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 257

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 136/225 (60%), Gaps = 5/225 (2%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFA 73
           +L +R+ LVTG+S GIG   A++ A  GA VI  GR++++LE + + ++ +   +  I  
Sbjct: 9   SLKDRVILVTGASDGIGREAAIQYAAHGATVILLGRTVAKLEAVYDEIEALGYIQPAIIP 68

Query: 74  FDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
            DL  +   + L++  T I +++G+LD ++ NAG+LG +SP+ QI+E +F DV+ VNV A
Sbjct: 69  LDLMGATKQHYLDMVDT-IEQQFGRLDGVLHNAGLLGVLSPLEQIEESTFDDVMQVNVKA 127

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            + + ++  P +KK+  GR +  SS   +  R  WG+Y+ SK A E + +  + E  NT 
Sbjct: 128 QFLLTQAIIPLIKKAPDGRIVFTSSTVGHSGRAFWGSYAISKFATEGMMQVLADELSNTN 187

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           ++V  I+PG TRT MRA+A PAED   +  P+ +  +  +L   +
Sbjct: 188 VKVNAINPGGTRTGMRAQAFPAEDVTQLKTPKDIMPLYLYLMGPE 232


>gi|37679481|ref|NP_934090.1| short chain dehydrogenase [Vibrio vulnificus YJ016]
 gi|37198225|dbj|BAC94061.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           vulnificus YJ016]
          Length = 250

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 126/210 (60%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 13  LKDKVILVTGAGAGIGRQAALSYAKHGATVILLGRNVKNLESVYDEIEASGYPQAAIIPL 72

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++++T I  ++G+LD L+ NAG+LG++SP  QI E+ F D++ +NV + 
Sbjct: 73  DLKGATKQNYIDMSET-IEGQFGRLDGLLHNAGVLGTLSPFDQISEEDFDDILQINVKSE 131

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L+K+  GR I  SS   +  R  WG Y+ SK A+E + +  + E  N+ +
Sbjct: 132 FLMTQALLPLLRKAQAGRIIFTSSTVGHSGRAFWGTYAISKFAVEGMMQILADEFSNSPI 191

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG TRT MR KA P ED NT+  P
Sbjct: 192 RVNAINPGATRTRMREKAYPGEDANTLKTP 221


>gi|27366260|ref|NP_761788.1| putative oxoacyl-(acyl carrier protein) reductase [Vibrio
           vulnificus CMCP6]
 gi|27362461|gb|AAO11315.1| Oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           vulnificus CMCP6]
          Length = 247

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 126/210 (60%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKDKVILVTGAGAGIGRQAALTYAKHGATVILLGRNVKNLESVYDEIEASGYPQAAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++++T I  ++G+LD L+ NAG+LG++SP  QI E+ F D++ +NV + 
Sbjct: 70  DLKGATKQNYIDMSET-IEGQFGRLDGLLHNAGVLGTLSPFDQISEEDFDDILQINVKSE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L+K+  GR I  SS   +  R  WG Y+ SK A+E + +  + E  N+ +
Sbjct: 129 FLMTQALLPLLRKAQAGRIIFTSSTVGHSGRAFWGTYAISKFAVEGMMQILADEFSNSPI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG TRT MR KA P ED NT+  P
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTLKTP 218


>gi|262276078|ref|ZP_06053887.1| oxidoreductase short-chain dehydrogenase/reductase family
           [Grimontia hollisae CIP 101886]
 gi|262219886|gb|EEY71202.1| oxidoreductase short-chain dehydrogenase/reductase family
           [Grimontia hollisae CIP 101886]
          Length = 247

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/224 (36%), Positives = 132/224 (58%), Gaps = 5/224 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ ++ LVTG+  GIG+  AL  A+ GA VI  GR++ +LE + + ++     +  I   
Sbjct: 10  LNGKVILVTGAGDGIGHQAALSYAQHGATVILLGRTVKKLESVYDEIEAAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D+  +   + L++  T I +++GKLD ++ NAG+LG +SP  QI+EK++ DV+ VNV A 
Sbjct: 70  DMLGAIRQHYLDMADT-IEQQFGKLDGVLHNAGMLGVLSPFDQIEEKAYDDVMQVNVKAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P ++KS  GR +  SS   +  R  WG Y+ SK A E + +  + E  NT +
Sbjct: 129 FLMTQALLPLIQKSDDGRIVFTSSTVGHSGRAFWGTYAISKFATEGMMQVLADELSNTRV 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           +V  I+PG TRT MRA A PAED N +  P  +  +  +L A +
Sbjct: 189 KVNAINPGGTRTKMRASAFPAEDANNLKTPLDIMPLYLYLMAPE 232


>gi|307292890|ref|ZP_07572736.1| short-chain dehydrogenase/reductase SDR [Sphingobium
           chlorophenolicum L-1]
 gi|306880956|gb|EFN12172.1| short-chain dehydrogenase/reductase SDR [Sphingobium
           chlorophenolicum L-1]
          Length = 236

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 127/214 (59%), Gaps = 1/214 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  +LALVTG+SRGIG  TA  LA +GA+VI   R+   LE++++ + +      I   D
Sbjct: 6   LSGKLALVTGASRGIGAATAEALAAAGAHVILTARTNGGLEEVEDRIHQAGGSATIAPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D  ++      I+ RW  LDIL+ NA  LGS++ +  I  K FA ++++NV A   ++
Sbjct: 66  LIDGESIGRLAHAISGRWQALDILVLNAATLGSLASVPAIDAKEFARLLTLNVAAPQALI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRVI 194
            +FD  L+ S   R + L+S    + R  WGAY ASKAA+E L  T+ +E  N +A+R  
Sbjct: 126 AAFDGMLRASGDARVVALTSSVGAQPRAYWGAYGASKAALETLVSTYGEEVKNISAIRTH 185

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKII 228
            +DPG TRT+MRA+A P EDP T+  P  V + I
Sbjct: 186 IVDPGATRTAMRARAFPGEDPATLKEPAVVGQAI 219


>gi|320156769|ref|YP_004189148.1| putative oxidoreductase [Vibrio vulnificus MO6-24/O]
 gi|319932081|gb|ADV86945.1| putative oxidoreductase [Vibrio vulnificus MO6-24/O]
          Length = 247

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 125/210 (59%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKDKVILVTGAGAGIGRQAALTYAKHGATVILLGRNVKNLESVYDEIEASGYPQAAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+LG++SP  QI E+ F D++ +NV + 
Sbjct: 70  DLKGATKQNYIDMAET-IEGQFGRLDGLLHNAGVLGTLSPFDQISEEDFDDILQINVKSE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L+K+  GR I  SS   +  R  WG Y+ SK A+E + +  + E  N+ +
Sbjct: 129 FLMTQALLPLLRKAQAGRIIFTSSTVGHSGRAFWGTYAISKFAVEGMMQILADEFSNSPI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG TRT MR KA P ED NT+  P
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTLKTP 218


>gi|328474634|gb|EGF45439.1| putative oxoacyl-(acyl carrier protein) reductase [Vibrio
           parahaemolyticus 10329]
          Length = 248

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 124/213 (58%), Gaps = 5/213 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ ++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LEGKVILVTGAGNGIGRQAALSYAKHGATVILLGRNVKNLESIYDEIEAAGYPQAAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+L ++ P  QI E+ F D++ +NV A 
Sbjct: 70  DLKGATKQNYIDMAET-IEGQFGQLDGLLHNAGVLSALCPFEQINEEDFDDIMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++KS  GR I  SS   +  R  WG Y+ SK A+E + +  + E  +T +
Sbjct: 129 VLMTQALLPVMRKSEAGRIIFTSSTVGHSGRAFWGPYAISKFAVEGMMQVLADELSDTPM 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           RV  I+PG TRT MR KA P ED NT+  PQ +
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTLKTPQDI 221


>gi|149191856|ref|ZP_01870091.1| short chain dehydrogenase [Vibrio shilonii AK1]
 gi|148834291|gb|EDL51293.1| short chain dehydrogenase [Vibrio shilonii AK1]
          Length = 250

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 124/213 (58%), Gaps = 5/213 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A  GA VI  GR++  LE L + ++     +  I   
Sbjct: 10  LKGKVILVTGAGAGIGRQAALSYAEHGATVILLGRNVKNLEYLYDEIENAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++GKLD ++ NA +LG++SP  QI E++F DV+ +NV + 
Sbjct: 70  DLKGATKQNYIDMAET-IEGQFGKLDGILHNASVLGTLSPFDQIDEETFDDVMKINVKSE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P LKK+  GR I  SS   +  R  WG Y+ SK A E + +  + E  +T +
Sbjct: 129 FLMTQALLPALKKAEAGRVIFTSSTVGHSGRAFWGTYAISKFATEGMMQILADELSDTEI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           RV  I+PG TRT MR KA P ED NT+  P+ +
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTLKTPKDI 221


>gi|294011741|ref|YP_003545201.1| SDR-family protein [Sphingobium japonicum UT26S]
 gi|292675071|dbj|BAI96589.1| SDR-family protein [Sphingobium japonicum UT26S]
          Length = 236

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 126/214 (58%), Gaps = 1/214 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  +LALVTG+SRGIG  TA  LA +GA+VI   R+   LE++++ + +      I   D
Sbjct: 6   LSGKLALVTGASRGIGAATAEALAAAGAHVILTARTTGGLEEVEDRIHEAGGHATIAPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D  ++      I+ RW  LDIL+ NA  LGS++ +  I  K FA ++++NV A   ++
Sbjct: 66  LIDGESIGRLAHAISGRWQALDILVLNAATLGSLASVPAIDAKEFARLLTLNVAAPQALI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRVI 194
            +FD  L+ S   R + ++S    + R  WGAY ASKAA+E L   + +E  N +A+R  
Sbjct: 126 AAFDGMLRASGDARVVAITSSVGAQPRAYWGAYGASKAALETLVGAYGEEVKNISAIRTH 185

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKII 228
            +DPG TRT+MRA+A P EDP T+  P  V + I
Sbjct: 186 IVDPGATRTAMRARAFPGEDPATLKEPAVVGRAI 219


>gi|326387641|ref|ZP_08209247.1| short-chain dehydrogenase/reductase SDR [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207687|gb|EGD58498.1| short-chain dehydrogenase/reductase SDR [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 241

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 87/219 (39%), Positives = 130/219 (59%), Gaps = 1/219 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++ALVTG+SRGIG  TA  LA +GA+VI   R+   LE ++ ++        I   D
Sbjct: 8   LSGQVALVTGASRGIGAATAKALAAAGAHVILVARTARDLEAVEQSIFDAGGSATIAPAD 67

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L + +++    T +A+RW  LDIL+ NA +L  ++P+WQI+ +     + +NV A   ++
Sbjct: 68  LAEPDSIARLATALAERWEALDILVINAAVLPVLTPVWQIEPRDLNRALVLNVAATQALI 127

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRVI 194
            +F P LKKS   R I ++S      R  WGAY A+KAA + L  ++++E    +A+RV 
Sbjct: 128 AAFHPLLKKSKGARVIGVTSSVGANPRAYWGAYGATKAAFDNLLDSYAQEVRGISAIRVA 187

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            +DPG TRT MRAKA P EDP +V  P+ VA  I+ L +
Sbjct: 188 ILDPGATRTGMRAKAYPGEDPESVKAPEVVADRITALAS 226


>gi|312882441|ref|ZP_07742182.1| short chain dehydrogenase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369841|gb|EFP97352.1| short chain dehydrogenase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 246

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 130/227 (57%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L +++ LVTG+  GIG   AL  A+ GA VI  GR++ +LE+  + ++     +  I   
Sbjct: 10  LKDKVILVTGAGDGIGKQAALSYAQYGATVILLGRTVKKLEQTYDEIESFGGPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N  ++ +T I  ++G+LD ++ NA +LG ISP  QI E +F DV+ VNV A 
Sbjct: 70  DMKGASKKNYQDMAET-IEGQYGRLDGVLHNASLLGVISPFDQISEDTFDDVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P + KS  GR I  SS   +  R LWG+Y+ SK A E + +  + E  NT +
Sbjct: 129 FLMTQALLPVIHKSKDGRIIFTSSTVGHSGRALWGSYAISKFATEGMMQILADELSNTNI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT MRAKA PAED   +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTGMRAKAYPAEDSQQLKTPLDIMPLYLYLMAPEGRE 235


>gi|148553503|ref|YP_001261085.1| short-chain dehydrogenase/reductase SDR [Sphingomonas wittichii
           RW1]
 gi|148498693|gb|ABQ66947.1| short-chain dehydrogenase/reductase SDR [Sphingomonas wittichii
           RW1]
          Length = 236

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 130/226 (57%), Gaps = 2/226 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
              +LALVTG+SRGIG  TA  L  +GA+VI   R+   LE+++  +        I   D
Sbjct: 5   FSGKLALVTGASRGIGAATAEALGAAGAHVILTARTSGGLEEVEERIHAAGGSATIAPLD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L +++++      I  RW  LDIL+ NA +LG+++P+  I  K FA ++++N+MA   ++
Sbjct: 65  LAENDSIARLAEAIGGRWQALDILVLNAAMLGTLAPVPAIDAKEFARLLTLNIMAQQQLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRVI 194
            +FDP L+ S  GR I L+S  A   R  WGAY ASKAA+E L   +++E    + +RV 
Sbjct: 125 AAFDPMLRASAAGRVIGLTSTVAQAPRAYWGAYGASKAALETLLLAYAEEVGKISPIRVA 184

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG 240
            ++PG T T+MR KA P ED  T+  P  V   +  L A Q  ETG
Sbjct: 185 VVNPGATATAMRQKAYPGEDQTTLRSPANVGAALVELIA-QDFETG 229


>gi|85708824|ref|ZP_01039890.1| probable oxidoreductase [Erythrobacter sp. NAP1]
 gi|85690358|gb|EAQ30361.1| probable oxidoreductase [Erythrobacter sp. NAP1]
          Length = 237

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 88/226 (38%), Positives = 128/226 (56%), Gaps = 2/226 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R ALVTG+S+GIG  TA+ LA +GA+VI   R +  LE +++ +        I   D
Sbjct: 7   LAGRTALVTGASKGIGAATAIALAEAGAHVILTARKVKALEAIEDRIHDAGGTSTIAPVD 66

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L + +A+    + IA RW  LD+L+ +A  L  ++P+ QI  K F   I  NV+A   ++
Sbjct: 67  LTEPDAISRLASAIAGRWETLDVLVISAAYLPELTPLPQIDPKQFNTAIMTNVVATQALL 126

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRVI 194
            +FDP L+++  GR I L+S      R  W AY ++KAA + L  +++ E    + LRV 
Sbjct: 127 AAFDPLLRRAEAGRIIGLTSSVGANPRSFWSAYGSTKAAFDNLLDSYAAEVEKLSPLRVA 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG 240
            +DPG TRT MRA+A P E P +V  P+ VAK I  L A +   TG
Sbjct: 187 IVDPGATRTDMRARAYPGEKPESVKPPEVVAKRIIALLA-EDFTTG 231


>gi|91228569|ref|ZP_01262489.1| short chain dehydrogenase [Vibrio alginolyticus 12G01]
 gi|91187893|gb|EAS74205.1| short chain dehydrogenase [Vibrio alginolyticus 12G01]
          Length = 248

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 121/210 (57%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A  GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKGKVILVTGAGNGIGRQAALSYAEHGATVILLGRNVQNLESIYDEIEAAGYPQAAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+L S+ P  QIKE+ F D++ +NV A 
Sbjct: 70  DLKGATQQNYIDMAET-IEGQFGRLDGLLHNAGVLSSLCPFDQIKEEDFDDIMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++KS  GR I  SS   +  R  WG Y+ SK A+E + +  + E  +T +
Sbjct: 129 VLMTQALLPVMRKSEAGRIIFTSSTVGHSGRAFWGPYAISKFAVEGMMQVLADELSDTPI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG TRT MR KA P ED NT+  P
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTLKTP 218


>gi|254230316|ref|ZP_04923704.1| oxidoreductase, short chain dehydrogenase/reductase family [Vibrio
           sp. Ex25]
 gi|262393790|ref|YP_003285644.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           sp. Ex25]
 gi|151937176|gb|EDN56046.1| oxidoreductase, short chain dehydrogenase/reductase family [Vibrio
           sp. Ex25]
 gi|262337384|gb|ACY51179.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           sp. Ex25]
          Length = 248

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 121/210 (57%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A  GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKGKVILVTGAGNGIGRQAALSYAEHGATVILLGRNVQNLESIYDEIEAAGYPQAAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+L S+ P  QIKE+ F D++ +NV A 
Sbjct: 70  DLKGATKQNYIDMAET-IEGQFGRLDGLLHNAGVLSSLCPFDQIKEEDFDDIMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++KS  GR I  SS   +  R  WG Y+ SK A+E + +  + E  +T +
Sbjct: 129 VLMTQALLPVMRKSEAGRIIFTSSTVGHSGRAFWGPYAISKFAVEGMMQVLADELSDTPI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG TRT MR KA P ED NT+  P
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTLKTP 218


>gi|149911385|ref|ZP_01900004.1| short chain dehydrogenase [Moritella sp. PE36]
 gi|149805560|gb|EDM65564.1| short chain dehydrogenase [Moritella sp. PE36]
          Length = 247

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 130/239 (54%), Gaps = 6/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L+N+  LVTG+  GIG   AL  A  GA VI  G+++++LE + + ++ +      I   
Sbjct: 10  LENKTILVTGAGDGIGRQAALTYAAHGATVILLGKTVAKLEAVYDEIEALGAPTPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N  ++  T I  ++GKLD L+ NAG LG + P  QI EKS+ +V+ VNV A 
Sbjct: 70  DMKGATVANYKDMADT-IDTQFGKLDGLLNNAGQLGVLGPFHQIDEKSYDEVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             +  +  P LKK+     I  SS    K R  W  Y+ SK A E + +T + E  NT++
Sbjct: 129 LFMTSALLPVLKKADKASIIFTSSSVGVKGRAYWAEYAISKFATEGMMQTLADEFENTSI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLFSVPQNR 249
           R   I+PG TRT MRAKA P E+ NT+   + +  +  +L     + ETGK F    NR
Sbjct: 189 RANCINPGATRTGMRAKAFPGENANTLATAEDIMPLYLYLMGNDSVAETGKTFKAQPNR 247


>gi|269966536|ref|ZP_06180619.1| short chain dehydrogenase [Vibrio alginolyticus 40B]
 gi|269828880|gb|EEZ83131.1| short chain dehydrogenase [Vibrio alginolyticus 40B]
          Length = 248

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 121/210 (57%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A  GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKGKVILVTGAGNGIGRQAALSYAEHGATVILLGRNVQNLESIYDEIEAAGYPQAAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+L S+ P  QIKE+ F D++ +NV A 
Sbjct: 70  DLKGATQQNYIDMAET-IEGQFGRLDGLLHNAGVLSSLCPFDQIKEEDFDDIMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++KS  GR I  SS   +  R  WG Y+ SK A+E + +  + E  +T +
Sbjct: 129 VLMTQALLPVMRKSEAGRIIFTSSTVGHSGRAFWGPYAISKFAVEGMMQVLADELNDTPI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG TRT MR KA P ED NT+  P
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTLKTP 218


>gi|28898807|ref|NP_798412.1| short chain dehydrogenase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838847|ref|ZP_01991514.1| oxidoreductase, short chain dehydrogenase/reductase family [Vibrio
           parahaemolyticus AQ3810]
 gi|260898466|ref|ZP_05906962.1| oxidoreductase, short chain dehydrogenase/reductase family [Vibrio
           parahaemolyticus Peru-466]
 gi|260899602|ref|ZP_05907997.1| oxidoreductase, short chain dehydrogenase/reductase family [Vibrio
           parahaemolyticus AQ4037]
 gi|28807026|dbj|BAC60296.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149747731|gb|EDM58631.1| oxidoreductase, short chain dehydrogenase/reductase family [Vibrio
           parahaemolyticus AQ3810]
 gi|308089018|gb|EFO38713.1| oxidoreductase, short chain dehydrogenase/reductase family [Vibrio
           parahaemolyticus Peru-466]
 gi|308106898|gb|EFO44438.1| oxidoreductase, short chain dehydrogenase/reductase family [Vibrio
           parahaemolyticus AQ4037]
          Length = 248

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 122/210 (58%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ ++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LEGKVILVTGAGNGIGRQAALSYAKHGATVILLGRNVKNLESIYDEIEAAGYPQAAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+L ++ P  QI E+ F D++ +NV A 
Sbjct: 70  DLKGATKQNYIDMAET-IEGQFGQLDGLLHNAGVLSALCPFEQINEEDFDDIMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++KS  GR I  SS   +  R  WG Y+ SK A+E + +  + E  +T +
Sbjct: 129 VLMTQALLPVMRKSEAGRIIFTSSTVGHSGRAFWGPYAISKFAVEGMMQVLADELSDTPM 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG TRT MR KA P ED NT+  P
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTLKTP 218


>gi|209694709|ref|YP_002262637.1| short chain dehydrogenase [Aliivibrio salmonicida LFI1238]
 gi|208008660|emb|CAQ78845.1| putative NAD-or NADP-dependent oxidoreductase [Aliivibrio
           salmonicida LFI1238]
          Length = 246

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 81/226 (35%), Positives = 131/226 (57%), Gaps = 5/226 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L N+  LVTG+  GIG   AL  A+ GA VI  GR++++LE + + ++        I   
Sbjct: 10  LKNKTILVTGAGDGIGKQAALSYAKHGATVILLGRTVAKLEAVYDEIETAGYPTPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   + +++ +T I  ++GKLD L+ NAG+LG +SP  Q +E  F +V+ +NV A 
Sbjct: 70  DLKGAKKQHYIDMAET-IQSQFGKLDGLLHNAGLLGILSPFEQFEESIFDEVMQINVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L+KS   R I  +S   ++ R  WGAY+ SK A E + +T + E   T +
Sbjct: 129 FLMTQALLPVLQKSDDSRIIFTTSTVGHQGRAFWGAYAISKFATEGMMQTLAHEMEGTHV 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
           +V  I+PG T T MRA+A PAED + +  P+ +  +  +L A + I
Sbjct: 189 KVNAINPGGTHTRMRAQAFPAEDISLLKTPEDLMPLYVYLMAPESI 234


>gi|197334466|ref|YP_002155842.1| KR domain superfamily protein [Vibrio fischeri MJ11]
 gi|197315956|gb|ACH65403.1| KR domain superfamily protein [Vibrio fischeri MJ11]
          Length = 246

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 132/226 (58%), Gaps = 5/226 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L N++ LVTG+  GIG   AL  A+ GA VI  GR++++LE + + ++        I   
Sbjct: 10  LKNKVILVTGAGDGIGKQAALHYAQHGATVILLGRTVAKLEAVYDEIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   + +++ +T I  ++GKLD L+ NAG+LG +SP  Q +E  F +V+ +NV A 
Sbjct: 70  DLKGATKQHYVDMAET-IQSQFGKLDGLLHNAGLLGMLSPFEQFEESIFDEVMQINVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L++S   R I  +S   ++ R  WGAY+ SK A E + +T + E   T +
Sbjct: 129 FLMTQALLPVLQQSDDARIIFTTSTVGHQGRAFWGAYAISKFATEGMMQTLAHEMEGTTV 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
           +V  I+PG T T MRA+A PAED + +  P+ +  +  +L A + +
Sbjct: 189 KVNAINPGGTHTRMRAQAFPAEDISLLKTPKDIMPLYVYLMAPEGV 234


>gi|94498266|ref|ZP_01304826.1| short-chain dehydrogenase/reductase SDR [Sphingomonas sp. SKA58]
 gi|94422268|gb|EAT07309.1| short-chain dehydrogenase/reductase SDR [Sphingomonas sp. SKA58]
          Length = 237

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 87/218 (39%), Positives = 125/218 (57%), Gaps = 1/218 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  +LALVTG+SRGIG  TA  LA +GA+VI   R+   LE+++  +        I   D
Sbjct: 6   LTGKLALVTGASRGIGAATAEALATAGAHVILTARTPGALEEVEERIHATGGSATIAPLD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D +++      I  RW  LDI++ NA  LGS++ +  I  K FA ++++N+ A   ++
Sbjct: 66  LIDGDSVGRLAQAIGGRWSALDIMVLNAATLGSLAAVQAIDAKEFARLLTLNIAAPQALI 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRVI 194
            +FD  L+ S   R + L+S      R  WGAY ASKAA+E L   + +E  N +A+R  
Sbjct: 126 AAFDSMLRASSDARVVALTSSVGTAPRAYWGAYGASKAALETLIGAYGEEVRNISAIRTH 185

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
            +DPG TRT+MRA+A P EDP T+  P+ VA  I  L 
Sbjct: 186 IVDPGATRTAMRARAYPGEDPATLKGPETVADAIVDLV 223


>gi|162149274|ref|YP_001603735.1| short-chain dehydrogenase/reductase protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209544994|ref|YP_002277223.1| short-chain dehydrogenase/reductase SDR [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787851|emb|CAP57449.1| putative short-chain dehydrogenase/reductase protein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532671|gb|ACI52608.1| short-chain dehydrogenase/reductase SDR [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 239

 Score =  145 bits (365), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 82/224 (36%), Positives = 131/224 (58%), Gaps = 2/224 (0%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK-INKKIDIFAFDLRD 78
           +ALVTG+SRGIG  TAL LA  GA+ I   R+   LE+  + +++   ++  +   DLRD
Sbjct: 11  VALVTGASRGIGRATALALAAGGAHCILTARTPGGLEETDDLIERRTGRRATLLPLDLRD 70

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
            +A++     IA R+G+LD+L+  A +LG ++P+  +++  +   ++VN  A W ++R+ 
Sbjct: 71  GDAIDTLGPSIAARFGRLDVLVHCAAMLGVLTPVTHMRDADWTATLAVNATAAWRMIRTT 130

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV-NTALRVINID 197
            P L+++  GRA+ L+ G A      WG  +ASKAA+EA+  TW+ E    + LRV   D
Sbjct: 131 APLLERAPAGRAVFLTDGHATHPASFWGMMAASKAAMEAVVLTWADEIAPGSPLRVNLYD 190

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGK 241
           PGP  T +R +AMPA D + +P P      I+ LC   +   G+
Sbjct: 191 PGPVATRLRVQAMPAADLSALPRPDAAGAAIAALCRPDETRHGQ 234


>gi|114563738|ref|YP_751251.1| short chain dehydrogenase [Shewanella frigidimarina NCIMB 400]
 gi|114335031|gb|ABI72413.1| short-chain dehydrogenase/reductase SDR [Shewanella frigidimarina
           NCIMB 400]
          Length = 245

 Score =  145 bits (365), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 128/228 (56%), Gaps = 5/228 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+N+  LVTG+  GIG   ++E A+ GA VI  G+++ +LE + + +      K  I   
Sbjct: 11  LNNKTILVTGAGDGIGRAASIEFAKHGATVILLGKTVKKLENVYDEIVNAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++   + N +++  T IA+++G LD L+ NA  LG++ P   I   S   ++ VNV A 
Sbjct: 71  DMKGATEQNYIDMADT-IAEQFGHLDGLLHNASQLGALGPFEHIDLTSLETILKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + +S  P ++K+     +  SSG   K R  WG Y+ SK A E + +  + E  NT++
Sbjct: 130 AIMTKSLLPIMRKAEHASIVFTSSGVGRKGRAYWGPYAFSKFATEGMMQVLADECDNTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIET 239
           RV +I+PG TRT MRAKA PAEDP T+   +++     FL   + I+T
Sbjct: 190 RVNSINPGATRTEMRAKAYPAEDPQTLKTAEQIMPTYLFLMGNESIDT 237


>gi|59711646|ref|YP_204422.1| short chain dehydrogenase [Vibrio fischeri ES114]
 gi|59479747|gb|AAW85534.1| predicted oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC
           system [Vibrio fischeri ES114]
          Length = 246

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 78/226 (34%), Positives = 132/226 (58%), Gaps = 5/226 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L N++ LVTG+  GIG   AL  A+ GA VI  GR++++LE + + ++        I   
Sbjct: 10  LKNKVILVTGAGDGIGKQAALHYAQHGATVILLGRTVAKLEAVYDEIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   + +++ +T I  ++GKLD L+ NAG+LG +SP  Q +E  F +V+ +NV A 
Sbjct: 70  DLKGATKQHYVDMAET-IQSQFGKLDGLLHNAGLLGMLSPFEQFEESIFDEVMQINVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L++S   R +  +S   ++ R  WGAY+ SK A E + +T + E   T +
Sbjct: 129 FLMTQALLPVLQQSDDARIVFTTSTVGHQGRAFWGAYAISKFATEGMMQTLAHEMEGTTV 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
           +V  I+PG T T MRA+A PAED + +  P+ +  +  +L A + +
Sbjct: 189 KVNAINPGGTHTRMRAQAFPAEDISLLKTPKDIMPLYVYLMAPEGV 234


>gi|56460148|ref|YP_155429.1| short chain dehydrogenase [Idiomarina loihiensis L2TR]
 gi|56179158|gb|AAV81880.1| Short chain dehydrogenase family protein [Idiomarina loihiensis
           L2TR]
          Length = 250

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 84/230 (36%), Positives = 128/230 (55%), Gaps = 3/230 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L N++ LVTG+  GIG   AL  A  GA VI  GR++S+LE + + +  + + +  I   
Sbjct: 16  LKNKVILVTGAGDGIGRQAALSYAEHGATVILLGRTVSKLESVYDEIIAQESPQPAIIPL 75

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL+ +  N        IA ++GKLD ++ NAG+LG +SP   I++ S+ D++ VNV   +
Sbjct: 76  DLKGATENHYRDMAATIADQFGKLDGVLHNAGLLGILSPFTHIEKDSWDDIMQVNVTGQF 135

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P ++KS     +  SSG   K R  WG YS SK A E +A+  + E  +T LR
Sbjct: 136 AMTQALIPVMEKSPNASLVFTSSGVGRKGRAFWGPYSVSKFATEGMAQVIADEYEDTKLR 195

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKL 242
              I+PG TRT+MRAKA PAED  ++  P+ +     +L +   I    L
Sbjct: 196 TNVINPGATRTAMRAKAYPAEDAKSLKTPKDLMPTYLYLMSDDSISDNGL 245


>gi|84393897|ref|ZP_00992640.1| short chain dehydrogenase [Vibrio splendidus 12B01]
 gi|84375494|gb|EAP92398.1| short chain dehydrogenase [Vibrio splendidus 12B01]
          Length = 246

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 124/210 (59%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKDKVILVTGAGAGIGRQAALSFAQHGATVILLGRNVKNLEFIYDEIESAGYPQAAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+LG++SP  QI E++F  V+ +NV A 
Sbjct: 70  DLKGATKQNYIDMAET-IESQFGRLDGLLHNAGVLGTLSPFDQIDEETFDGVMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P +KK+  GR +  SS   +  R  WG Y+ SK A E + +  + E  +T +
Sbjct: 129 FLMTQALLPVIKKAEAGRIVFTSSTVGHSGRAFWGTYAISKFATEGMMQILADELEDTNI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG T+T MRAKA P ED N +  P
Sbjct: 189 RVNAINPGGTQTRMRAKAYPGEDANKLKTP 218


>gi|148980526|ref|ZP_01816099.1| short chain dehydrogenase [Vibrionales bacterium SWAT-3]
 gi|145961179|gb|EDK26494.1| short chain dehydrogenase [Vibrionales bacterium SWAT-3]
          Length = 246

 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 125/213 (58%), Gaps = 5/213 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKDKVILVTGAGAGIGRQAALSFAQHGATVILLGRNVKNLEFIYDEIESAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+LG++SP  QI E++F DV+ +NV + 
Sbjct: 70  DLKGATKQNYIDMAET-IESQFGRLDGLLHNAGVLGTLSPFEQIDEETFDDVMQINVKSE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P LK +  GR +  SS   +  R  WG Y+ SK A E + +  + E  +T +
Sbjct: 129 FLMTQALLPALKIAEAGRIVFTSSTVGHSGRAFWGTYAISKFATEGMMQILADELEDTNI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           RV  I+PG T+T MRAKA P ED N +  P  +
Sbjct: 189 RVNAINPGGTQTRMRAKAYPGEDANKLKTPLDI 221


>gi|218709037|ref|YP_002416658.1| short chain dehydrogenase [Vibrio splendidus LGP32]
 gi|218322056|emb|CAV18115.1| Hypothetical oxidoreductase [Vibrio splendidus LGP32]
          Length = 258

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 124/210 (59%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 22  LKDKVILVTGAGAGIGRQAALSFAQHGATVILLGRNVKNLELIYDEIESAGYPQPAIIPL 81

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+LG++SP  QI E++F  V+ +NV A 
Sbjct: 82  DLKGATKQNYIDMAET-IESQFGRLDGLLHNAGVLGTLSPFDQIDEETFDGVMQINVKAE 140

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P +KK+  GR +  SS   +  R  WG Y+ SK A E + +  + E  +T +
Sbjct: 141 FLMTQALLPVIKKAEAGRIVFTSSTVGHSGRAFWGTYAISKFATEGMMQILADELEDTNI 200

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG T+T MRAKA P ED N +  P
Sbjct: 201 RVNAINPGGTQTRMRAKAYPGEDANKLKTP 230


>gi|308050239|ref|YP_003913805.1| short-chain dehydrogenase/reductase SDR [Ferrimonas balearica DSM
           9799]
 gi|307632429|gb|ADN76731.1| short-chain dehydrogenase/reductase SDR [Ferrimonas balearica DSM
           9799]
          Length = 248

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 120/207 (57%), Gaps = 5/207 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L +++ LVTG+  GIG   A + A  GA VI  GR++ +LE + +A+      +  I   
Sbjct: 11  LKDKVILVTGAGDGIGKEAACQFAAHGATVILLGRTVKKLEAVYDAIVAAGGPEPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D +   + N L+L  T I  ++G+LD L+ NA +LG++SP  Q+    FA+V+ VNV A 
Sbjct: 71  DAKGATEQNYLDLADT-IEGQFGRLDGLLHNAAVLGALSPFEQLGADMFAEVMQVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P LKK+  G  +  SSG   K R  WGAY+ SK A E +  T + E   T++
Sbjct: 130 FLMTKALLPVLKKAEHGSIVFTSSGVGRKGRAYWGAYAISKFATEGMMETLADELDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTV 218
           R   I+PG TRT MRA A PAEDP T+
Sbjct: 190 RANCINPGATRTGMRATAFPAEDPQTL 216


>gi|86148847|ref|ZP_01067108.1| short chain dehydrogenase [Vibrio sp. MED222]
 gi|85833364|gb|EAQ51561.1| short chain dehydrogenase [Vibrio sp. MED222]
          Length = 246

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 123/210 (58%), Gaps = 5/210 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKDKVILVTGAGAGIGRQAALSFAQHGATVILLGRNVKNLELIYDEIESAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N +++ +T I  ++G+LD L+ NAG+LG++SP  QI E++F  V+ +NV A 
Sbjct: 70  DLKGATKQNYIDMAET-IESQFGRLDGLLHNAGVLGTLSPFDQIDEETFDGVMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P +KK+  GR +  SS   +  R  WG Y+ SK A E + +  + E   T +
Sbjct: 129 FLMTQALLPVIKKAEAGRIVFTSSTVGHSGRAFWGTYAISKFATEGMMQILADELEGTDI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           RV  I+PG T+T MRAKA P ED N +  P
Sbjct: 189 RVNAINPGGTQTRMRAKAYPGEDANKLKTP 218


>gi|296114033|ref|YP_003627971.1| short-chain dehydrogenase/reductase SDR [Moraxella catarrhalis RH4]
 gi|295921727|gb|ADG62078.1| short-chain dehydrogenase/reductase SDR [Moraxella catarrhalis RH4]
 gi|326573719|gb|EGE23677.1| short chain dehydrogenase [Moraxella catarrhalis O35E]
          Length = 259

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 128/221 (57%), Gaps = 4/221 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFA 73
           +L +++ LVTG+  GIG   AL  A+ GA V+  G++ S+LE + + ++ +   +  I  
Sbjct: 19  SLKDKIILVTGAGDGIGKVAALTYAKCGATVLLLGKTQSKLEVVYDEIEALGLALPAILP 78

Query: 74  FDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            DL  ++  ++ K    I K +G LD ++ NA ILG+++P+      +F  V+ VN+ A 
Sbjct: 79  MDLERADFAQMQKLAGLIEKEFGHLDGVLHNAAILGTLTPLEMYDPITFEQVMRVNMTAV 138

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TA 190
           + + +S  P L+ +  G  +  SS    + R  WGAY+ SK A+E +A  +++ET N TA
Sbjct: 139 FMLTQSLIPLLRAAQSGSVVFTSSSVGARPRAFWGAYALSKQAVEGMATIFTQETQNMTA 198

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           LR   I+PG TRT+MRA A P EDP T+  P+ +  +  +L
Sbjct: 199 LRFNCINPGATRTNMRAHAFPGEDPYTLKTPEDIMPVYVYL 239


>gi|261253392|ref|ZP_05945965.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           orientalis CIP 102891]
 gi|260936783|gb|EEX92772.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           orientalis CIP 102891]
          Length = 247

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 126/224 (56%), Gaps = 5/224 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A+ GA VI  GR++ +LE+  + ++     +  I   
Sbjct: 10  LKGKVILVTGAGAGIGKQAALSYAQHGATVILLGRTVKKLEQTYDEIEAAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I  ++G+LD ++ NA +LG ISP  QI E +F D++ VNV A 
Sbjct: 70  DMKGATKQNYLDMVDT-IEGQFGRLDGVLHNASLLGVISPFDQIGEDNFDDIMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  SS   +  R  WG Y+ SK A E + +  + E  +T +
Sbjct: 129 FLLTQAVLPLLHKSEDARIVFTSSTVGHSGRAFWGTYAMSKFATEGMMQILADELSDTTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           RV  I+PG TRT MRAKA PAED + +  P  +  +  +L A +
Sbjct: 189 RVNAINPGATRTGMRAKAYPAEDADLLKTPLDIMPLYLYLMAPE 232


>gi|326559479|gb|EGE09902.1| short chain dehydrogenase [Moraxella catarrhalis 7169]
 gi|326566101|gb|EGE16258.1| short chain dehydrogenase [Moraxella catarrhalis BC1]
 gi|326568194|gb|EGE18276.1| short chain dehydrogenase [Moraxella catarrhalis BC8]
          Length = 259

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 128/221 (57%), Gaps = 4/221 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFA 73
           +L +++ LVTG+  GIG   AL  A+ GA V+  G++ S+LE + + ++ +   +  I  
Sbjct: 19  SLKDKIILVTGAGDGIGKVAALTYAKCGATVLLLGKTQSKLEVVYDEIEALGLALPAILP 78

Query: 74  FDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            DL  ++  ++ K    I K +G LD ++ NA ILG+++P+      +F  V+ VN+ A 
Sbjct: 79  MDLERADFAQMQKLAGLIEKEFGHLDGVLHNAAILGTLTPLEMYDPITFEQVMRVNMTAV 138

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TA 190
           + + +S  P L+ +  G  +  SS    + R  WGAY+ SK A+E +A  +++ET N TA
Sbjct: 139 FMLTQSLIPLLRAAQSGSVVFTSSSVGARPRAFWGAYALSKQAVEGMATIFTQETQNMTA 198

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           LR   I+PG TRT+MRA A P EDP T+  P+ +  +  +L
Sbjct: 199 LRFNCINPGATRTNMRAHAFPGEDPYTLKTPEDIMPVYVYL 239


>gi|326561259|gb|EGE11618.1| short chain dehydrogenase [Moraxella catarrhalis 46P47B1]
 gi|326565146|gb|EGE15337.1| short chain dehydrogenase [Moraxella catarrhalis 103P14B1]
 gi|326567804|gb|EGE17908.1| short chain dehydrogenase [Moraxella catarrhalis 12P80B1]
 gi|326572835|gb|EGE22820.1| short chain dehydrogenase [Moraxella catarrhalis CO72]
 gi|326574657|gb|EGE24593.1| short chain dehydrogenase [Moraxella catarrhalis 101P30B1]
          Length = 259

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 128/221 (57%), Gaps = 4/221 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFA 73
           +L +++ LVTG+  GIG   AL  A+ GA V+  G++ S+LE + + ++ +   +  I  
Sbjct: 19  SLKDKIILVTGAGDGIGKVAALTYAKCGATVLLLGKTQSKLEVVYDEIEALGLALPAILP 78

Query: 74  FDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            DL  ++  ++ K    I K +G LD ++ NA ILG+++P+      +F  V+ VN+ A 
Sbjct: 79  MDLERADFAQMQKLAGLIEKEFGHLDGVLHNAAILGALTPLEMYDPITFEQVMRVNMTAV 138

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TA 190
           + + +S  P L+ +  G  +  SS    + R  WGAY+ SK A+E +A  +++ET N TA
Sbjct: 139 FMLTQSLIPLLRAAQSGSVVFTSSSVGARPRAFWGAYALSKQAVEGMATIFTQETQNMTA 198

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           LR   I+PG TRT+MRA A P EDP T+  P+ +  +  +L
Sbjct: 199 LRFNCINPGATRTNMRAHAFPGEDPYTLKTPEDIMPVYVYL 239


>gi|326572169|gb|EGE22165.1| short chain dehydrogenase [Moraxella catarrhalis BC7]
          Length = 259

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 128/221 (57%), Gaps = 4/221 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFA 73
           +L +++ LVTG+  GIG   AL  A+ GA V+  G++ S+LE + + ++ +   +  I  
Sbjct: 19  SLKDKIILVTGAGDGIGKVAALTYAKCGATVLLLGKTQSKLEVVYDEIEALGLALPAILP 78

Query: 74  FDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            DL  ++  ++ K    I K +G LD ++ NA ILG+++P+      +F  V+ VN+ A 
Sbjct: 79  MDLERADFAQMQKLAGLIEKEFGHLDGVLHNAAILGALTPLEMYDPITFEQVMRVNMTAV 138

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TA 190
           + + +S  P L+ +  G  +  SS    + R  WGAY+ SK A+E +A  +++ET N TA
Sbjct: 139 FMLTQSLIPLLRAARSGSVVFTSSSVGARPRAFWGAYALSKQAVEGMATIFTQETQNMTA 198

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           LR   I+PG TRT+MRA A P EDP T+  P+ +  +  +L
Sbjct: 199 LRFNCINPGATRTNMRAHAFPGEDPYTLKTPEDIMPVYVYL 239


>gi|156975138|ref|YP_001446045.1| short chain dehydrogenase [Vibrio harveyi ATCC BAA-1116]
 gi|156526732|gb|ABU71818.1| hypothetical protein VIBHAR_02865 [Vibrio harveyi ATCC BAA-1116]
          Length = 248

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 120/207 (57%), Gaps = 5/207 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKGKVILVTGAGNGIGRQAALSYAQHGATVILLGRNVQNLESIYDEIESAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   + +++ +T I  ++G+LD L+ NAG+L ++ P  QI E+ F D++ +NV A 
Sbjct: 70  DLKGATKQHYIDMAET-IEGQFGRLDGLLHNAGVLSTLCPFEQINEEDFDDIMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             I ++  P ++KS  GR +  SS   +  R  WG Y+ SK A+E + +  + E  +T +
Sbjct: 129 VLITQALLPIMRKSDAGRIVFTSSTVGHSGRAFWGPYAISKFAVEGMMQVLADELSDTPM 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTV 218
           RV  I+PG TRT MR KA P ED NT+
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTL 215


>gi|269962019|ref|ZP_06176373.1| short chain dehydrogenase [Vibrio harveyi 1DA3]
 gi|269833103|gb|EEZ87208.1| short chain dehydrogenase [Vibrio harveyi 1DA3]
          Length = 248

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 122/213 (57%), Gaps = 5/213 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKGKVILVTGAGNGIGRQAALSYAQHGATVILLGRNVQNLESIYDEIESAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   + +++ +T I  ++G+LD L+ NAG+L ++ P  QI E+ F D++ +NV A 
Sbjct: 70  DLKGATKQHYIDMAET-IEGQFGRLDGLLHNAGVLSTLCPFEQINEEDFDDIMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++ S  GR I  SS   +  R  WG+Y+ SK A+E + +  + E  +T +
Sbjct: 129 VLMTQALLPIMRNSDAGRIIFTSSTVGHSGRAFWGSYAISKFAVEGMMQVLADELSDTPM 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           RV  I+PG TRT MR KA P ED NT+  P  +
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTLKTPLDI 221


>gi|153834871|ref|ZP_01987538.1| ATPase FliI/YscN [Vibrio harveyi HY01]
 gi|148868689|gb|EDL67768.1| ATPase FliI/YscN [Vibrio harveyi HY01]
          Length = 248

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 120/207 (57%), Gaps = 5/207 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A+ GA VI  GR++  LE + + ++     +  I   
Sbjct: 10  LKGKVILVTGAGNGIGRQAALSYAQHGATVILLGRNVQNLESIYDEIESAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   + +++ +T I  ++G+LD L+ NAG+L ++ P  QI E+ F D++ +NV A 
Sbjct: 70  DLKGATKQHYIDMAET-IEGQFGRLDGLLHNAGVLSTLCPFEQINEEDFDDIMQINVKAE 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++KS  GR +  SS   +  R  WG Y+ SK A+E + +  + E  +T +
Sbjct: 129 VLMTQALLPIMRKSDAGRIVFTSSTVGHSGRAFWGPYAISKFAVEGMMQVLADELSDTPM 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTV 218
           RV  I+PG TRT MR KA P ED NT+
Sbjct: 189 RVNAINPGATRTRMREKAYPGEDANTL 215


>gi|260767895|ref|ZP_05876829.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           furnissii CIP 102972]
 gi|260615925|gb|EEX41110.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           furnissii CIP 102972]
          Length = 247

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 125/224 (55%), Gaps = 5/224 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   A+  A  GA VI  GR++ +LE   + ++     +  I   
Sbjct: 10  LKDKVILVTGAGDGIGKQAAISYAAHGATVILLGRTVKKLEHTYDEIEAAGYPQPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N +++  T I  ++G+LD ++ NAG+LG +SP  QI E +F DV+ VNV + 
Sbjct: 70  DMKGATKQNYVDMVDT-IEGQFGRLDGVLHNAGLLGVLSPFDQIGEDTFDDVMQVNVKSQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  SS   +  R  WG YS SK A E + +  + E  ++ +
Sbjct: 129 FLMTQALLPLLHKSDDARIVFTSSTVGHVGRAFWGTYSISKFATEGMMQVLADELSDSTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           RV  I+PG TRT MRAKA PAED   +  P  +  +  +L A +
Sbjct: 189 RVNAINPGGTRTGMRAKAFPAEDAELLKTPLDIMPLYVYLMAPE 232


>gi|315179598|gb|ADT86512.1| short chain dehydrogenase [Vibrio furnissii NCTC 11218]
          Length = 247

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 125/224 (55%), Gaps = 5/224 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   A+  A  GA VI  GR++ +LE   + ++     +  I   
Sbjct: 10  LKDKVILVTGAGDGIGKQAAISYAAHGATVILLGRTVKKLEHTYDEIEAAGYPQPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N +++  T I  ++G+LD ++ NAG+LG +SP  QI E +F DV+ VNV + 
Sbjct: 70  DMKGATKQNYVDMVDT-IEGQFGRLDGVLHNAGLLGVLSPFDQIGEDTFDDVMQVNVKSQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  SS   +  R  WG YS SK A E + +  + E  ++ +
Sbjct: 129 FLMTQALLPLLHKSDDARIVFTSSTVGHVGRAFWGTYSISKFATEGMMQVLADELSDSTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           RV  I+PG TRT MRAKA PAED   +  P  +  +  +L A +
Sbjct: 189 RVNAINPGGTRTGMRAKAFPAEDAELLKTPLDIMPLYVYLMAPE 232


>gi|254507610|ref|ZP_05119743.1| short chain dehydrogenase [Vibrio parahaemolyticus 16]
 gi|219549497|gb|EED26489.1| short chain dehydrogenase [Vibrio parahaemolyticus 16]
          Length = 247

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 126/224 (56%), Gaps = 5/224 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A  GA VI  GR++ +LE+  + ++     +  I   
Sbjct: 10  LKGKVILVTGAGAGIGKQAALSYAERGATVILLGRTVKKLEQTYDEIEAAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I  ++G+LD ++ NA +LG ISP  QI E ++ D++ VNV A 
Sbjct: 70  DMKGATKQNYLDMADT-IEGQFGRLDGVLHNASLLGVISPFDQIGEDTYDDIMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  SS   +  R  WG Y+ SK A E + +  + E  +T +
Sbjct: 129 FLMTQAILPLLHKSDDARIVFTSSTVGHSGRAFWGTYAMSKFATEGMMQVLADELSDTHI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           RV  I+PG TRT+MRAKA PAED + +  P  +  +  +L + +
Sbjct: 189 RVNAINPGATRTAMRAKAYPAEDTDLLKTPLDIMPLYLYLMSPE 232


>gi|304310665|ref|YP_003810263.1| Short-chain dehydrogenase/reductase SDR [gamma proteobacterium
           HdN1]
 gi|301796398|emb|CBL44606.1| Short-chain dehydrogenase/reductase SDR [gamma proteobacterium
           HdN1]
          Length = 247

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 126/220 (57%), Gaps = 4/220 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L N++ ++TG+  GIG   AL  AR GA V+  GR+I +LE + + ++     K  I   
Sbjct: 11  LQNQVIMITGAGSGIGRAVALACARLGATVVLMGRTIEKLEAVYDEIEACGYPKPAIIPL 70

Query: 75  DLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  LE  +    + K  G L+ LI  A  LG ++ + Q    +FA+VI VN+ A+ 
Sbjct: 71  NLLTATHLEYAQIADIVEKELGHLNALIHCAAQLGELTMLSQYPMDTFANVIKVNMTASL 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-AL 191
            + ++  P L+++  GR I  +S    K R  WGAY+ SK A+E L +T + E  NT ++
Sbjct: 131 ALTQALLPLLQEAPSGRIIFTTSSVGRKGRAHWGAYAISKFAVEGLVQTLADELENTSSI 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           RV  I+PG TRT+MRA A PAEDP  V  P+KVA+   +L
Sbjct: 191 RVNAINPGATRTNMRASAYPAEDPAKVCPPEKVAETFLYL 230


>gi|323491951|ref|ZP_08097120.1| putative oxoacyl-(acyl carrier protein) reductase [Vibrio
           brasiliensis LMG 20546]
 gi|323313809|gb|EGA66904.1| putative oxoacyl-(acyl carrier protein) reductase [Vibrio
           brasiliensis LMG 20546]
          Length = 246

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 125/224 (55%), Gaps = 5/224 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A  GA VI  GR++ +LE+  + ++     +  I   
Sbjct: 10  LKGKVILVTGAGAGIGKQAALSYAEHGATVILLGRTVKKLEQTYDEIEAAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I  ++G+LD ++ NA +LG ISP  QI E ++ D++ VNV A 
Sbjct: 70  DMKGATKQNYLDMVDT-IEGQFGRLDGVLHNASLLGVISPFDQIGEDTYDDIMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R I  SS   +  R  WG Y+ SK A E + +  + E  +T +
Sbjct: 129 FLMTQAVLPLLHKSEDARIIFTSSTVGHSGRAFWGTYAMSKFATEGMMQILADELSDTNI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           RV  I+PG TRT+MRAKA PAED   +  P  +  +  +L + +
Sbjct: 189 RVNAINPGGTRTAMRAKAYPAEDAELLKTPLDIMPLYLYLMSPE 232


>gi|262171928|ref|ZP_06039606.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           mimicus MB-451]
 gi|261893004|gb|EEY38990.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           mimicus MB-451]
          Length = 247

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/227 (35%), Positives = 126/227 (55%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  ++ LVTG+  GIG   A+  A  GA VI  GR++ +LE+  +A++        I   
Sbjct: 10  LKEKVILVTGAGDGIGKQAAISFAAHGATVILLGRTVKKLEQTYDAIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I +++G+LD ++ NA +LG +SP  QI E SF DV+ VNV A 
Sbjct: 70  DMKGASKQNYLDMVDT-IEEQFGRLDGVLHNASLLGVLSPFDQIGEDSFDDVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  SS   +  R  W  Y+ SK A E + +  + E  ++ +
Sbjct: 129 FLMTQALLPLLHKSADARIVFTSSTVGHIGRAFWATYAISKFATEGMMQILADELSDSTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT MRAKA PAED + +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTGMRAKAYPAEDADKLKTPLDIMPLYLYLMAPEGRE 235


>gi|119469276|ref|ZP_01612215.1| short chain dehydrogenase [Alteromonadales bacterium TW-7]
 gi|119447140|gb|EAW28409.1| short chain dehydrogenase [Alteromonadales bacterium TW-7]
          Length = 248

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 126/226 (55%), Gaps = 5/226 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L++++ L+TG+  GIG   A+  A+ GA VI  G++ ++LE + + +      K  I   
Sbjct: 11  LNDKVILITGAGDGIGRVAAITYAKHGATVILLGKTTNKLECVYDEIVNAGYPKPAIVPM 70

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N  +L  T I  ++G+LD L+ NAGILGS+ P+      +F +++ VNV A 
Sbjct: 71  DLKGATKQNYRDLAAT-IENQFGRLDGLLNNAGILGSLGPLEHFCSSTFENIMKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             I ++  P ++KS     +  SSG   K R  WG Y+ SK A+E + +TW+ E   T +
Sbjct: 130 AMITKALFPVMRKSDNASIVFTSSGVGRKGREFWGPYAISKFAVEGMMQTWACEVGKTNI 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
           RV  I+PG TRTSMRA A P ED + +  P+ +     +L +   I
Sbjct: 190 RVNCINPGATRTSMRASAYPGEDRDKLATPESIMPTYLYLMSDDSI 235


>gi|323499378|ref|ZP_08104354.1| putative oxoacyl-(acyl carrier protein) reductase [Vibrio
           sinaloensis DSM 21326]
 gi|323315563|gb|EGA68598.1| putative oxoacyl-(acyl carrier protein) reductase [Vibrio
           sinaloensis DSM 21326]
          Length = 247

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 125/224 (55%), Gaps = 5/224 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  ++ LVTG+  GIG   AL  A  GA VI  GR++ +LE+  + ++     +  I   
Sbjct: 10  LKGKVILVTGAGAGIGKQAALSYAERGATVILLGRTVKKLEQTYDEIEAAGYPQPAIIPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N +++  T I  ++G+LD ++ NA +LG ISP  QI E ++ D++ VNV A 
Sbjct: 70  DMKGATKQNYVDMADT-IEGQFGRLDGVLHNASLLGVISPFDQIGEDTYDDIMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R I  SS   +  R  WG Y+ SK A E + +  + E  +T +
Sbjct: 129 FLMTQAILPLLHKSEEARIIFTSSTVGHSGRAFWGTYAMSKFATEGMMQILADELSDTHI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           RV  I+PG TRT+MRAKA PAED   +  P  +  +  +L + +
Sbjct: 189 RVNAINPGATRTAMRAKAYPAEDTELLKTPLDIMPLYLYLMSPE 232


>gi|256822110|ref|YP_003146073.1| short-chain dehydrogenase/reductase SDR [Kangiella koreensis DSM
           16069]
 gi|256795649|gb|ACV26305.1| short-chain dehydrogenase/reductase SDR [Kangiella koreensis DSM
           16069]
          Length = 249

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 113/209 (54%), Gaps = 3/209 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA-- 73
           L N++ LVTGS+ GIG   A+  A+ GA VI   R   +LEK+ + ++        F   
Sbjct: 11  LKNKVILVTGSTSGIGKEIAMTYAKHGATVILLSRDTRKLEKVYDEIEAAGYPQPAFLPV 70

Query: 74  -FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
                D    +     I K +G+LD L+ NAG LG +SPI    E+++  V+ +NV A +
Sbjct: 71  NLQNNDPQQYQQVADVIEKEFGRLDALVHNAGDLGLLSPIEHFDEETWFRVMQINVNAEF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + +   P L+KS     +  SSG   + R  WGAY+ SK A E L +  + E  +  +R
Sbjct: 131 LLTKYCMPLLRKSDDASILFTSSGVGRQGRAYWGAYAVSKFATEGLMQVLADELESANIR 190

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           V +I+PG TRT MRA A P EDPNT+P P
Sbjct: 191 VNSINPGATRTKMRANAYPGEDPNTLPTP 219


>gi|262377112|ref|ZP_06070337.1| 2-deoxy-D-gluconate 3-dehydrogenase [Acinetobacter lwoffii SH145]
 gi|262307850|gb|EEY88988.1| 2-deoxy-D-gluconate 3-dehydrogenase [Acinetobacter lwoffii SH145]
          Length = 248

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 78/226 (34%), Positives = 127/226 (56%), Gaps = 3/226 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   A+  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAAISYALHGATVVLHGRTLNKLEVIYDEIESLGAPQPAILPL 72

Query: 75  DLRDSNA--LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            L  ++    EL    + +++G+LD ++ NAGILG   P+       + DV++VN+ A +
Sbjct: 73  QLSSASERDYELLLDTLDRQFGRLDGILHNAGILGERVPLADYPVNVWDDVMAVNLRAPF 132

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS     +  SSG   + R  WGAYS SK AIEA+++ ++KE V+  +R
Sbjct: 133 VMTQALLPLLSKSEHASVVFASSGVGREARERWGAYSVSKIAIEAVSQLFAKEQVHPNIR 192

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
              I+PG TRT+MRAKA P EDP T+P P  +     +L     + 
Sbjct: 193 YNCINPGATRTAMRAKAYPNEDPKTLPTPDSIMPAYLYLMGNDSLH 238


>gi|262370967|ref|ZP_06064290.1| short chain dehydrogenase [Acinetobacter johnsonii SH046]
 gi|262314043|gb|EEY95087.1| short chain dehydrogenase [Acinetobacter johnsonii SH046]
          Length = 248

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 78/226 (34%), Positives = 127/226 (56%), Gaps = 3/226 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   AL  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAALSYALHGATVVLHGRTLNKLEVIYDEIEGLGAPQPAILPL 72

Query: 75  DLRDSNA--LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            L  ++    EL    + +++G+LD ++ NAGILG  + +       + DV++VN+ A +
Sbjct: 73  QLSSASPRDYELLVDTLERQFGRLDGILHNAGILGERTELENYPVDVWDDVMAVNLRAPF 132

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + +   P LKKS     +  SSG   + R  WGAYS SK AIEA+++ ++KE  +  +R
Sbjct: 133 VMTQELMPLLKKSEHASVVFASSGVGRETRERWGAYSVSKIAIEAVSQLFAKENTSPNIR 192

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
              I+PG TRT+MRAKA P EDP T+P P+ +     +L     + 
Sbjct: 193 FNCINPGATRTAMRAKAYPDEDPKTLPTPENIMPAYLYLMGDDSLH 238


>gi|317492189|ref|ZP_07950619.1| short chain dehydrogenase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919894|gb|EFV41223.1| short chain dehydrogenase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 253

 Score =  138 bits (347), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L NR+ LVTG+  GIG   AL  AR GA +I  GR++S+L+ +K  + ++         F
Sbjct: 10  LHNRIILVTGAGDGIGREAALTYARHGAQLILLGRTLSKLQAVKQEIHQLGLAPAATVEF 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +   +  K    +A  +  LD ++ NAG+LG+I+P+ +   + F DV+ VNV A+ 
Sbjct: 70  DLLTAAPADYQKLADELAAAYPHLDGVLNNAGLLGTINPLAEQDYQEFCDVMQVNVNASL 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS     I  SS      R  WGAY+ SK A E + +  + E  NT LR
Sbjct: 130 LLTQAVLPLLLKSPSASLIFTSSSVGRTGRAGWGAYAISKFATEGMMQVLADEYKNTHLR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRTSMRA A P EDP+ +  P  +  +  +L     + +TG  F     R
Sbjct: 190 VNCINPGGTRTSMRASAFPDEDPHKLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPGR 247


>gi|299772076|ref|YP_003734102.1| short chain dehydrogenase [Acinetobacter sp. DR1]
 gi|298702164|gb|ADI92729.1| short chain dehydrogenase [Acinetobacter sp. DR1]
          Length = 248

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 129/228 (56%), Gaps = 9/228 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   AL  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAALTYALHGATVVLHGRTLNKLEVIYDEIESLGAPQPAILPL 72

Query: 75  DL-----RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            L     RD + L  T   + K++G+LD ++ NAGILG    +     +++ DV++VN+ 
Sbjct: 73  QLSSASDRDYDFLVDT---LEKQFGRLDGILHNAGILGERVELAHYPTETWDDVMAVNLR 129

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L+KS     +  SSG   + R LWGAYS SK AIEA+++ ++ E    
Sbjct: 130 APFALTQALLPLLQKSENASVVFTSSGVGREARALWGAYSVSKIAIEAVSKIFAAEHTYP 189

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
            +R   I+PG TRT+MRAKA P EDP T+P P+ +     +L     +
Sbjct: 190 NIRFNCINPGATRTAMRAKAYPQEDPKTLPTPESILPAYLYLMGEDSL 237


>gi|169632063|ref|YP_001705799.1| short chain dehydrogenase [Acinetobacter baumannii SDF]
 gi|169797757|ref|YP_001715550.1| short chain dehydrogenase [Acinetobacter baumannii AYE]
 gi|184156375|ref|YP_001844714.1| short chain dehydrogenase [Acinetobacter baumannii ACICU]
 gi|213155443|ref|YP_002317488.1| short chain dehydrogenase [Acinetobacter baumannii AB0057]
 gi|215485108|ref|YP_002327349.1| short chain dehydrogenase family protein [Acinetobacter baumannii
           AB307-0294]
 gi|239503761|ref|ZP_04663071.1| short chain dehydrogenase [Acinetobacter baumannii AB900]
 gi|260553002|ref|ZP_05825917.1| short chain dehydrogenase [Acinetobacter sp. RUH2624]
 gi|260557757|ref|ZP_05829971.1| 2-deoxy-D-gluconate 3-dehydrogenase [Acinetobacter baumannii ATCC
           19606]
 gi|301347651|ref|ZP_07228392.1| short chain dehydrogenase [Acinetobacter baumannii AB056]
 gi|301511158|ref|ZP_07236395.1| short chain dehydrogenase [Acinetobacter baumannii AB058]
 gi|301595701|ref|ZP_07240709.1| short chain dehydrogenase [Acinetobacter baumannii AB059]
 gi|332873545|ref|ZP_08441494.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Acinetobacter baumannii 6014059]
 gi|169150684|emb|CAM88594.1| putative oxoacyl-(acyl carrier protein) reductase [Acinetobacter
           baumannii AYE]
 gi|169150855|emb|CAO99458.1| putative oxoacyl-(acyl carrier protein) reductase [Acinetobacter
           baumannii]
 gi|183207969|gb|ACC55367.1| Dehydrogenase with different specificities [Acinetobacter baumannii
           ACICU]
 gi|193075949|gb|ABO10529.2| putative oxoacyl-(acyl carrier protein) reductase [Acinetobacter
           baumannii ATCC 17978]
 gi|213054603|gb|ACJ39505.1| short chain dehydrogenase [Acinetobacter baumannii AB0057]
 gi|213987089|gb|ACJ57388.1| short chain dehydrogenase family protein [Acinetobacter baumannii
           AB307-0294]
 gi|260405244|gb|EEW98741.1| short chain dehydrogenase [Acinetobacter sp. RUH2624]
 gi|260408930|gb|EEX02234.1| 2-deoxy-D-gluconate 3-dehydrogenase [Acinetobacter baumannii ATCC
           19606]
 gi|322506245|gb|ADX01699.1| oxoacyl-Acyl carrier protein reductase [Acinetobacter baumannii
           1656-2]
 gi|323516121|gb|ADX90502.1| short chain dehydrogenase [Acinetobacter baumannii TCDC-AB0715]
 gi|332738242|gb|EGJ69120.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Acinetobacter baumannii 6014059]
          Length = 248

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 128/228 (56%), Gaps = 9/228 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   AL  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAALSYALHGATVVLHGRTLNKLEVIYDEIEGLGAPQPAILPL 72

Query: 75  DL-----RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            L     RD + L  T   + K++G+LD ++ NAGILG    +     + + DV++VN+ 
Sbjct: 73  QLSSASDRDYDFLVST---LEKQFGRLDGILHNAGILGERVELAHYPAEVWDDVMAVNLR 129

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L+KS     +  SSG   + R LWGAYS SK AIEA+++ ++ E    
Sbjct: 130 APFALTQALLPLLQKSENASVVFTSSGVGREARALWGAYSVSKVAIEAVSKIFAAEHTYP 189

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
            +R   I+PG TRT+MRAKA P EDP T+P P+ +     +L     +
Sbjct: 190 NIRFNCINPGATRTAMRAKAYPEEDPKTLPTPESIMPAYLYLMGEDSL 237


>gi|262402597|ref|ZP_06079158.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           sp. RC586]
 gi|262351379|gb|EEZ00512.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           sp. RC586]
          Length = 247

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  ++ LVTG+  GIG   A+  A  GA VI  GR++ +LE   +A++        I   
Sbjct: 10  LKEKVILVTGAGDGIGKQAAISFAAHGATVILLGRTVKKLEHTYDAIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I +++G+LD ++ NA +LG +SP  QI E SF +V+ VNV A 
Sbjct: 70  DMKGATKQNYLDMVDT-IEEQFGRLDGVLHNASLLGVLSPFDQIGEDSFDEVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  SS   +  R  W  Y+ SK A E + +  + E  ++ +
Sbjct: 129 FLMTQALLPLLHKSADARIVFTSSTVGHIGRAFWATYAISKFATEGMMQILADELSDSTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT MRAKA PAED + +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTGMRAKAYPAEDADKLKTPLDIMPLYLYLMAPEGRE 235


>gi|262281431|ref|ZP_06059212.1| short chain dehydrogenase [Acinetobacter calcoaceticus RUH2202]
 gi|262257257|gb|EEY75994.1| short chain dehydrogenase [Acinetobacter calcoaceticus RUH2202]
          Length = 248

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 128/228 (56%), Gaps = 9/228 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   AL  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAALTYALHGATVVLHGRTLNKLEVIYDEIESLGAPQPAILPL 72

Query: 75  DL-----RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            L     RD + L  T   + K++G+LD ++ NAGILG    +     + + DV++VN+ 
Sbjct: 73  QLSSASDRDYDFLVDT---LEKQFGRLDGILHNAGILGERVELAHYPSEVWDDVMAVNLR 129

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L+KS     +  SSG   + R LWGAYS SK AIEA+++ ++ E    
Sbjct: 130 APFALTQALLPLLQKSENASVVFTSSGVGREARALWGAYSVSKIAIEAVSKIFAAENTYP 189

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
            +R   I+PG TRT+MRAKA P EDP T+P P+ +     +L     +
Sbjct: 190 NIRFNCINPGATRTAMRAKAYPQEDPKTLPTPESILPAYLYLMGEDSL 237


>gi|294141566|ref|YP_003557544.1| short chain dehydrogenase/reductase family oxidoreductase
           [Shewanella violacea DSS12]
 gi|293328035|dbj|BAJ02766.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Shewanella violacea DSS12]
          Length = 245

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 125/222 (56%), Gaps = 5/222 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L N+  LVTG+  GIG   A+  A+ GA VI  G+++ +LE + + + Q    K  I   
Sbjct: 11  LINKTILVTGAGDGIGRAAAISFAQHGATVILLGKTVKKLEAVYDQIIQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N +++ +T I +++G LD  + NAG+LG + P   I   S  +V+ VNV+A 
Sbjct: 71  DLQGATEQNYIDMAQT-IEEQFGHLDGALHNAGLLGVLGPFEHISMDSVQEVMQVNVIAE 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P +KK+     +  SSG   + R  WG Y+ SK A E + ++ + E   ++L
Sbjct: 130 IMLTKALLPIMKKAPKASLVFTSSGVGRQGRAFWGEYAISKFATEGMMQSIADEYEGSSL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           RV +I+PG TRT MRA A PAE+P+T+  P+ +     +L  
Sbjct: 190 RVNSINPGATRTGMRANAYPAENPSTLKEPEDIMATYLYLMG 231


>gi|145300015|ref|YP_001142856.1| short chain dehydrogenase/reductase family oxidoreductase
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852787|gb|ABO91108.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 251

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 135/237 (56%), Gaps = 10/237 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L +++ LVTG+  GIG   A+  A  GA VI  GR+ ++LE + + ++     +  I   
Sbjct: 11  LKDKVILVTGAGDGIGREAAITYAAHGATVILLGRTSAKLEAVYDQIEAAGYPLPAIVPV 70

Query: 75  DLRDSNALE---LTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ + A     + +T+ A+++G+LD ++ NAG+LG++SP   I+EK + +V+ VNV + 
Sbjct: 71  DLKGATAAHYRGMAETF-AQQFGRLDGVLFNAGLLGTLSPFEHIQEKEWDEVMQVNVKSE 129

Query: 132 WNIMRSFDPWLK---KSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           + + ++  P ++   K H   +I+  SS    K R  WG Y+ SK AIE +    + E  
Sbjct: 130 FLLTQALLPLIRQTAKEHGDASIVYTSSSVGRKGRAYWGTYAISKFAIEGMMEVLADELE 189

Query: 188 NTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF 243
           NTA+RV  ++PG TRT MRA A PAEDP  +  P  +  +  +L     + +TG+ F
Sbjct: 190 NTAVRVNTLNPGGTRTKMRASAFPAEDPQQLKTPADLMPLYLYLMGQDSRGKTGQTF 246


>gi|325124014|gb|ADY83537.1| putative oxoacyl-(acyl carrier protein) reductase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 248

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 128/228 (56%), Gaps = 9/228 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   AL  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAALSYALHGATVVLHGRTLNKLEVIYDEIESLGAPQPAILPL 72

Query: 75  DL-----RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            L     RD + L  T   + K++G+LD ++ NAGILG    +     + + DV++VN+ 
Sbjct: 73  QLSSASDRDYDFLVDT---LEKQFGRLDGILHNAGILGERVELAHYPTEVWDDVMAVNLR 129

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L+KS     +  SSG   + R LWGAYS SK AIEA+++ ++ E    
Sbjct: 130 APFALTQALLPLLQKSENASVVFTSSGVGREARALWGAYSVSKIAIEAVSKIFAAENSYP 189

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
            +R   I+PG TRT+MRAKA P EDP T+P P+ +     +L     +
Sbjct: 190 NIRFNCINPGATRTAMRAKAYPQEDPKTLPTPESILPAYLYLMGEDSL 237


>gi|293611270|ref|ZP_06693568.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826521|gb|EFF84888.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 248

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 127/228 (55%), Gaps = 9/228 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   AL  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAALSYALHGATVVLHGRTLNKLEVIYDEIESLGAPQPAILPL 72

Query: 75  DL-----RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            L     RD + L  T   + K++G LD ++ NAGILG    +     + + DV++VN+ 
Sbjct: 73  QLSSASDRDYDFLVDT---LEKQFGHLDGILHNAGILGERVELAHYPTEVWDDVMAVNLR 129

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L+KS     +  SSG   + R LWGAYS SK AIEA+++ ++ E    
Sbjct: 130 APFALTQALLPLLQKSENASVVFTSSGVGREARALWGAYSVSKIAIEAVSKIFAAENTYP 189

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
            +R   I+PG TRT+MRAKA P EDP T+P P+ +     +L     +
Sbjct: 190 NIRFNCINPGATRTAMRAKAYPQEDPKTLPTPESILPAYLYLMGEDSL 237


>gi|254291485|ref|ZP_04962276.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae AM-19226]
 gi|150422549|gb|EDN14505.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae AM-19226]
          Length = 247

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/227 (34%), Positives = 125/227 (55%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  ++ LVTG+  GIG   A+  A  GA VI  GR++ +LE+  +A++        I   
Sbjct: 10  LKEKVILVTGAGDGIGKQAAISFAAHGATVILLGRTVKKLEQTYDAIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I  ++G+LD ++ NA +LG +SP  QI E SF +V+ VNV A 
Sbjct: 70  DMKGATKQNYLDMVDT-IEDQFGRLDGVLHNASLLGVLSPFDQIGEDSFDEVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  +S   +  R  W  Y+ SK A E + +  + E   + +
Sbjct: 129 FLMTQTLLPLLHKSADARIVFTTSTVGHIGRAFWATYAISKFATEGMMQILADELSESTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT+MRAKA PAED + +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTAMRAKAYPAEDADKLKTPLDIMPLYLYLMAPEGRE 235


>gi|229520510|ref|ZP_04409935.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae TM 11079-80]
 gi|229342608|gb|EEO07601.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae TM 11079-80]
          Length = 247

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/227 (34%), Positives = 125/227 (55%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  ++ LVTG+  GIG   A+  A  GA VI  GR++ +LE+  +A++        I   
Sbjct: 10  LKEKVILVTGAGDGIGKQAAISFAAQGATVILLGRTVKKLEQTYDAIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I  ++G+LD ++ NA +LG +SP  QI E SF +V+ VNV A 
Sbjct: 70  DMKGATKQNYLDMVDT-IEDQFGRLDGVLHNASLLGVLSPFDQIGEDSFDEVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  +S   +  R  W  Y+ SK A E + +  + E   + +
Sbjct: 129 FLMTQALLPLLHKSADARIVFTTSTVGHIGRAFWATYAISKFATEGMMQILADELSESTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT+MRAKA PAED + +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTAMRAKAYPAEDADKLKTPLDIMPLYLYLMAPEGRE 235


>gi|332852844|ref|ZP_08434426.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Acinetobacter baumannii 6013150]
 gi|332728958|gb|EGJ60309.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Acinetobacter baumannii 6013150]
          Length = 248

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 127/228 (55%), Gaps = 9/228 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   AL  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAALSYALHGATVVLHGRTLNKLEVIYDEIEGLGAPQPAILPL 72

Query: 75  DL-----RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            L     RD + L  T   + K++G+LD ++ NAGILG    +     + + DV++VN+ 
Sbjct: 73  QLSSASDRDYDFLVST---LEKQFGRLDGILHNAGILGERVELAHYPAEVWDDVMAVNLR 129

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L+KS     +  SSG   + R LWGAYS SK AIEA+++ ++ E    
Sbjct: 130 APFALTQALLPLLQKSENASVVFTSSGVGREARALWGAYSVSKVAIEAVSKIFAAEHTYP 189

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
            +R   I+PG TRT+MR KA P EDP T+P P+ +     +L     +
Sbjct: 190 NIRFNCINPGATRTAMRVKAYPEEDPKTLPTPESIMPAYLYLMGEDSL 237


>gi|15641072|ref|NP_230704.1| short chain dehydrogenase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121587066|ref|ZP_01676843.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae 2740-80]
 gi|121726281|ref|ZP_01679571.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae V52]
 gi|147675485|ref|YP_001216527.1| short chain dehydrogenase [Vibrio cholerae O395]
 gi|153824202|ref|ZP_01976869.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae B33]
 gi|153828153|ref|ZP_01980820.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae 623-39]
 gi|227081232|ref|YP_002809783.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae M66-2]
 gi|229510984|ref|ZP_04400463.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae B33]
 gi|229518105|ref|ZP_04407549.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae RC9]
 gi|229525670|ref|ZP_04415075.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae bv. albensis VL426]
 gi|229529850|ref|ZP_04419240.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae 12129(1)]
 gi|229608365|ref|YP_002879013.1| short chain dehydrogenase [Vibrio cholerae MJ-1236]
 gi|254848188|ref|ZP_05237538.1| short chain dehydrogenase [Vibrio cholerae MO10]
 gi|255745476|ref|ZP_05419424.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholera CIRS 101]
 gi|297578663|ref|ZP_06940591.1| oxidoreductase [Vibrio cholerae RC385]
 gi|298498833|ref|ZP_07008640.1| short chain dehydrogenase [Vibrio cholerae MAK 757]
 gi|9655525|gb|AAF94218.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|121548701|gb|EAX58750.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae 2740-80]
 gi|121631227|gb|EAX63600.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae V52]
 gi|126518274|gb|EAZ75499.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae B33]
 gi|146317368|gb|ABQ21907.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae O395]
 gi|148876395|gb|EDL74530.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae 623-39]
 gi|227009120|gb|ACP05332.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae M66-2]
 gi|227012875|gb|ACP09085.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae O395]
 gi|229333624|gb|EEN99110.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae 12129(1)]
 gi|229339251|gb|EEO04268.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae bv. albensis VL426]
 gi|229344820|gb|EEO09794.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae RC9]
 gi|229350949|gb|EEO15890.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae B33]
 gi|229371020|gb|ACQ61443.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae MJ-1236]
 gi|254843893|gb|EET22307.1| short chain dehydrogenase [Vibrio cholerae MO10]
 gi|255736551|gb|EET91948.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholera CIRS 101]
 gi|297536257|gb|EFH75090.1| oxidoreductase [Vibrio cholerae RC385]
 gi|297543166|gb|EFH79216.1| short chain dehydrogenase [Vibrio cholerae MAK 757]
 gi|327483770|gb|AEA78177.1| Putative oxidoreductase [Vibrio cholerae LMA3894-4]
          Length = 247

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/227 (34%), Positives = 125/227 (55%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  ++ LVTG+  GIG   A+  A  GA VI  GR++ +LE+  +A++        I   
Sbjct: 10  LKEKVILVTGAGDGIGKQAAISFAAHGATVILLGRTVKKLEQTYDAIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I  ++G+LD ++ NA +LG +SP  QI E SF +V+ VNV A 
Sbjct: 70  DMKGATKQNYLDMVDT-IEDQFGRLDGVLHNASLLGVLSPFDQIGEDSFDEVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  +S   +  R  W  Y+ SK A E + +  + E   + +
Sbjct: 129 FLMTQALLPLLHKSADARIVFTTSTVGHIGRAFWATYAISKFATEGMMQILADELSESTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT+MRAKA PAED + +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTAMRAKAYPAEDADKLKTPLDIMPLYLYLMAPEGRE 235


>gi|332866691|ref|ZP_08437153.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Acinetobacter baumannii 6013113]
 gi|332734460|gb|EGJ65575.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Acinetobacter baumannii 6013113]
          Length = 248

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 127/228 (55%), Gaps = 9/228 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   AL  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAALSYALHGATVVLHGRTLNKLEVIYDEIEGLGAPQPAILPL 72

Query: 75  DL-----RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            L     RD + L  T   + K++G+LD ++ NAGILG    +     + + DV++VN+ 
Sbjct: 73  QLSSASDRDYDFLVST---LEKQFGRLDGILHNAGILGERVELAHYPAEVWDDVMAVNLR 129

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L+KS     +  SSG   + R LWGAYS SK AIEA+++ ++ E    
Sbjct: 130 APFALTQALLPLLQKSENASVVFTSSGVGREARALWGAYSVSKVAIEAVSKIFAAEHTYP 189

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
            +R   I+PG TRT+MR KA P EDP T+P P+ +     +L     +
Sbjct: 190 NIRFNCINPGATRTAMRVKAYPEEDPKTLPTPESIMPAYLYLMGEDSL 237


>gi|153824984|ref|ZP_01977651.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae MZO-2]
 gi|149741496|gb|EDM55526.1| oxidoreductase, short-chain dehydrogenase/reductase family [Vibrio
           cholerae MZO-2]
          Length = 247

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/227 (34%), Positives = 125/227 (55%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  ++ LVTG+  GIG   A+  A  GA VI  GR++ +LE+  +A++        I   
Sbjct: 10  LKEKVILVTGAGDGIGKQAAISFAAHGATVILLGRTVKKLEQTYDAIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I  ++G+LD ++ NA +LG +SP  QI E SF +V+ VNV A 
Sbjct: 70  DMKGATKQNYLDMADT-IEDQFGRLDGVLHNASLLGVLSPFDQIGEDSFDEVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  +S   +  R  W  Y+ SK A E + +  + E   + +
Sbjct: 129 FLMTQALLPLLHKSADARIVFTTSTVGHIGRAFWATYAISKFATEGMMQILADELSESTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT+MRAKA PAED + +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTAMRAKAYPAEDADKLKTPLDIMPLYLYLMAPEGRE 235


>gi|332533577|ref|ZP_08409439.1| short chain dehydrogenase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036979|gb|EGI73438.1| short chain dehydrogenase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 248

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 123/220 (55%), Gaps = 5/220 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ L+TG+  GIG   A+  A+ GA VI  G++ ++LE + + +      K  I   
Sbjct: 11  LKDKIILITGAGDGIGRVAAITYAKYGATVILLGKTTNKLECVYDEIVNAGYPKPAIVPM 70

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N  +L  T I  ++G+LD L+ NAGILGS+ P+      +F +++ VNV A 
Sbjct: 71  DLKGATKQNYRDLAAT-IEYQFGRLDGLLNNAGILGSLGPLEHFCSSTFENIMKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             I ++  P L+KS     +  SSG   K R  WG Y+ SK A+E + +TW+ E   T +
Sbjct: 130 AMITKALFPVLRKSDNASIVFTSSGVGRKGREFWGPYAISKFAVEGMMQTWACEVGKTNI 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           R+  I+PG TRTSMRA A P ED + +  P+ +     +L
Sbjct: 190 RINCINPGATRTSMRAAAYPGEDRDALATPEDLMPTYLYL 229


>gi|260776313|ref|ZP_05885208.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607536|gb|EEX33801.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 247

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 124/224 (55%), Gaps = 5/224 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   A+  A+ GA VI  GR++ +LE+  + ++     +  I   
Sbjct: 10  LKDKVILVTGAGDGIGKQAAISFAQHGATVILLGRTVKKLEQTYDEIEAAGYPQPAIIPL 69

Query: 75  DLRDSNA---LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +N    +++  T I  ++G+LD ++ NA  LG +SP  QI E ++ D++ VNV A 
Sbjct: 70  DMKGANKQNYIDMADT-IGSQFGRLDGVLHNASQLGVLSPFDQIGEDTYDDIMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS     I  SS   +  R  WG Y+ SK A E + +  + E  +T +
Sbjct: 129 FLMTQAILPLLHKSDDASVIFTSSTVGHAGRAFWGTYAISKFATEGMMQILADELSDTHI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           RV  I+PG TRTSMRAKA PAED   +  P  +  +   L + +
Sbjct: 189 RVNAINPGGTRTSMRAKAYPAEDAELLKTPLDIMPLYLHLMSNE 232


>gi|88800755|ref|ZP_01116313.1| short chain dehydrogenase [Reinekea sp. MED297]
 gi|88776531|gb|EAR07748.1| short chain dehydrogenase [Reinekea sp. MED297]
          Length = 256

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 126/223 (56%), Gaps = 6/223 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L +++ LVTG+  GIG   AL  A +GA+VI  GR+  +LE++ + +++  K +  IF +
Sbjct: 17  LLDKVILVTGAGDGIGKAAALSYANAGAHVILLGRTQGKLEQVYDLIEQNTKTRPIIFPY 76

Query: 75  DLRDSN---ALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL   N   A E+    I + +G+LD ++ NA  LGS   I Q  E+ + DV++ NV + 
Sbjct: 77  DLNTLNPDIAREMAYA-IEQEYGRLDGVLFNASALGSKMAIEQYPEQEWLDVMNTNVNSA 135

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE-TVNTA 190
           + + ++  P LK +  GR +  +S    K R  WGAY+ SK A E L +T + E    + 
Sbjct: 136 FYLTKALLPLLKAADAGRILFTTSSVGRKGRAYWGAYAVSKFATEGLMQTLADELGAISQ 195

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           +R   ++PG TRT+MRA A P EDP  VP P+    +  FL +
Sbjct: 196 VRTFAVNPGGTRTAMRASAYPGEDPGDVPPPEDHMPLYRFLMS 238


>gi|229515442|ref|ZP_04404901.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae TMA 21]
 gi|229347211|gb|EEO12171.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae TMA 21]
          Length = 247

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 79/227 (34%), Positives = 124/227 (54%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  ++ LVTG+  GIG   A+  A  GA VI  GR++ +LE+  +A++        I   
Sbjct: 10  LKEKVILVTGAGDGIGKQAAISFAAHGATVILLGRTVKKLEQTYDAIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I  ++G+LD ++ NA +LG +SP  QI E SF +V+ VNV A 
Sbjct: 70  DMKGATKQNYLDMVDT-IEDQFGRLDGVLHNASLLGVLSPFDQIGEDSFDEVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  +S   +  R  W  Y+ SK A E + +  + E   + +
Sbjct: 129 FLMTQALLPLLHKSADARIVFTTSTVGHIGRAFWATYAISKFATEGMMQILADELSESTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT+MRAKA PAED   +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTAMRAKAYPAEDAEKLKTPLDIMPLYLYLMAPEGRE 235


>gi|93004963|ref|YP_579400.1| short chain dehydrogenase [Psychrobacter cryohalolentis K5]
 gi|92392641|gb|ABE73916.1| short-chain dehydrogenase/reductase SDR [Psychrobacter
           cryohalolentis K5]
          Length = 291

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 123/221 (55%), Gaps = 6/221 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           LD +  LVTG+  GIG   AL  AR GA V+  GR+ S+LE + + ++    K+  +   
Sbjct: 53  LDGKTILVTGAGDGIGRVAALTYARYGATVLLLGRTSSKLEYVYDEIESFGGKQPAMLPM 112

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +   E+ K    I +  G+LD ++ NAG+LG ++P+       FA V+ +N  A +
Sbjct: 113 NLEGATYAEMQKLENLIHREVGQLDGILHNAGMLGPLTPLEMYDVDMFAQVMKINFTATF 172

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + ++  P LK +  G  +  SS      R  WGAY+ SK A+E ++  +++ET NT  L
Sbjct: 173 MLTQALLPLLKDAPHGSIVFTSSSVGTHPRAFWGAYALSKQAVEGMSDIFTQETQNTTNL 232

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
           R   I+PG TRT+MRA A P E+P ++  P+ +  +  ++C
Sbjct: 233 RFNCINPGGTRTNMRAHAYPGENPMSLKTPEDI--MAGYVC 271


>gi|88859933|ref|ZP_01134572.1| short chain dehydrogenase [Pseudoalteromonas tunicata D2]
 gi|88817927|gb|EAR27743.1| short chain dehydrogenase [Pseudoalteromonas tunicata D2]
          Length = 257

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 127/228 (55%), Gaps = 5/228 (2%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIF 72
           + L  ++ L+TG+  GIG   ALE A++GA VI  G+++++LE + + +      +  I 
Sbjct: 19  LELKEKVILITGAGDGIGRVAALEYAKAGATVILLGKTVNKLECVYDEIIAAGGPQPAIV 78

Query: 73  AFDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
             D++ +   +  +L  T I  ++G+LD L+ NAGILGS+ P+      +F +++ VNV 
Sbjct: 79  PLDMKGATKQHYRDLAAT-IENQFGRLDGLLNNAGILGSLGPLEHFCVSTFENIMKVNVT 137

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A   + +   P L+KS     I  SSG   + R  WGAY+ SK A+E + +TWSKE   T
Sbjct: 138 AQAVLTKYMFPILRKSPNASIIFTSSGVGREGREFWGAYAISKFAVEGMMQTWSKEVAKT 197

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
            +R+  I+PG T T MRA A P ED + +  P  +     +L + + I
Sbjct: 198 NIRINCINPGATETKMRASAYPGEDRSKLASPLDLMPTYLYLMSDRSI 245


>gi|260773131|ref|ZP_05882047.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           metschnikovii CIP 69.14]
 gi|260612270|gb|EEX37473.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           metschnikovii CIP 69.14]
          Length = 246

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 3/221 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L N++ LVTG+S GIG   A+  A  GA VI  GRS  +L++    +      +  + A 
Sbjct: 10  LQNKVILVTGASDGIGKQAAITYAAHGATVILLGRSEDKLQQTYAEIVSAGYPEARVIAL 69

Query: 75  DLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           D++ ++  +       I ++ G+LD L+ +AG+LG ISP   I E ++  V+ VNV A  
Sbjct: 70  DMQKASRYDYQTLIHNIEQQCGQLDGLLHSAGLLGEISPFEAITEHTYDQVMQVNVKAQL 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P +K+S  GR +  SS   +  R  W +YS SK A E + +  + E  +T LR
Sbjct: 130 LLTQAALPLIKRSPQGRIVFTSSTVGHSGRSGWASYSISKFATEGMMQILADELRDTPLR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           V  I+PG TRT+MRAKA P ED N +  PQ++  +  +L A
Sbjct: 190 VNAINPGGTRTAMRAKAYPQEDANRLKTPQEIMPLYLYLMA 230


>gi|315126450|ref|YP_004068453.1| short chain dehydrogenase [Pseudoalteromonas sp. SM9913]
 gi|315014964|gb|ADT68302.1| short chain dehydrogenase [Pseudoalteromonas sp. SM9913]
          Length = 248

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 122/220 (55%), Gaps = 5/220 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ L+TG+  GIG   A+  A+ GA VI  G++ ++LE + + +      +  I   
Sbjct: 11  LKDKVILITGAGDGIGRVAAITYAKHGATVILLGKTTNKLECVYDEIVNAGYPQPAIVPM 70

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N  +L  T I  ++G LD L+ NAGILG++ P+      +F +V+ VNV A 
Sbjct: 71  DLKGATKQNYRDLAAT-IESQFGCLDGLLNNAGILGTLGPLEHFCSSTFENVMKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             I ++  P ++KS     +  SSG   K R  WG Y+ SK A+E + +TW+ E   T +
Sbjct: 130 AMITKALFPVMRKSKSASVVFTSSGVGRKGREFWGPYAISKFAVEGMMQTWACEVEKTPI 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           RV  I+PG TRTSMRA A P ED + +  P+ +     +L
Sbjct: 190 RVNCINPGATRTSMRASAFPGEDRDLLATPEDLMPTYLYL 229


>gi|77360286|ref|YP_339861.1| short chain dehydrogenase [Pseudoalteromonas haloplanktis TAC125]
 gi|76875197|emb|CAI86418.1| putative oxoacyl-(acyl carrier protein) reductase with
           NAD(P)-binding domain [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 248

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 123/220 (55%), Gaps = 5/220 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ L+TG+  GIG   A+  A+ GA VI  G++ ++LE + + + K    +  I   
Sbjct: 11  LKDKVILITGAGDGIGRVAAITYAKYGATVILLGKTTNKLECVYDEIVKAGYPQPAIVPM 70

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   N  +L  T I  ++G LD L+ NAGILG++ P+      +F +++ VNV A 
Sbjct: 71  DLKGATKQNYRDLAAT-IESQFGCLDGLLNNAGILGTLGPLEHFCSSTFENIMKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             I ++  P L+KS     +  SSG   K R  WG Y+ SK A+E + +TW+ E   T +
Sbjct: 130 AMITKALFPVLRKSKNASVVFTSSGVGRKGREFWGPYAISKFAVEGMMQTWACEVGKTNI 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           R+  I+PG TRTSMRA A P ED + +  P+ +     +L
Sbjct: 190 RINCINPGATRTSMRASAYPGEDRDKLATPEDLMPTYLYL 229


>gi|50083336|ref|YP_044846.1| short chain dehydrogenase [Acinetobacter sp. ADP1]
 gi|49529312|emb|CAG67024.1| putative oxoacyl-(acyl carrier protein) reductase [Acinetobacter
           sp. ADP1]
          Length = 248

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/226 (33%), Positives = 125/226 (55%), Gaps = 3/226 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  R+ L+TG+  GIG   A+  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKGRIILITGAGDGIGRAAAMSYALHGATVVLHGRTLNKLEVIYDEIESLGAPQPAILPL 72

Query: 75  DLRDSNA--LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            L  ++    EL    +  ++G+LD ++ NAGILG   P+       + DV++VN+ A +
Sbjct: 73  QLSSASDRDYELLFNTLEDQFGRLDGILHNAGILGERVPLAHYPADVWDDVMAVNLRAPF 132

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L++S     +  SSG   + R LWGAYS SK AIEA+++ ++ E V   +R
Sbjct: 133 VLTQALLPLLERSDNASVVFASSGVGREARALWGAYSVSKVAIEAVSKIFASEHVYPNIR 192

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
              I+PG TRT+MRAKA P EDP T+P  + +     +L     + 
Sbjct: 193 FNCINPGATRTAMRAKAYPEEDPLTLPTTESIMPAYLYLMGEDSLH 238


>gi|212634750|ref|YP_002311275.1| short chain dehydrogenase [Shewanella piezotolerans WP3]
 gi|212556234|gb|ACJ28688.1| Short-chain dehydrogenase/reductase SDR [Shewanella piezotolerans
           WP3]
          Length = 245

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 121/222 (54%), Gaps = 5/222 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ ++ LVTG+  GIG   AL  A+ GA VI  G+++ +LE + + +++    K  I   
Sbjct: 11  LNGKVILVTGAGDGIGKTAALTYAQHGATVILLGKTVKKLEAVYDQIEQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N L++ +T I +++G LD L+ NA +LG + P   I   S  +V  VNV+A 
Sbjct: 71  DLKGATEQNYLDMAET-IEEQFGHLDGLLHNASMLGVLGPFEHITMSSVEEVFKVNVIAE 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++KS     I  SS    K R  WG Y+ SK A E + +  + E   + +
Sbjct: 130 IMLTKALLPVMRKSESASLIFTSSSVGRKARSFWGEYAMSKFATEGMMQAIAHEYEGSNI 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA A PAE+P  +  P+++     +L  
Sbjct: 190 RTNSINPGATRTGMRANAYPAENPQLLKKPEEIMPTYLYLMG 231


>gi|85713083|ref|ZP_01044119.1| Short chain dehydrogenase family protein [Idiomarina baltica OS145]
 gi|85693122|gb|EAQ31084.1| Short chain dehydrogenase family protein [Idiomarina baltica OS145]
          Length = 250

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 114/206 (55%), Gaps = 3/206 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L N+  LVTG+  GIG   AL  A+ GA VI  GR+ ++LE + + ++     +  I   
Sbjct: 16  LANKTILVTGAGEGIGRQAALSFAQHGATVILLGRTTAKLEAVYDEIEAAGYAQAAIVPL 75

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL+ + A       + I +++G LD ++ NAGIL  +SP   I E  + D + +NV    
Sbjct: 76  DLKGATAQHYKDMASTIEQQFGHLDGVLHNAGILSILSPFTHIDENDWNDALQINVTGPM 135

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L+K+     +  SSG   K R  WG+Y+ SK A E LA+  + E   T++R
Sbjct: 136 LMTQALMPVLEKAPFASVVFTSSGVGRKGRAYWGSYAVSKFATEGLAQVIADEYETTSVR 195

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTV 218
              I+PG TRT MR+KA PAEDP T+
Sbjct: 196 TNVINPGATRTKMRSKAYPAEDPKTL 221


>gi|117619161|ref|YP_857607.1| short chain dehydrogenase/reductase family oxidoreductase
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560568|gb|ABK37516.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 251

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 136/237 (57%), Gaps = 10/237 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L +++ LVTG+  GIG   AL  A  GA VI  GR+ ++LE + + ++     +  I   
Sbjct: 11  LKDKVILVTGAGDGIGREAALTYAAHGATVILLGRTSAKLEAVYDQIEAAGHPLPAIVPV 70

Query: 75  DLRD---SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+    S+ L + +T+ A+++G+LD ++ NAG+LG++SP   I+E+ + +V+ VNV + 
Sbjct: 71  DLKGATKSHYLGMAETF-AQQFGRLDGVLFNAGLLGTLSPFEHIQEQEWDEVMQVNVKSE 129

Query: 132 WNIMRSFDPWLKKS--HCGRAIIL--SSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           + + ++  P ++++    G A I+  SS      R  WG Y+ SK AIE +    + E  
Sbjct: 130 FLLTQALLPLIRQTAKEQGDASIVYTSSSVGRNGRAYWGTYAISKFAIEGMMEVLADELE 189

Query: 188 NTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC-ATQKIETGKLF 243
           NT +RV  ++PG TRT MRA A PAEDP  +  P  +  +  +L  A  + +TG+ F
Sbjct: 190 NTGVRVNTLNPGGTRTKMRASAFPAEDPMNLKTPADLMPLYLYLMGADSRGKTGQTF 246


>gi|71064704|ref|YP_263431.1| short chain dehydrogenase [Psychrobacter arcticus 273-4]
 gi|71037689|gb|AAZ17997.1| probable short-chain dehydrogenase protein [Psychrobacter arcticus
           273-4]
          Length = 295

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 123/221 (55%), Gaps = 6/221 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           LD +  LVTG+  GIG   AL  AR GA V+  GR+ S+LE + + ++    K+  +   
Sbjct: 57  LDGKTILVTGAGDGIGRVAALTYARYGATVLLLGRTSSKLEYVYDEIESFGGKQPAMLPM 116

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +   E+ K    I +  G+LD ++ NAG+LG ++P+       FA V+ +N  + +
Sbjct: 117 NLEGATYAEMQKLENLIHREVGQLDGILHNAGMLGPLTPLEMYDVDMFAQVMKINFTSTF 176

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + ++  P LK +  G  +  SS      R  WGAY+ SK A+E ++  +++ET NT  L
Sbjct: 177 MLTQALLPLLKDAPQGSIVFTSSSVGTHPRAFWGAYALSKQAVEGMSDIFTQETQNTTNL 236

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
           R   I+PG TRT+MRA A P E+P ++  P+ +  +  ++C
Sbjct: 237 RFNCINPGGTRTNMRAHAYPGENPMSLKTPEDI--MAGYVC 275


>gi|71279221|ref|YP_267934.1| short chain dehydrogenase [Colwellia psychrerythraea 34H]
 gi|71144961|gb|AAZ25434.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Colwellia psychrerythraea 34H]
          Length = 245

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 128/235 (54%), Gaps = 5/235 (2%)

Query: 8   NNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN- 66
           N S    NL N+  LVTG+  GIG   AL  A+ GA VI  G+++S+LE + + +  +  
Sbjct: 3   NYSTKDANLSNKTILVTGAGAGIGRTAALTYAQLGATVILLGKTVSKLEAVYDEIVALGL 62

Query: 67  KKIDIFAFDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADV 123
            +  I   DL+ +   N ++++ T I+ ++G LD ++ NA ILG ++P  Q+ E+ F DV
Sbjct: 63  AEPAIIPLDLKGATKQNYIDMSST-ISSQFGHLDGVLLNASILGELTPFTQMHEQVFNDV 121

Query: 124 ISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWS 183
           + VNV A   + ++  P L  +     +  SSG   + R  WG YS SK A E + +  +
Sbjct: 122 MKVNVTAQCLLAQTLIPTLLLAPNASLVFTSSGVGSQGRAYWGQYSISKFATEGMMQVIA 181

Query: 184 KETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
            E   + LR   I+PG T T+MR+ A PAED + +  P+ +  +  +L +   +E
Sbjct: 182 DEYEGSNLRTNAINPGATNTNMRSCAFPAEDKDELATPEDIMPLYVYLMSDDSLE 236


>gi|223365959|pdb|3G1T|A Chain A, Crystal Structure Of Short Chain Dehydrogenase From
           Salmonella Enterica Subsp. Enterica Serovar Typhi Str.
           Ct18
          Length = 258

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 125/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  AR GA VI  GR+    EKL+   Q I  +  +    
Sbjct: 12  LQNRIILVTGASDGIGREAALTYARYGATVILLGRN---EEKLRRVAQHIADEQHVQPQW 68

Query: 72  FAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL    A E  +    IA  + +LD ++ NAG+LG I P+ +   + + DV+ VNV 
Sbjct: 69  FTLDLLTCTAEECRQVADRIAAHYPRLDGVLHNAGLLGEIGPMSEQDPQIWQDVMQVNVN 128

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N 
Sbjct: 129 ATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNR 188

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
           +LRV  I+PG TRTSMRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 189 SLRVNCINPGGTRTSMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 248

Query: 249 R 249
           R
Sbjct: 249 R 249


>gi|326794744|ref|YP_004312564.1| short-chain dehydrogenase/reductase SDR [Marinomonas mediterranea
           MMB-1]
 gi|326545508|gb|ADZ90728.1| short-chain dehydrogenase/reductase SDR [Marinomonas mediterranea
           MMB-1]
          Length = 249

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 127/221 (57%), Gaps = 6/221 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ +  LVTG+  GIG   AL+ A  GA VI  GR+  +LE + + +++    +  I   
Sbjct: 11  LEGKTVLVTGAGDGIGKEAALQYAAHGATVILLGRTPKKLEDVYDLIEEQGYPQPAIVPI 70

Query: 75  DLRDSNA---LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           +L ++N     EL  T ++  + +LD L+ NA +LG+ +P+     ++F  V+ VNV + 
Sbjct: 71  NLENANEHDYQELANT-LSTEFPQLDGLLLNASVLGTRTPLSDYDSETFEQVMKVNVNSQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA- 190
           + + +S  P L+ S+    I  +S    K R  WGAYS SK A EA+ + +S+E   T+ 
Sbjct: 130 FMLTQSLIPLLRNSNSASIIFTTSTVGRKARAFWGAYSISKFATEAMMQLFSEELAQTSN 189

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           +RV  I+PG TRT+MRA A PAEDP T+  P+++  +  +L
Sbjct: 190 IRVNAINPGATRTNMRACAYPAEDPQTLKSPEELMPLYLYL 230


>gi|157374831|ref|YP_001473431.1| short chain dehydrogenase [Shewanella sediminis HAW-EB3]
 gi|157317205|gb|ABV36303.1| short-chain dehydrogenase/reductase SDR [Shewanella sediminis
           HAW-EB3]
          Length = 245

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/226 (33%), Positives = 124/226 (54%), Gaps = 5/226 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L N+  LVTG+  GIG   AL  A  GA VI  G+++ +LE + + +++    K  I   
Sbjct: 11  LINKTILVTGAGDGIGRAAALSFAEHGATVILLGKTVKKLEAVYDEIEQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N L++ +T I +++G LD L+ NA +LG + P   I   S  +V+ VNV+A 
Sbjct: 71  DLKGATEQNYLDMAET-IEEQFGHLDGLLHNASMLGVLGPFEHISMDSVNEVMQVNVIAE 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P +KK+     +  SSG   + R  WG Y+ SK A E + ++ + E   + +
Sbjct: 130 IMMTKALLPVMKKAPQASLVFTSSGVGRQGRAFWGEYAISKFATEGMMQSIAHEYEGSNI 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
           RV +I+PG TRT+MRA A PAE+P T+    ++     +L     +
Sbjct: 190 RVNSINPGATRTAMRANAYPAENPQTLKTAAEIMATYLYLMGNDSV 235


>gi|16760163|ref|NP_455780.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765061|ref|NP_460676.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29142066|ref|NP_805408.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413357|ref|YP_150432.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161613793|ref|YP_001587758.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167549774|ref|ZP_02343532.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167993772|ref|ZP_02574865.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168230156|ref|ZP_02655214.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168241296|ref|ZP_02666228.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168260061|ref|ZP_02682034.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168462808|ref|ZP_02696739.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168819540|ref|ZP_02831540.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194443675|ref|YP_002040971.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448259|ref|YP_002045764.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472871|ref|ZP_03078855.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|197250533|ref|YP_002146309.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197265166|ref|ZP_03165240.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197362281|ref|YP_002141918.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198243109|ref|YP_002215424.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205352609|ref|YP_002226410.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856770|ref|YP_002243421.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213163151|ref|ZP_03348861.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213424434|ref|ZP_03357247.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213647995|ref|ZP_03378048.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213855227|ref|ZP_03383467.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|238911891|ref|ZP_04655728.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289829091|ref|ZP_06546771.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25283262|pir||AC0654 hypothetical oxidoreductase STY1333 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16420247|gb|AAL20635.1| putative oxoacyl-(acyl carrier protein) reductase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16502457|emb|CAD08414.1| hypothetical oxidoreductase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137695|gb|AAO69257.1| hypothetical oxidoreductase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56127614|gb|AAV77120.1| hypothetical oxidoreductase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161363157|gb|ABX66925.1| hypothetical protein SPAB_01527 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402338|gb|ACF62560.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194406563|gb|ACF66782.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194459235|gb|EDX48074.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|195634342|gb|EDX52694.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197093758|emb|CAR59232.1| hypothetical oxidoreductase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197214236|gb|ACH51633.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197243421|gb|EDY26041.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197937625|gb|ACH74958.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205272390|emb|CAR37270.1| hypothetical oxidoreductase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205325069|gb|EDZ12908.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205328279|gb|EDZ15043.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205335315|gb|EDZ22079.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205339219|gb|EDZ25983.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205343775|gb|EDZ30539.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205351124|gb|EDZ37755.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206708573|emb|CAR32894.1| hypothetical oxidoreductase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261246907|emb|CBG24724.1| hypothetical oxidoreductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993663|gb|ACY88548.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158245|emb|CBW17744.1| hypothetical oxidoreductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912710|dbj|BAJ36684.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320085784|emb|CBY95560.1| oxidoreductase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321224348|gb|EFX49411.1| Putative oxidoreductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322614976|gb|EFY11901.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322621430|gb|EFY18284.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322623228|gb|EFY20070.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322628518|gb|EFY25306.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633682|gb|EFY30422.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638510|gb|EFY35205.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640820|gb|EFY37469.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645316|gb|EFY41844.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322651801|gb|EFY48173.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654302|gb|EFY50624.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659267|gb|EFY55515.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662731|gb|EFY58938.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322667658|gb|EFY63818.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671928|gb|EFY68049.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322677026|gb|EFY73090.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322680312|gb|EFY76351.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685259|gb|EFY81255.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323129989|gb|ADX17419.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323195431|gb|EFZ80610.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199318|gb|EFZ84412.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323204776|gb|EFZ89772.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323205928|gb|EFZ90891.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210424|gb|EFZ95311.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217253|gb|EGA01974.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220714|gb|EGA05159.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323232117|gb|EGA16224.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323234644|gb|EGA18731.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238096|gb|EGA22155.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323243300|gb|EGA27319.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248443|gb|EGA32378.1| putative oxoacyl-(acyl carrier protein) reductase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323252549|gb|EGA36392.1| putative oxoacyl-(acyl carrier protein) reductase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323255426|gb|EGA39192.1| putative oxoacyl-(acyl carrier protein) reductase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323260828|gb|EGA44430.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267585|gb|EGA51068.1| putative oxoacyl-(acyl carrier protein) reductase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323270949|gb|EGA54385.1| putative oxoacyl-(acyl carrier protein) reductase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|326623171|gb|EGE29516.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326627672|gb|EGE34015.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332988606|gb|AEF07589.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 253

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 125/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  AR GA VI  GR+    EKL+   Q I  +  +    
Sbjct: 10  LQNRIILVTGASDGIGREAALTYARYGATVILLGRN---EEKLRRVAQHIADEQHVQPQW 66

Query: 72  FAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL    A E  +    IA  + +LD ++ NAG+LG I P+ +   + + DV+ VNV 
Sbjct: 67  FTLDLLTCTAEECRQVADRIAAHYPRLDGVLHNAGLLGEIGPMSEQDPQIWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N 
Sbjct: 127 ATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
           +LRV  I+PG TRTSMRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 SLRVNCINPGGTRTSMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|204927827|ref|ZP_03219028.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|204323169|gb|EDZ08365.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 253

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 125/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  AR GA VI  GR+    EKL+   Q I  +  +    
Sbjct: 10  LQNRIILVTGASDGIGREAALTYARYGATVILLGRN---EEKLRRVAQHIANEQHVQPQW 66

Query: 72  FAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL    A E  +    IA  + +LD ++ NAG+LG I P+ +   + + DV+ VNV 
Sbjct: 67  FTLDLLTCTAEECRQVADRIAAHYPRLDGVLHNAGLLGEIGPMSEQDPQIWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N 
Sbjct: 127 ATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
           +LRV  I+PG TRTSMRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 SLRVNCINPGGTRTSMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|109898500|ref|YP_661755.1| short-chain dehydrogenase/reductase SDR [Pseudoalteromonas
           atlantica T6c]
 gi|109700781|gb|ABG40701.1| short-chain dehydrogenase/reductase SDR [Pseudoalteromonas
           atlantica T6c]
          Length = 247

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 127/232 (54%), Gaps = 4/232 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L ++  LVTG+  GIG   AL+ A+ GA VI  GR++S+LE + + +      +  I   
Sbjct: 11  LASKTILVTGAGDGIGKEAALQFAKYGATVILLGRTVSKLEAVYDKIVDNGGPEPAIIPL 70

Query: 75  DLRDSNALEL--TKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL+ +         + I  ++  LD ++ NA +LG + P+ QI E+ +  V+ VNV + +
Sbjct: 71  DLQGATVQHYRDMASTIDAQFPSLDGVLHNASLLGHLEPLQQISEEDWNKVMQVNVNSQF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P LKKS     +  +S    K R  WG+Y+ SK A + +    + E  NT++R
Sbjct: 131 FMTQALIPVLKKSDNASIVFTTSSVGLKGRAYWGSYAISKFATQGMMEVIADENENTSIR 190

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF 243
              I+PG TRT+MRA+A P EDP T+  P  +  +  +L + + + ETG+ F
Sbjct: 191 ANCINPGGTRTNMRAQAFPGEDPETLKTPADIMPLYLYLMSDESRHETGQTF 242


>gi|262374490|ref|ZP_06067764.1| 2-deoxy-D-gluconate 3-dehydrogenase [Acinetobacter junii SH205]
 gi|262310486|gb|EEY91576.1| 2-deoxy-D-gluconate 3-dehydrogenase [Acinetobacter junii SH205]
          Length = 248

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 122/226 (53%), Gaps = 3/226 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI---NKKIDIF 72
           L +R+ L+TG+  GIG   A+  A  GA V+  GR++++LE + + ++ +      I   
Sbjct: 13  LKDRIILITGAGDGIGRAAAISYALHGATVVLHGRTLNKLEVIYDEIEGLGAPQPAILPL 72

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
                 S+  EL    + +++G+LD ++ NAG+LG    +       + DV++VN+ A +
Sbjct: 73  QLSTASSHDYELLVDTLEQQFGRLDGILHNAGMLGDRVELAHYPVDVWDDVMAVNLRAPF 132

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L+KS     +  SS    + R LWGAYS SK AIEA+++ ++ E     +R
Sbjct: 133 ALTQALLPLLEKSDRASVVFTSSSVGREARALWGAYSVSKVAIEAMSKIFAAENTYPNIR 192

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
              I+PG TRT+MRAKA P EDP  +P P  +     +L     +E
Sbjct: 193 FNCINPGGTRTAMRAKAYPEEDPKVLPTPDSIMPAYLYLMGDDSLE 238


>gi|62180284|ref|YP_216701.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62127917|gb|AAX65620.1| putative oxoacyl-(acyl carrier protein) reductase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|322714758|gb|EFZ06329.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 253

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 124/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  AR GA VI  GR+    EKL+   Q I  +  +    
Sbjct: 10  LQNRIILVTGASDGIGREAALTYARYGATVILLGRN---EEKLRRVAQHIADEQHVQPQW 66

Query: 72  FAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL    A E  +    IA  + +LD ++ NAG+LG I P+ +   + + DV+ VNV 
Sbjct: 67  FTLDLLTCTAEECRQVADRIAAHYPRLDGILHNAGLLGEIGPMSEQDPQIWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N 
Sbjct: 127 ATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRTSMRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 PLRVNCINPGGTRTSMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|200391003|ref|ZP_03217614.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|224583791|ref|YP_002637589.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|199603448|gb|EDZ01994.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|224468318|gb|ACN46148.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 253

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 124/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  AR GA VI  GR+    EKL+   Q I  +  +    
Sbjct: 10  LQNRIILVTGASDGIGREAALTYARYGATVILLGRN---EEKLRRVAQHIADEQHVQPQW 66

Query: 72  FAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL    A E  +    IA  + +LD ++ NAG+LG I P+ +   + + DV+ VNV 
Sbjct: 67  FTLDLLTCTAEECRQVADRIAAHYPRLDGVLHNAGLLGEIGPMSEQDPQIWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N 
Sbjct: 127 ATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRTSMRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 PLRVNCINPGGTRTSMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|91793825|ref|YP_563476.1| short chain dehydrogenase [Shewanella denitrificans OS217]
 gi|91715827|gb|ABE55753.1| short-chain dehydrogenase/reductase SDR [Shewanella denitrificans
           OS217]
          Length = 245

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 122/228 (53%), Gaps = 5/228 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L N+  LVTG+  GIG   A+E A+ GA VI  G+++ +LE + + +         I   
Sbjct: 11  LINKTILVTGAGDGIGKAAAIEFAKFGATVILLGKTVKKLENVYDIIVNAGYPTPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + +  ++  T IA+++G LD L+ NA  LG++ P   I   S  D++ VNV A 
Sbjct: 71  DLKGATEQHYKDMADT-IAEQFGHLDGLLHNASQLGALGPFEHIDLTSLEDIMKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++K+  G  I  SSG   + +  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VLLTKALLPIMRKAPSGSIIFTSSGVGRQGKAYWGPYAFSKFATEGMMQVLAHECDGTSI 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIET 239
           RV +I+PG TRT MRAKA P EDP ++   + +     FL     + T
Sbjct: 190 RVNSINPGATRTEMRAKAYPGEDPMSLKAAEDIMPTYLFLMGEDSVNT 237


>gi|221134640|ref|ZP_03560943.1| short chain dehydrogenase [Glaciecola sp. HTCC2999]
          Length = 249

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 120/225 (53%), Gaps = 11/225 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAF 74
           L  ++ L+TG+  GIG   AL  A  GA VI  G+++ +LE + + +    +K+  I   
Sbjct: 13  LVGKIILITGAGDGIGKQAALTFAEHGAEVILLGKTVKKLESVYDEIMANGHKEPGIIPL 72

Query: 75  DLRDSNALELTKTYI------AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           D+  + A E  K YI        ++G+LD ++ NA ILG + P  QI  + F DV+ VNV
Sbjct: 73  DM--AGATE--KHYIDMGAMLLDQYGRLDGVLHNASILGHLCPFNQITAQEFNDVMQVNV 128

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A + + +   P L+K+     +  +S    + R  WG YS SK A E + +  + E  N
Sbjct: 129 TAQFLMTQGILPALQKAKASSIVFTTSSVGREGRAFWGTYSISKFATEGMMQVMASEYAN 188

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           + +RV  I+PG TRT+MR KA PAEDP  +  P+ +     +L +
Sbjct: 189 SHIRVNCINPGATRTTMRGKAFPAEDPQLLKTPKDIMPAYVYLMS 233


>gi|163750233|ref|ZP_02157475.1| short chain dehydrogenase [Shewanella benthica KT99]
 gi|161330089|gb|EDQ01073.1| short chain dehydrogenase [Shewanella benthica KT99]
          Length = 245

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 123/222 (55%), Gaps = 5/222 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L N+  L+TG+  GIG   A+  A+ GA VI  G+++ +LE + + + Q    K  I   
Sbjct: 11  LINKTILITGAGDGIGRAAAISFAKHGATVILLGKTVKKLEAVYDRIVQAGYPKPAIIPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N +++ +T I +++G LD  + NA +LG + P   I   S  +V+ VNV+A 
Sbjct: 71  DLKGATEQNYVDMAET-IEEQFGHLDGALHNASLLGVLGPFEHISMDSVKEVMQVNVIAE 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + R+  P +KK+     +  SS    + R  WG Y+ SK A E + ++ + E   ++L
Sbjct: 130 IMMTRALLPIMKKAPKASLVFTSSAVGRQGRAFWGEYAISKFATEGMMQSIADEYEGSSL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           RV +I+PG TRT MRA A PAE+P+T+  P+ +     +L  
Sbjct: 190 RVNSINPGATRTGMRANAYPAENPSTLKEPEDIMATYLYLMG 231


>gi|300723347|ref|YP_003712650.1| putative oxoacyl-(acyl carrier protein) reductase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629867|emb|CBJ90485.1| putative oxoacyl-(acyl carrier protein) reductase with
           NAD(P)-binding domain [Xenorhabdus nematophila ATCC
           19061]
          Length = 254

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 125/223 (56%), Gaps = 5/223 (2%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDI 71
           H  L  ++ LVTG+  GIG   AL  AR GA VI  GR+ ++LE +K  ++ +      +
Sbjct: 8   HDLLQQKIILVTGAGDGIGREVALTYARHGAQVILLGRTAAKLEAVKQQIENEGGLPASV 67

Query: 72  FAFDLRDSNALELTKTY---IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           +  DL    A E  +T+   +A+R+  LD ++ NAG+LG ++P+ +   + + DV+ VNV
Sbjct: 68  YTMDLLTVTAEE-CQTFAKELAQRYSCLDGVLHNAGLLGVVAPVVEQPVQLWHDVMQVNV 126

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A + + ++  P L KS  G  +  SS    + R  WGAYS SK A E   +  ++E  +
Sbjct: 127 NATFMLTQALIPLLLKSASGSLVFTSSSVGREGRSGWGAYSVSKFATEGFMQVLTQEYQD 186

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           TALR+  I+PG TRT+MRA A P E+   +  P ++  +  ++
Sbjct: 187 TALRINCINPGGTRTNMRATAFPDENSAKLKTPAEIMPVYLYI 229


>gi|168237770|ref|ZP_02662828.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194738279|ref|YP_002114749.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|194713781|gb|ACF93002.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197289214|gb|EDY28581.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 253

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 124/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  AR GA VI  GR+    EKL+   Q I  +  +    
Sbjct: 10  LQNRIILVTGASDGIGREAALTYARYGATVILLGRN---EEKLRRVAQHIADEQHVQPQW 66

Query: 72  FAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL    A E  +    IA  + +LD ++ NAG+LG I P+ +   + + DV+ VNV 
Sbjct: 67  FTLDLLTCTAEECRQVADRIAAHYPRLDGVLHNAGLLGEIGPMSEQDPQIWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N 
Sbjct: 127 ATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
           +LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 SLRVNCINPGGTRTGMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|269467903|gb|EEZ79642.1| dehydrogenase [uncultured SUP05 cluster bacterium]
          Length = 250

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 122/221 (55%), Gaps = 3/221 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG++RG G    L+LA++GA VI  GR +  LE + + +  +  ++  ++  
Sbjct: 14  LTDKVILVTGANRGFGRAMTLDLAKAGATVIMLGRDLGSLESVYDEVVDLGYQEPVLYPL 73

Query: 75  DLRDSNA--LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +     E  +  + + + +LD LI NA I+G++ PI Q   K +   + +NV A +
Sbjct: 74  DLEGATPEHYEQLQANLLENFDQLDGLIHNASIIGTMMPIEQYDIKLWYSTMQINVNAVF 133

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + +   P L KS   R + LSS      R  WGAY  SK AIE L++T S+E   T +R
Sbjct: 134 MLTQFLIPVLNKSDDARILFLSSSVGRSARAYWGAYGVSKFAIEGLSKTLSEELEKTNIR 193

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           V ++DP   RT MR  A PAE+ +  P P+ ++  I +L +
Sbjct: 194 VNSLDPKRMRTKMRQTAYPAENADNNPTPESISPAIVYLMS 234


>gi|197285196|ref|YP_002151068.1| short chain dehydrogenase [Proteus mirabilis HI4320]
 gi|227355621|ref|ZP_03840015.1| possible 3-oxoacyl-[acyl-carrier-protein] reductase [Proteus
           mirabilis ATCC 29906]
 gi|194682683|emb|CAR42832.1| putative short chain dehydrogenase [Proteus mirabilis HI4320]
 gi|227164228|gb|EEI49121.1| possible 3-oxoacyl-[acyl-carrier-protein] reductase [Proteus
           mirabilis ATCC 29906]
          Length = 254

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 127/230 (55%), Gaps = 5/230 (2%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDI 71
           H  L +++ LVTG+  GIG   AL  AR GA +I  GR++S+LE ++N +     ++  +
Sbjct: 8   HTVLRDKIILVTGAGDGIGKEAALTYARYGATLILLGRTLSKLEDVQNEIITSGGQQPML 67

Query: 72  FAFDL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           +  DL    +++  E   T I KR+  LD ++ NAG+LG + PI       + DV+ VNV
Sbjct: 68  YPLDLLTASENDYQEFADT-IVKRFPHLDGVLQNAGLLGVVEPIINQPSTLWHDVMQVNV 126

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A + + ++  P + K+     I+ +S    + R  WGAYS SK A E L +   +E  +
Sbjct: 127 NATFMLTKALIPLMLKAPHASLILTTSSVGRQGRYGWGAYSVSKFATEGLMQVLHEEYKD 186

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           ++LR+  I+PG TRTSMRA A P E+   +  P+ +  +  +L +   IE
Sbjct: 187 SSLRINCINPGGTRTSMRASAFPDENAQKLKTPKDLMPLYLYLMSDDSIE 236


>gi|327394040|dbj|BAK11462.1| short chain dehydrogenase YciK [Pantoea ananatis AJ13355]
          Length = 253

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/238 (35%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L NRL LVTG+S GIG   AL  AR GA VI  GRS  +L++ + A+ ++NK       F
Sbjct: 10  LANRLILVTGASDGIGREAALTYARFGAEVILLGRSAEKLQQAEEAINQLNKCPAHSVVF 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL ++      +    +A+R+  LD ++ NA ILG I+P+ ++    +  V+ +NV A +
Sbjct: 70  DLSEATPAHCHQLAGQLAQRFSHLDGVLHNASILGDITPLAELDPLVWQQVMKINVDATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  +S      R  WGAY+ SK A E + +  + E  N ALR
Sbjct: 130 FLTQALLPLLLKSDSGSLVFTTSSVGRTGRAGWGAYAVSKFATEGMMQVLADEYKNHALR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT MRA A P ED + +  P  +  +  +L     + +TG  F     R
Sbjct: 190 VNCINPGGTRTKMRASAFPQEDASKLKTPADIMPLYLYLMGDDSRRKTGISFDAQPGR 247


>gi|253989547|ref|YP_003040903.1| short chain dehydrogenase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780997|emb|CAQ84159.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 254

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI-DI 71
           H  L  R+ LVTG+  GIG   AL  AR GA VI  G++  +LE +K  +++       I
Sbjct: 8   HDLLHQRIILVTGAGDGIGREVALTYARYGAQVILLGKTTHKLEAVKKEIEQAGGTTATI 67

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           +  DL    A E  +    +AK + +LD ++ NAG+LG+++P+ +   + + DV+ VNV 
Sbjct: 68  YTLDLLTITAEECKEFADDLAKYYPRLDGVLHNAGLLGAVAPMVEQPVQLWHDVMQVNVN 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  I  SS    + R  WGAYSASK A E + +  + E  N+
Sbjct: 128 ATFMLTQALLPLLLKSPDGSLIFTSSSVGREGRSGWGAYSASKFATEGMMQVLAAEYKNS 187

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLFSVPQN 248
           +LRV  I+PG TRT+MRAKA P E+   +  P ++  +  +L  +  + +TG  F     
Sbjct: 188 SLRVNCINPGGTRTNMRAKAFPNENSAKLKTPAEIMPLYLYLMGSDSLHKTGISFDAQPG 247

Query: 249 R 249
           R
Sbjct: 248 R 248


>gi|262165296|ref|ZP_06033033.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           mimicus VM223]
 gi|262025012|gb|EEY43680.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           mimicus VM223]
          Length = 247

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 126/227 (55%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  ++ LVTG+  GIG   A+  A  GA VI  GR++ +LE+  +A++        I   
Sbjct: 10  LKEKVILVTGAGDGIGKQAAISFAAHGATVILLGRTVKKLEQTYDAIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I +++G+LD ++ NA +LG +SP  QI E SF +V+ VNV A 
Sbjct: 70  DMKGATKQNYLDMVDT-IEEQFGRLDGVLHNASLLGVLSPFDQIGEDSFDEVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  SS   +  R  W  Y+ SK A E + +  + E  ++ +
Sbjct: 129 FLLTQALLPLLHKSADARIVFTSSTVGHIGRAFWATYAISKFATEGMMQILADELSDSTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT MRAKA PAED + +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTGMRAKAYPAEDADKLKTPLDIMPLYLYLMAPEGRE 235


>gi|258626254|ref|ZP_05721101.1| short chain dehydrogenase [Vibrio mimicus VM603]
 gi|258581306|gb|EEW06208.1| short chain dehydrogenase [Vibrio mimicus VM603]
          Length = 247

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 126/227 (55%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  ++ LVTG+  GIG   A+  A  GA VI  GR++ +LE+  +A++        I   
Sbjct: 10  LKEKVILVTGAGDGIGKQAAISFAAHGATVILLGRTVKKLEQTYDAIEAAGYPTPAIVPL 69

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++ +   N L++  T I +++G+LD ++ NA +LG +SP  QI E SF +V+ VNV A 
Sbjct: 70  DMKGASKQNYLDMVDT-IEEQFGRLDGVLHNASLLGVLSPFDQIGEDSFDEVMQVNVKAQ 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS   R +  SS   +  R  W  Y+ SK A E + +  + E  ++ +
Sbjct: 129 FLLTQALLPLLHKSPDARIVFTSSTVGHIGRAFWATYAISKFATEGMMQILADELSDSTI 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG TRT MRAKA PAED + +  P  +  +  +L A +  E
Sbjct: 189 RVNAINPGGTRTGMRAKAYPAEDADKLKTPLDIMPLYLYLMAPEGRE 235


>gi|332306443|ref|YP_004434294.1| short-chain dehydrogenase/reductase SDR [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173772|gb|AEE23026.1| short-chain dehydrogenase/reductase SDR [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 247

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L ++  LVTG+  GIG   AL+ A+ GA VI  GR++S+LE + + +      +  I   
Sbjct: 11  LTSKTILVTGAGDGIGKEAALQFAKYGATVILLGRTVSKLEAVYDEIVANGGAEPAIIPL 70

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ +   +  ++  T I  ++  LD ++ NA +LG + P  QI E  + +V+ VNV + 
Sbjct: 71  DLQGATPQHYRDMANT-IDNQFASLDGVLHNASLLGHLEPFQQINEDDWNNVMQVNVNSQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P +KKS     +  +S    K R  WG+YS SK A + +    + E  NT++
Sbjct: 130 FFMTQALIPVMKKSTNASLVFTTSSVGLKGRAYWGSYSISKFATQGMMEVIADENENTSI 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA-TQKIETGKLF 243
           R   I+PG TRT+MRA+A PAED + +  P+++  +  +L +   K E+GK F
Sbjct: 190 RANCINPGGTRTNMRAQAYPAEDASKLKTPEEIMPLYLYLMSDASKHESGKTF 242


>gi|226952292|ref|ZP_03822756.1| short chain dehydrogenase [Acinetobacter sp. ATCC 27244]
 gi|294648762|ref|ZP_06726220.1| oxoacyl-(acyl carrier protein) reductase [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226836958|gb|EEH69341.1| short chain dehydrogenase [Acinetobacter sp. ATCC 27244]
 gi|292825332|gb|EFF84077.1| oxoacyl-(acyl carrier protein) reductase [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 248

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 124/226 (54%), Gaps = 3/226 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ L+TG+  GIG   A+  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKDRIILITGAGDGIGRAAAMSYALHGATVVLHGRTLNKLEVIYDEIEALGAPQPAILPL 72

Query: 75  DLR--DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            L    S+  EL    + +++G+LD ++ NAG+LG    +       + DV++VN+ A +
Sbjct: 73  QLSTASSHDYELLVDTLEQQFGRLDGILHNAGMLGDRVELANYPVDVWDDVMAVNLRAPF 132

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L+KS     I  SSG   + R LWGAYS SK A EA+++ ++ E     +R
Sbjct: 133 ALTQALLPLLEKSDHASVIFTSSGVGREARALWGAYSVSKIATEAMSKIFALENSFPNIR 192

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
              I+PG TRT+MRAKA P EDP  +P P  +     +L     ++
Sbjct: 193 YNCINPGGTRTAMRAKAYPDEDPKVLPTPDSIMPAYLYLMGDDSLD 238


>gi|170727247|ref|YP_001761273.1| short chain dehydrogenase [Shewanella woodyi ATCC 51908]
 gi|169812594|gb|ACA87178.1| short-chain dehydrogenase/reductase SDR [Shewanella woodyi ATCC
           51908]
          Length = 245

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 124/227 (54%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L N+  LVTG+  GIG   A+  A+ GA VI  G+++ +LE + + +++    K  I   
Sbjct: 11  LINKTILVTGAGDGIGRAAAISFAKHGATVILLGKTVKKLEAVYDVIEQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N +++ +T I +++G LD L+ NA +LG + P   I   S  +V+ VNV+A 
Sbjct: 71  DLKGATEQNYIDMAET-IEQQFGHLDGLLHNASMLGVLGPFEHISMDSVKEVMQVNVIAE 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P +KK+     +  SS    + +  WG Y+ SK A E + +  + E   + +
Sbjct: 130 VMMTKALLPVMKKAPQASLVFTSSSVGRQGKAFWGEYAISKFATEGMMQAIAHEYDGSNV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           R  +I+PG TRT MRA A PAE+P ++  P+++     +L     +E
Sbjct: 190 RANSINPGATRTGMRANAYPAENPQSIKAPEEIMATYLYLMGNDSLE 236


>gi|94499384|ref|ZP_01305921.1| short chain dehydrogenase [Oceanobacter sp. RED65]
 gi|94428138|gb|EAT13111.1| short chain dehydrogenase [Oceanobacter sp. RED65]
          Length = 245

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 135/237 (56%), Gaps = 8/237 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL--QKINKKIDIFA 73
           LD R+ LVTG+S+GIG       A +GA VI   R+   L  + + L  +K+ + + I  
Sbjct: 10  LDQRVILVTGASKGIGRAMVYGFAEAGATVIMLARNEEALNHIHDDLVAKKLPQPV-IVQ 68

Query: 74  FDLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           FDL  +   A    +  I + +G+LD L+ NA +LG  +P+     +++  V+++NV + 
Sbjct: 69  FDLEHAPEEAYFQLRDMINEEFGRLDGLLLNASLLGQRTPLSNYNWQTWNRVMNINVNST 128

Query: 132 WNIMRSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
           + + R+  P +++S    +I++ SS    K +  WGAY+ SK A E L +T ++E  NT+
Sbjct: 129 FLLARTLLPVMEQSPADASILMTSSSVGRKSKAYWGAYAVSKFATEGLMQTMAEELENTS 188

Query: 191 -LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQK-VAKIISFLCATQKIETGKLFSV 245
            +RV +I+PG TRT MRA+A PAEDP TV  P+  VA+ I  + A  K   G+   +
Sbjct: 189 NVRVNSINPGGTRTDMRAEAYPAEDPATVKSPEDLVARYIYLMSAESKGINGQALDI 245


>gi|291617612|ref|YP_003520354.1| YciK [Pantoea ananatis LMG 20103]
 gi|291152642|gb|ADD77226.1| YciK [Pantoea ananatis LMG 20103]
          Length = 259

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 126/243 (51%), Gaps = 14/243 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L NRL LVTG+S GIG   AL  AR GA VI  GRS  +L++ + A+ ++NK       F
Sbjct: 16  LANRLILVTGASDGIGREAALTYARFGAEVILLGRSAEKLQQTEEAINQLNKCPAHSVVF 75

Query: 75  DLRDSNALELTKTY-------IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
           DL      E T  Y       +A+R+  LD ++ NA ILG I+P+ ++    +  V+ +N
Sbjct: 76  DLS-----EATPAYCHQLAGQLAQRFSHLDGVLHNASILGDITPLAELDPLVWQQVMKIN 130

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           V A + + ++  P L KS  G  +  +S      R  WGAY+ SK A E + +  + E  
Sbjct: 131 VDATFFLTQALLPLLLKSDSGSLVFTTSSVGRTGRAGWGAYAVSKFATEGMMQVLADEYK 190

Query: 188 NTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVP 246
           N ALRV  I+PG TRT MRA A P ED + +  P  +  +  +L     + +TG  F   
Sbjct: 191 NHALRVNCINPGGTRTKMRASAFPQEDASKLKTPADIMPLYLYLMGDDSRRKTGISFDAQ 250

Query: 247 QNR 249
             R
Sbjct: 251 PGR 253


>gi|332141315|ref|YP_004427053.1| short chain dehydrogenase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551337|gb|AEA98055.1| short chain dehydrogenase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 248

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 124/227 (54%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKL-KNALQKINKKIDIFAF 74
           L +++ LVTG+  GIG   A   A  GA  I  GR++S+LE +  + ++   ++  I   
Sbjct: 11  LRDKVILVTGAGDGIGAQAAKTYAAHGAICILLGRTVSKLEAVYDDIVEAGGQEPAIVPL 70

Query: 75  DLRD---SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++    S+  ++T+T I  ++G+LD ++ NA ILG +S    I  + + DV+ VNV   
Sbjct: 71  DIKGATPSHYQQMTQTII-DQFGRLDGVLHNASILGHLSAFKDIDAEEWQDVMQVNVNGM 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P L+K+     I  +S    K R  WG Y+ SK A E + +T + E  N  L
Sbjct: 130 VYMTQALIPALEKAENASVIFTTSSVGRKGRAFWGTYAVSKFATEGVMQTLADEYQNKTL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           R   I+PG TRT MRA+A PAE+P+T+  P+ +  +  +L     IE
Sbjct: 190 RFNCINPGGTRTQMRAQAFPAENPDTLKTPEDIMPMYLYLMGNDSIE 236


>gi|255320670|ref|ZP_05361847.1| short-chain dehydrogenase/reductase SDR [Acinetobacter
           radioresistens SK82]
 gi|262380697|ref|ZP_06073850.1| 2-deoxy-D-gluconate 3-dehydrogenase [Acinetobacter radioresistens
           SH164]
 gi|255302286|gb|EET81526.1| short-chain dehydrogenase/reductase SDR [Acinetobacter
           radioresistens SK82]
 gi|262297645|gb|EEY85561.1| 2-deoxy-D-gluconate 3-dehydrogenase [Acinetobacter radioresistens
           SH164]
          Length = 248

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 124/221 (56%), Gaps = 3/221 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L N++ L+TG+  GIG   AL  A  GA V+  GR++++LE + + ++ +   +  I   
Sbjct: 13  LKNQVILITGAGDGIGRAAALSYALHGATVVLHGRTLNKLEVIYDEIEALGAPQPAILPL 72

Query: 75  DLRDSNA--LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            L  ++A   E     + K++G+LD ++ NAGILG    +     + + DV++VN+ A +
Sbjct: 73  QLSSASAQDYEHLVNILDKQFGRLDGILHNAGILGERIELAHYPAEVWDDVMAVNLRAPF 132

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L+KS     +  SSG   + R  WGAYS SK AIEA+++ ++ E  +  +R
Sbjct: 133 VLTQALLPLLQKSEHASVVFASSGVGREVRERWGAYSVSKIAIEAVSKLFAVENQHPNIR 192

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
              I+PG TRT+MRAKA P EDP  +  P+ +     +L  
Sbjct: 193 FNCINPGATRTAMRAKAFPDEDPKVLATPETIMPAYLYLMG 233


>gi|283785435|ref|YP_003365300.1| short chain dehydrogenase [Citrobacter rodentium ICC168]
 gi|282948889|emb|CBG88491.1| putative short chain dehydrogenase [Citrobacter rodentium ICC168]
          Length = 253

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 125/241 (51%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDI 71
           H  L  R+ LVTG+S GIG   AL  AR GA VI  GR+  +L ++   +  +  ++   
Sbjct: 7   HDLLQGRIILVTGASDGIGREAALTYARFGASVILLGRNDEKLRRVAETMSTETGRQPQW 66

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL    A +  +    I++ + +LD ++ NAG+LG I P+ +   + +  V+ VNV 
Sbjct: 67  FTLDLLTCTADDCRQLAERISEHYPRLDGVLHNAGLLGDIRPMSEQDPQVWQQVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS CG  +  SS    + R  WGAY+ SK A E + +  + E  N 
Sbjct: 127 ATFMLTQALLPLLLKSDCGSLVFTSSSVGRQGRANWGAYAVSKFATEGMMQVLADEYQNH 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP+ +  P  +  +  +L     + +TG  F     
Sbjct: 187 PLRVNCINPGGTRTGMRASAFPTEDPHKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|308187006|ref|YP_003931137.1| hypothetical oxidoreductase [Pantoea vagans C9-1]
 gi|308057516|gb|ADO09688.1| hypothetical oxidoreductase [Pantoea vagans C9-1]
          Length = 262

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L++R+ LVTG+S GIG   AL  AR GA VI  GR+  +L+++K A+ ++NK       F
Sbjct: 19  LNHRIILVTGASDGIGREAALTYARYGAEVILMGRNPEKLQQVKEAIDQLNKCAAHTVVF 78

Query: 75  DLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL ++      +    +++++ +LD ++ NAGILG I P+ ++  + +  V+++N+ A +
Sbjct: 79  DLAEATPERCHQVAEQLSQQFPRLDGVLHNAGILGEIVPLAELDPQIWQQVMNINLDATF 138

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  +S      R  WGAY+ SK A E + +  + E    ALR
Sbjct: 139 FLTQALLPLLLKSDAGSLVFTTSSVGRTGRAGWGAYAVSKFATEGMMQVLADEYKTQALR 198

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT MRA A P ED N +  P  +  +  +L     + +TG  F     R
Sbjct: 199 VNCINPGGTRTKMRASAFPQEDANKLKTPADLMPLYLYLMGDDSRRKTGISFDAQPGR 256


>gi|148244600|ref|YP_001219294.1| oxidoreductase [Candidatus Vesicomyosocius okutanii HA]
 gi|146326427|dbj|BAF61570.1| oxidoreductase [Candidatus Vesicomyosocius okutanii HA]
          Length = 250

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 130/247 (52%), Gaps = 7/247 (2%)

Query: 6   SKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI 65
           S N S     L +R+ LVTG++RG G    L+LA++GA VI  GR +S LE   + +   
Sbjct: 4   STNYSITKGELKDRVILVTGANRGFGRAITLDLAKAGASVIMLGRDLSSLENTYDEVINF 63

Query: 66  N-KKIDIFAFDLRDSNA--LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFAD 122
             +K  ++  DL  +     E  +  I   + +LD LI NA I+G++ PI Q   K +  
Sbjct: 64  GYQKPILYPLDLEGATPKHYEQLQKDILNNFEQLDGLIHNASIIGTMMPIEQYDIKLWYS 123

Query: 123 VISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTW 182
            + +N+ A + + +   P L KS   R +  SS      +  WGAY  SK AIE +++T 
Sbjct: 124 TMQININAPFMLTQVLIPVLNKSSDARVLFFSSSVGRVAKAYWGAYGVSKFAIEGISKTL 183

Query: 183 SKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGK 241
           S+E   T ++V ++DPG  RT MR  A PAE+    P P+  + +I +L + +  E  GK
Sbjct: 184 SEELERTNIKVNSLDPGRMRTKMRQIAYPAENIYNNPLPETKSPVIVYLMSEKAKELNGK 243

Query: 242 ---LFSV 245
              LFS+
Sbjct: 244 QITLFSI 250


>gi|183599263|ref|ZP_02960756.1| hypothetical protein PROSTU_02724 [Providencia stuartii ATCC 25827]
 gi|188021495|gb|EDU59535.1| hypothetical protein PROSTU_02724 [Providencia stuartii ATCC 25827]
          Length = 254

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 127/236 (53%), Gaps = 6/236 (2%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDI 71
           H  L  +  LVTG+  GIG   AL  AR GA +I  GR+  +L+ +   ++ +  K  DI
Sbjct: 8   HDLLSGKTLLVTGAGDGIGREAALTYARFGASLILVGRTQHKLDAVSQEIETLTGKAADI 67

Query: 72  FAFDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           +  DL  +     +EL    IAK+   LD ++ NAG+LG ++PI +     + DV+ VNV
Sbjct: 68  YVVDLLTAPHEQYVELAND-IAKKHPYLDGVLHNAGLLGVVAPIIEQPVDLWHDVMQVNV 126

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A++ + +   P L K+     +  SS    K R  WGAYS SK A E L +  ++E  N
Sbjct: 127 NASFMLTQVLLPLLLKAPTASLVFTSSSVGKKGRADWGAYSVSKFATEGLMQILAEEYKN 186

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLF 243
           + LRV  I+PG TRTSMRA A P EDP T+  P  +  I  +L +   + +TG  F
Sbjct: 187 SGLRVNCINPGRTRTSMRASAAPDEDPMTIKAPADIMPIYLYLMSNDSLRKTGISF 242


>gi|127513337|ref|YP_001094534.1| short chain dehydrogenase [Shewanella loihica PV-4]
 gi|126638632|gb|ABO24275.1| short-chain dehydrogenase/reductase SDR [Shewanella loihica PV-4]
          Length = 245

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 127/234 (54%), Gaps = 6/234 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L ++  LVTG+  GIG   AL  A  GA VI  G+++ +LE + + +++       I   
Sbjct: 11  LKDKTILVTGAGDGIGRAAALAYAEHGATVILLGKTVKKLEAVYDEIEQAGYPTPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++ +T I +++G LD L+ NA +LG + P   I   S  +V+ VN++A 
Sbjct: 71  DLKGATEQNYQDMAET-IEQQFGHLDGLLHNASLLGVLGPFEHISMDSVKEVLQVNLVAE 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P +KK+     +  SS    + R  WG Y+ SK A E + ++ + E  ++ L
Sbjct: 130 IMMTKALLPVMKKAPAASILFTSSSVGRQGRAFWGEYAISKFATEGMMQSLAHEYEDSNL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFS 244
           RV +I+PG TRT MRA A PAE+P  +  P+++     +L     K  TG+ F+
Sbjct: 190 RVNSINPGATRTKMRANAYPAENPQDLKAPEEIMATYLYLMGDDAKGVTGQQFN 243


>gi|330889352|gb|EGH22013.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 246

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 118/222 (53%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  R+ LVTG++RGIG  TA   A  GA V+  GR+ + L ++ + +Q     +  +  F
Sbjct: 11  LKGRIILVTGAARGIGAATAKTYAAHGATVLLLGRTEASLAQVHDEIQAAGHLLPLVIPF 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  ++  +     T I ++ G+LD L+ NA I+G  + +  +  + F  V+ VNV A +
Sbjct: 71  DLESADPAQYHDLATMIERKVGRLDGLLHNASIIGPRTSVEHLPGEDFMQVMHVNVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + ++  P L++S        SS    K R  WGAY  SK A E L +T + E    T++
Sbjct: 131 MLTQALLPLLRRSTDASVAFTSSSVGRKGRAQWGAYGVSKFATEGLMQTLADELEGVTSV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA+A P E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTGMRAQAYPDENPQNNPAPEDIMPVYLYLMG 232


>gi|304396080|ref|ZP_07377962.1| short-chain dehydrogenase/reductase SDR [Pantoea sp. aB]
 gi|304356449|gb|EFM20814.1| short-chain dehydrogenase/reductase SDR [Pantoea sp. aB]
          Length = 262

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 130/238 (54%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L++R+ LVTG+S GIG   AL  AR GA VI  GR+  +L+++  A+ ++N+       F
Sbjct: 19  LNHRIILVTGASDGIGREAALTYARYGAEVILMGRNADKLQQVAQAINQLNQCPAHTVVF 78

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL D+      +    +A+++ +LD ++ NAGILG I P+ ++  + + +V+++N+ A +
Sbjct: 79  DLADATPERCHQIGEQLAQQFPRLDGVLHNAGILGEIVPLAELDPQIWQEVMNINLDATF 138

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  +S      R  WGAY+ SK A E + +  + E    +LR
Sbjct: 139 FLTQALLPLLLKSDAGSLVFTTSSVGRTGRAGWGAYAVSKFATEGMMQVLADEYKTHSLR 198

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT MRA A P ED N +  P  +  +  +L     + +TG  F     R
Sbjct: 199 VNCINPGGTRTKMRASAFPQEDANKLKTPADLMPLYLYLMGDDSRRKTGISFDAQPGR 256


>gi|87119285|ref|ZP_01075183.1| short chain dehydrogenase [Marinomonas sp. MED121]
 gi|86165676|gb|EAQ66943.1| short chain dehydrogenase [Marinomonas sp. MED121]
          Length = 254

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 122/227 (53%), Gaps = 4/227 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   A+  A+ GA VI  GR+  +LE + + ++ +   +  I   
Sbjct: 11  LKDKIILVTGAGDGIGRVAAINYAKHGATVILLGRTTKKLEAVYDEIENLGYPQAAIVPL 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +   +       I   +G+LD L+ NA ILG  + +   +  +F  V+ +NV + +
Sbjct: 71  NLDGATEHDYADLANIIETEFGQLDGLLHNASILGDRTGLANYEASTFEQVMRINVTSQF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + ++  P L+K+        +S    K R  WGAY+ SK A EA+ +  + E  NT+ +
Sbjct: 131 MLTQAVMPLLQKAKSASIAFTTSSVGRKARAYWGAYAVSKFATEAMMQLLADELENTSEI 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           RV  I+PG T TSMR++A PAEDPNT+  P+ +  +  +L     +E
Sbjct: 191 RVNAINPGATATSMRSRAYPAEDPNTIASPEDIMPLYLYLMGDDSLE 237


>gi|330828721|ref|YP_004391673.1| short chain dehydrogenase/reductase family oxidoreductase
           [Aeromonas veronii B565]
 gi|328803857|gb|AEB49056.1| Oxidoreductase, short chain dehydrogenase/reductase family
           [Aeromonas veronii B565]
          Length = 251

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 134/237 (56%), Gaps = 10/237 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L +++ LVTG+  GIG   AL  A  GA VI  GR+ ++LE + + ++     +  I   
Sbjct: 11  LKDKVILVTGAGDGIGREAALTYAAHGATVILLGRTSAKLEAVYDQIEAAGYPLPAIVPV 70

Query: 75  DLRDSNALE---LTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+ + A     + +T+ A+++G+LD ++ NAG+LG++SP   I+EK + +V+ VNV + 
Sbjct: 71  DLKGATAAHYRGMAETF-AQQFGRLDGVLFNAGLLGTLSPFEHIQEKEWDEVMQVNVKSE 129

Query: 132 WNIMRSFDPWLKKSHCGRA----IILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           + + ++  P L+++   +     I  SS    K R  WG Y+ SK AIE +    + E  
Sbjct: 130 FLLTQALLPLLRQTAKAQGDASIIYTSSSVGRKGRAYWGTYAISKFAIEGMMEVLADELE 189

Query: 188 NTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLF 243
           NT +RV  ++PG TRT MRA A PAEDP  +  P  +  +  +L  +  + +TG+ F
Sbjct: 190 NTGVRVNTLNPGGTRTKMRASAFPAEDPMNLKTPADLMPLYLYLMGSDSRGKTGQTF 246


>gi|153001231|ref|YP_001366912.1| short chain dehydrogenase [Shewanella baltica OS185]
 gi|160875903|ref|YP_001555219.1| short chain dehydrogenase [Shewanella baltica OS195]
 gi|151365849|gb|ABS08849.1| short-chain dehydrogenase/reductase SDR [Shewanella baltica OS185]
 gi|160861425|gb|ABX49959.1| short-chain dehydrogenase/reductase SDR [Shewanella baltica OS195]
 gi|315268094|gb|ADT94947.1| short-chain dehydrogenase/reductase SDR [Shewanella baltica OS678]
          Length = 245

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  +  LVTG+  GIG   A+E A+ GA VI  G+++ +LE + + +++    K  I   
Sbjct: 11  LKGKTILVTGAGAGIGRTAAIEFAKHGATVILLGKTVKKLEAVYDVIEQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++  T IA+++  LD L+ NA +LG++ P   I   S  DV+ VNV A 
Sbjct: 71  DLKGATEQNYRDMADT-IAEQFDHLDGLLHNASLLGALGPFEHIDISSLEDVLKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPVMRQAPSASIIFTSSSVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           RV +I+PG TRT MRAKA PAE+P
Sbjct: 190 RVNSINPGATRTEMRAKAYPAENP 213


>gi|126174902|ref|YP_001051051.1| short chain dehydrogenase [Shewanella baltica OS155]
 gi|125998107|gb|ABN62182.1| short-chain dehydrogenase/reductase SDR [Shewanella baltica OS155]
          Length = 245

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  +  LVTG+  GIG   A+E A+ GA VI  G+++ +LE + + +++    K  I   
Sbjct: 11  LKGKTILVTGAGAGIGRTAAIEFAKHGATVILLGKTVKKLEAVYDVIEQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++  T IA+++  LD L+ NA +LG++ P   I   S  DV+ VNV A 
Sbjct: 71  DLKGATEQNYRDMADT-IAEQFDHLDGLLHNASLLGALGPFEHIDIPSLEDVLKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPVMRQAPSASIIFTSSSVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           RV +I+PG TRT MRAKA PAE+P
Sbjct: 190 RVNSINPGATRTEMRAKAYPAENP 213


>gi|157961475|ref|YP_001501509.1| short chain dehydrogenase [Shewanella pealeana ATCC 700345]
 gi|157846475|gb|ABV86974.1| short-chain dehydrogenase/reductase SDR [Shewanella pealeana ATCC
           700345]
          Length = 245

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 122/222 (54%), Gaps = 5/222 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L ++  LVTG+  GIG   A+  A+ GA VI  G+++ +LE + + +++       I   
Sbjct: 11  LKDKTILVTGAGDGIGKAAAIAFAKHGATVILLGKTVKKLEAVYDQIEQAGYPTPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++  T I +++G+LD L+ NA +LG + P   +   +  +V+ VNV+A 
Sbjct: 71  DLKGATEQNYKDMADT-IEEQFGQLDGLLHNASVLGVLGPFEHMTMSTVNEVMQVNVIAE 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++KS     +  SS    + R  WG Y+ SK A E + ++ + E  +T +
Sbjct: 130 IMLTKALLPVMRKSPSASLLFTSSSVGRQGRAYWGEYAISKFATEGMMQSLAHEYEDTNV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           RV +I+PG TRT MRA A PAE+P T+  P ++     +L  
Sbjct: 190 RVNSINPGATRTGMRANAYPAENPQTLKAPDEIMATYLYLMG 231


>gi|304411916|ref|ZP_07393527.1| short-chain dehydrogenase/reductase SDR [Shewanella baltica OS183]
 gi|307303316|ref|ZP_07583071.1| short-chain dehydrogenase/reductase SDR [Shewanella baltica BA175]
 gi|304349776|gb|EFM14183.1| short-chain dehydrogenase/reductase SDR [Shewanella baltica OS183]
 gi|306913676|gb|EFN44098.1| short-chain dehydrogenase/reductase SDR [Shewanella baltica BA175]
          Length = 245

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  +  LVTG+  GIG   A+E A+ GA VI  G+++ +LE + + +++    K  I   
Sbjct: 11  LKGKTILVTGAGAGIGRTAAIEFAKHGATVILLGKTVKKLEAVYDVIEQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++  T IA+++  LD L+ NA +LG++ P   I   S  DV+ VNV A 
Sbjct: 71  DLKGATEQNYRDMADT-IAEQFDHLDGLLHNASLLGALGPFEHIDIPSLEDVLKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPVMRQAPSASIIFTSSSVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           RV +I+PG TRT MRAKA PAE+P
Sbjct: 190 RVNSINPGATRTEMRAKAYPAENP 213


>gi|332993009|gb|AEF03064.1| short chain dehydrogenase [Alteromonas sp. SN2]
          Length = 248

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/227 (32%), Positives = 124/227 (54%), Gaps = 5/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L  ++ L+TG+  GIG   A   A+ GA  I  GR++S+LE + + +      +  I   
Sbjct: 11  LKGKVILITGAGDGIGAQAARTYAKHGATCILLGRTVSKLEAVYDEIVNAGSAEPAIVPL 70

Query: 75  DLRD---SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++    S+  ++T+T I  ++GKLD ++ NA +LG +S    I+++ + DV+  NV   
Sbjct: 71  DIKGATPSHYQQMTQT-ITDQFGKLDGVLHNASVLGHLSSFKDIEQQEWLDVMQTNVNGT 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P L+K+     I  +S    K R  WG Y+ SK A E + +T + E  N +L
Sbjct: 130 VFLTQALIPALEKADNASVIFTTSSVGRKGRAFWGTYAVSKFATEGVMQTLADEYQNKSL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           R   I+PG TRT+MRA+A PAE+P+T+  P  +  +  +L     I+
Sbjct: 190 RFNCINPGGTRTNMRAQAFPAENPDTLKTPADIMPMYLYLMGNDSID 236


>gi|90416541|ref|ZP_01224472.1| short chain dehydrogenase [marine gamma proteobacterium HTCC2207]
 gi|90331740|gb|EAS46968.1| short chain dehydrogenase [marine gamma proteobacterium HTCC2207]
          Length = 255

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 122/220 (55%), Gaps = 4/220 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L +R+ +VTG+  GIG   AL  A+ GA VI  GR++++LE++ +++      +  I+  
Sbjct: 17  LADRVIMVTGAGDGIGKTAALHCAKHGATVILAGRTVAKLEQVYDSIVADGGAEPVIYPI 76

Query: 75  DLR--DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S+   +    + +++G+LD L+ NAGILG  +P+   +   +  V+ VNV A +
Sbjct: 77  DLEGASSDDYNILCNQLDEQFGRLDGLLHNAGILGQRTPLSNYRSDVWDKVMQVNVTAAF 136

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + ++  P L+KS     +  +S      R  WGAY+ SK A+E + + W+ E      +
Sbjct: 137 QMTQALMPVLEKSASASVVFTTSSVGRAGRSFWGAYAVSKFAVEGMVQVWASELEGLGTV 196

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           RV  I+PG T TSMR +A PAE+P++V  P  +     +L
Sbjct: 197 RVNAINPGATGTSMRMQAFPAENPSSVTSPAAIMPTYLYL 236


>gi|217972849|ref|YP_002357600.1| short chain dehydrogenase [Shewanella baltica OS223]
 gi|217497984|gb|ACK46177.1| short-chain dehydrogenase/reductase SDR [Shewanella baltica OS223]
          Length = 245

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  +  LVTG+  GIG   A+E A+ GA VI  G+++ +LE + + +++    K  I   
Sbjct: 11  LKGKTILVTGAGAGIGRTAAIEFAKHGATVILLGKTVKKLEAVYDVIEQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++  T IA+++  LD L+ NA +LG++ P   I   S  DV+ VNV A 
Sbjct: 71  DLKGATEQNYRDMADT-IAEQFDHLDGLLHNASLLGALGPFEHIDIPSLEDVLKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPVMRQAPSASIIFTSSSVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           R+ +I+PG TRT MRAKA PAE+P
Sbjct: 190 RINSINPGATRTEMRAKAYPAENP 213


>gi|159044678|ref|YP_001533472.1| short chain dehydrogenase / reductase [Dinoroseobacter shibae DFL
           12]
 gi|157912438|gb|ABV93871.1| short chain dehydrogenase / reductase [Dinoroseobacter shibae DFL
           12]
          Length = 221

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 113/212 (53%), Gaps = 2/212 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L +++ALVTG+SRG+G+  A  LA  GA+VIA  R++  LE+L + +Q       +   
Sbjct: 4   DLTDKIALVTGASRGLGHAVAEALAARGAHVIALARTVGALEELDDRIQAAGGSATLAPI 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL   +A+      I  RWG++D+L+  A    ++SP+     K +A   + NV A   +
Sbjct: 64  DLTKEDAVAGICRAIYDRWGRIDLLVHCAVHAPTLSPVDHAAPKDYAKTFATNVEATQRV 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R   P L ++  GRAI  +   A +    +G Y ASKAA  AL  +W+ ETV T  +V 
Sbjct: 124 IRMVAPLLNEAAEGRAIFCADPRAGE--KFFGLYGASKAAEAALVASWAAETVRTGPKVA 181

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAK 226
           +  P P  T+ RA+  P ED   +  P   AK
Sbjct: 182 SFTPAPMPTATRARFFPGEDRTALSAPAAEAK 213


>gi|322833315|ref|YP_004213342.1| short-chain dehydrogenase/reductase SDR [Rahnella sp. Y9602]
 gi|321168516|gb|ADW74215.1| short-chain dehydrogenase/reductase SDR [Rahnella sp. Y9602]
          Length = 269

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+NR+ LVTG+  GIG   AL  AR GA VI  GR+ S+L  ++  +   N +   I+A 
Sbjct: 26  LNNRIILVTGAGDGIGREAALTYARFGAQVILLGRTESKLASVQQEIAARNLRPAFIYAL 85

Query: 75  DLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL+ ++  +  +    IA     LD ++ NAG+L  I+P+ +IK + + +V+ VNV A +
Sbjct: 86  DLQTASQQDCQRVADQIAAWVPHLDGVLHNAGLLTDITPMAEIKLQDWMNVMQVNVNATF 145

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + +S  P + KS     +  +S    + R  WGAY+ SK A E + +  ++E  +T LR
Sbjct: 146 MLTQSLLPLMLKSASSSLVFTTSSVGREGRSGWGAYAVSKFATEGMMQVLAEEHKHTGLR 205

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRTSMRA A P E+ + +  P  +  +  +L     + +TG  F     R
Sbjct: 206 VNCINPGGTRTSMRASAFPDENKDKLKTPADIMPLYLYLMGDDSRRKTGISFDAQPGR 263


>gi|161503175|ref|YP_001570287.1| short chain dehydrogenase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160864522|gb|ABX21145.1| hypothetical protein SARI_01243 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 253

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 123/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   A+  AR GA VI  GR+    EKL+   Q I  +  +    
Sbjct: 10  LQNRIILVTGASDGIGREAAITYARYGATVILLGRND---EKLRRVAQHIADEQHVQPQW 66

Query: 72  FAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
              DL    A E  +    IA  + +LD ++ NAG+LG I P+     + + DV+ VNV 
Sbjct: 67  LTLDLLTCTAEECRQVADRIAVHFPRLDGVLHNAGLLGEICPMSAQDPQIWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N 
Sbjct: 127 ATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAVSKFATEGMMQVLADEYQNR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
           +LRV  I+PG TRTSMRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 SLRVNCINPGGTRTSMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|212710699|ref|ZP_03318827.1| hypothetical protein PROVALCAL_01766 [Providencia alcalifaciens DSM
           30120]
 gi|212686396|gb|EEB45924.1| hypothetical protein PROVALCAL_01766 [Providencia alcalifaciens DSM
           30120]
          Length = 260

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 119/229 (51%), Gaps = 9/229 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK------I 69
           L+ +  L+TG++ GIG   AL  AR GA VI  GR+  +L  +K  +Q +         I
Sbjct: 17  LNGKTILITGATDGIGQEAALTYARFGASVILLGRNPQKLAAIKQEIQDVTGSTSESYLI 76

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+      D  A+      IAK+   LD ++ +AG+LG+I+PI +   + + DV+ VNV 
Sbjct: 77  DLLTATPDDCQAI---ADDIAKQHPYLDGVLHSAGLLGNIAPISEQPAQLWHDVMQVNVN 133

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L+K+     I  SS    + R  WG Y+ SK A E L +  + E   T
Sbjct: 134 AGFMLTQALLPLLEKAPHASLIFTSSSVGKQGRANWGVYAVSKFATEGLMQVLADEYQGT 193

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
            LRV  I+PG TRT+MRA A P EDP T+  P  +     +L     ++
Sbjct: 194 GLRVNCINPGRTRTAMRAGAAPGEDPMTLKTPADIMPTYLYLMGDDSVD 242


>gi|227326050|ref|ZP_03830074.1| short chain dehydrogenase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 253

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 126/241 (52%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK------I 69
           L NR+ LVTG+  GIG   AL  AR GA+VI  GR+ S+L+ +K  +++ +         
Sbjct: 10  LQNRIILVTGAGDGIGREAALTYARYGAHVILLGRTESKLQSVKQQIEQEHGTSAHVVVC 69

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+ A  L  +   +L    +A+    LD ++ NAG+LG I+PI Q   + +  V+ VNV 
Sbjct: 70  DMLA--LSSAQCFQLADE-LAQVVPHLDGVLHNAGLLGEITPIVQQTPEIWHQVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS C   +  SS    + R  WGAYS SK A E L +  ++E  + 
Sbjct: 127 ATFMLTQALLPLLLKSPCSSLVFTSSSVGREGRAGWGAYSVSKFATEGLMQVLAEEYRSQ 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 NLRVNCINPGGTRTGMRASAFPNEDPMRLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|253688399|ref|YP_003017589.1| short-chain dehydrogenase/reductase SDR [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251754977|gb|ACT13053.1| short-chain dehydrogenase/reductase SDR [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 253

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 126/241 (52%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI------ 69
           L NR+ L+TG+  GIG   AL  AR GA+VI  GR+ S+L+ +K  +++ +         
Sbjct: 10  LQNRIILITGAGDGIGREAALTYARYGAHVILLGRTESKLQAVKQQIEQEHGTTAHVVVC 69

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+ A  L  +   +L    +A+    LD ++ NAG+LG I+PI Q   + +  V+ VNV 
Sbjct: 70  DMLA--LSSAQCFQLADE-LAQVVPHLDGVLHNAGLLGEIAPITQQTPEIWHQVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS C   +  SS    + R  WGAYS SK A E L +  ++E  + 
Sbjct: 127 ATFMLTQALLPLLLKSSCASLVFTSSSVGREGRAGWGAYSVSKFATEGLMQVLAEEYRSQ 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 NLRVNCINPGGTRTGMRASAFPNEDPMRLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|227111424|ref|ZP_03825080.1| short chain dehydrogenase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 253

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 126/241 (52%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK------I 69
           L NR+ LVTG+  GIG   AL  AR GA++I  GR+ S+L+ +K  +++ +         
Sbjct: 10  LQNRIILVTGAGDGIGREAALTYARYGAHIILLGRTESKLQSVKQQIEQEHGTPAHVVVC 69

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+ A  L  +   +L    +A+    LD ++ NAG+LG I+PI Q   + +  V+ VNV 
Sbjct: 70  DMLA--LSSAQCFQLADE-LAQVVPHLDGVLHNAGLLGEITPIKQQTPEVWHQVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS C   +  SS    + R  WGAYS SK A E L +  ++E  + 
Sbjct: 127 ATFMLTQALLPLLLKSPCASLVFTSSSVGREGRAGWGAYSVSKFATEGLMQVLAEEYRSH 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 NLRVNCINPGGTRTGMRASAFPNEDPMRLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|167624535|ref|YP_001674829.1| short chain dehydrogenase [Shewanella halifaxensis HAW-EB4]
 gi|167354557|gb|ABZ77170.1| short-chain dehydrogenase/reductase SDR [Shewanella halifaxensis
           HAW-EB4]
          Length = 245

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 122/222 (54%), Gaps = 5/222 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L ++  LVTG+  GIG   A+  A+ GA VI  G+++ +LE + + +++       I   
Sbjct: 11  LKDKTILVTGAGDGIGKAAAIAFAKHGATVILLGKTVKKLEAVYDQIEQAGYPTPAIIPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + +  ++  T I +++G+L+ L+ NA +LG + P   +   +  +V+ VNV+A 
Sbjct: 71  DLKGATEQHYKDMADT-IEEQFGQLEGLLHNASVLGVLGPFEHMTMNTVEEVMQVNVIAE 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++KS     +  SS    + R  WG Y+ SK A E + ++ + E  +T +
Sbjct: 130 IMLTKALLPVMRKSTSASLLFTSSSVGRQGRAYWGEYAISKFATEGMMQSLADEYEDTNI 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           RV +I+PG TRT MRA A PAE+P T+  P ++     +L  
Sbjct: 190 RVNSINPGATRTGMRANAFPAENPQTLKAPDEIMSTYLYLMG 231


>gi|226330247|ref|ZP_03805765.1| hypothetical protein PROPEN_04160 [Proteus penneri ATCC 35198]
 gi|225201042|gb|EEG83396.1| hypothetical protein PROPEN_04160 [Proteus penneri ATCC 35198]
          Length = 254

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 124/229 (54%), Gaps = 3/229 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLK-NALQKINKKIDI 71
           H  L +++ LVTG+  GIG   AL  A+ GA +I  GR++S+LE ++ + +    ++  +
Sbjct: 8   HSVLKDKIILVTGAGDGIGKEAALTYAQYGATLILLGRTLSKLEDVQEDIITSGGQQPML 67

Query: 72  FAFDLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           +  DL  +  N  +     + KR+  LD ++ NAG+LG I PI       + DV+ VNV 
Sbjct: 68  YPLDLLTATENDFQQFADTLVKRFPHLDGVLQNAGLLGVIEPIINQPSNLWHDVMQVNVN 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P + K+     I+ +S    + R  WGAYS SK A E   +  ++E   +
Sbjct: 128 ATFMLTKALLPLMLKAPHASLILTTSSVGRQGRYGWGAYSVSKFATEGFMQVLNEEYNES 187

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
            LR+  I+PG TRT+MRA A P E+P  +  P+ +  +  +L +   I+
Sbjct: 188 TLRINCINPGGTRTAMRANAFPDENPQKLKTPKDLMPLYLYLMSDDSID 236


>gi|157145599|ref|YP_001452918.1| short chain dehydrogenase [Citrobacter koseri ATCC BAA-895]
 gi|157082804|gb|ABV12482.1| hypothetical protein CKO_01345 [Citrobacter koseri ATCC BAA-895]
          Length = 253

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 121/241 (50%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  AR GA VI  GR+    EKL+   Q + +        
Sbjct: 10  LQNRIILVTGASDGIGREAALTYARYGANVILLGRNE---EKLRQVAQTVAEDTGALPQW 66

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL    A E  +    IA  + +LD ++ NAG+LG I  + +     + DV+ VNV 
Sbjct: 67  FTLDLLTCTAEECHQLGQRIAAHYPRLDGVLHNAGLLGDICLMSEQNPHVWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N 
Sbjct: 127 ATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNH 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRTSMRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 PLRVNCINPGGTRTSMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|254575109|pdb|3IAH|A Chain A, Crystal Structure Of Short Chain Dehydrogenase (Ycik) From
           Salmonella Enterica Subsp. Enterica Serovar Typhimurium
           Str. Lt2 In Complex With Nadp And Acetate.
 gi|254575110|pdb|3IAH|B Chain B, Crystal Structure Of Short Chain Dehydrogenase (Ycik) From
           Salmonella Enterica Subsp. Enterica Serovar Typhimurium
           Str. Lt2 In Complex With Nadp And Acetate
          Length = 256

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 121/241 (50%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  AR GA VI  GR+    EKL+   Q I  +  +    
Sbjct: 13  LQNRIILVTGASDGIGREAALTYARYGATVILLGRN---EEKLRRVAQHIADEQHVQPQW 69

Query: 72  FAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL    A E  +    IA  + +LD ++ NAG+LG I P  +   + + DV  VNV 
Sbjct: 70  FTLDLLTCTAEECRQVADRIAAHYPRLDGVLHNAGLLGEIGPXSEQDPQIWQDVXQVNVN 129

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E   +  + E  N 
Sbjct: 130 ATFXLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGXXQVLADEYQNR 189

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
           +LRV  I+PG TRTS RA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 190 SLRVNCINPGGTRTSXRASAFPTEDPQKLKTPADIXPLYLWLXGDDSRRKTGXTFDAQPG 249

Query: 249 R 249
           R
Sbjct: 250 R 250


>gi|290475295|ref|YP_003468183.1| putative oxoacyl-(acyl carrier protein) reductase with
           NAD(P)-binding domain [Xenorhabdus bovienii SS-2004]
 gi|289174616|emb|CBJ81410.1| putative oxoacyl-(acyl carrier protein) reductase with
           NAD(P)-binding domain [Xenorhabdus bovienii SS-2004]
          Length = 254

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 124/241 (51%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDI 71
           H  L  ++ LVTG+  GIG   AL  AR GA VI  GR+ ++LE +K  ++ +    + I
Sbjct: 8   HDLLQQKIILVTGAGDGIGREAALTYARYGAQVILLGRTTAKLEAVKQQIENEGGLPVTI 67

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           +  DL    A E       + +R+ +LD ++ NAG+LG ++P+ +   + + +V+ VNV 
Sbjct: 68  YTIDLLTVTAEECQAFADELTQRYPRLDGVLHNAGLLGVVAPVLEQPVQLWHEVMQVNVN 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + +   P L KS  G  +  SS      R  WGAY+ SK A E L +  ++E    
Sbjct: 128 ATFMLTQVLIPLLLKSPKGSLVFTSSSVGRVGRSGWGAYAVSKFATEGLMQVLAQEYQEI 187

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLFSVPQN 248
            LR+  I+PG TRT MRA A P E+   +  P ++  I  +L     + ++G  F     
Sbjct: 188 GLRINCINPGGTRTGMRASAFPDENATKLKIPAEIMPIYLYLMGDDSLSDSGISFDAQPG 247

Query: 249 R 249
           R
Sbjct: 248 R 248


>gi|257454757|ref|ZP_05620011.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Enhydrobacter aerosaccus SK60]
 gi|257447877|gb|EEV22866.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Enhydrobacter aerosaccus SK60]
          Length = 256

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 116/207 (56%), Gaps = 4/207 (1%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAFDLRDSN 80
           LVTG+  GIG   AL  A+ GA V+  G++ S+LE + + ++ +   +  +   +L  ++
Sbjct: 25  LVTGAGDGIGKAAALSYAKYGATVLLLGKTASKLEAVYDLIEAEGGAQPAMLLMNLESAS 84

Query: 81  ALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
             E+ +    I +  G LD ++ NAG+LG ++P+       F  V+ VN  A + + ++ 
Sbjct: 85  YTEMQQLAILIEREVGHLDGVLHNAGLLGVLTPLEMYDPIIFEQVMKVNFNATFTLTQAL 144

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV-NTALRVINID 197
            P LK +  G  +  SS    + R  WGAY+ SK A+E ++  +++ET   T LR   I+
Sbjct: 145 LPLLKSAQSGSVVFTSSSVGSRPRAFWGAYALSKLAVEGMSDIFTQETQKTTTLRFNCIN 204

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           PG TRT MRA A P+E+PNT+  P+ +
Sbjct: 205 PGATRTQMRAAAYPSENPNTLLAPEDL 231


>gi|261821584|ref|YP_003259690.1| short chain dehydrogenase [Pectobacterium wasabiae WPP163]
 gi|261605597|gb|ACX88083.1| short-chain dehydrogenase/reductase SDR [Pectobacterium wasabiae
           WPP163]
          Length = 253

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 127/241 (52%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI------ 69
           L NR+ LVTG+  GIG   A+  AR GA+VI  GR+ S+L+ +K  +++ ++        
Sbjct: 10  LQNRIILVTGAGDGIGREAAMTYARYGAHVILLGRTESKLQAVKQQIEQEHRATAHVIVC 69

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+ A  L  +   +L    +A+    LD ++ NAG+LG ++P+ Q   + +  V+ VN+ 
Sbjct: 70  DMLA--LSSAQCFQLADE-LAQVVPHLDGVLHNAGLLGEVAPVVQQTPEIWHQVMQVNIN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS C   +  SS    + R  WGAYS SK A E L +  ++E  + 
Sbjct: 127 ATFMLTQALLPLLLKSPCSSLVFTSSSVGREGRANWGAYSVSKFATEGLMQVLAEEYRSQ 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 NLRVNCINPGGTRTGMRAAAFPNEDPMKLKTPTDIMPLYLYLMGDDSRRKTGMSFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|90021797|ref|YP_527624.1| ATPase FliI/YscN [Saccharophagus degradans 2-40]
 gi|89951397|gb|ABD81412.1| short-chain dehydrogenase/reductase SDR [Saccharophagus degradans
           2-40]
          Length = 254

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 125/240 (52%), Gaps = 5/240 (2%)

Query: 1   MIDCESKNNSEIHVN-LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLK 59
           MID E     +   N L +++ ++TG+  GIG   A   A+ GA V+  GR+ ++LE + 
Sbjct: 1   MIDSEFLTQYKPRENSLADKIIVITGAGDGIGRCVAKTCAQHGATVVLLGRTQAKLESVY 60

Query: 60  NALQKIN-KKIDIFAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIK 116
           + ++     K  I+  +L  +   + +     +   +GK+D LI NA  LG  +PI    
Sbjct: 61  DEIEAAGYPKPAIYPMNLEGAIEQDFSAMADVLETEFGKIDGLIHNASELGPRTPIANYS 120

Query: 117 EKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE 176
              +  ++ VNV A + + ++  P L KS     +  SS    K R  WGAY+ASKAAIE
Sbjct: 121 AVQWQKIMQVNVNAPFMMTKALLPLLDKSTSASILFTSSSVGAKGRAYWGAYAASKAAIE 180

Query: 177 ALARTWSKETVNTA-LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
            L  T + E   T+ +RV +++PG TRT MRA A PAEDP TV  P+ +     FL   +
Sbjct: 181 NLVETLADELDGTSKIRVNSLNPGATRTGMRAAAYPAEDPTTVTEPEAIMNRYLFLLGQE 240


>gi|311279821|ref|YP_003942052.1| short-chain dehydrogenase/reductase SDR [Enterobacter cloacae SCF1]
 gi|308749016|gb|ADO48768.1| short-chain dehydrogenase/reductase SDR [Enterobacter cloacae SCF1]
          Length = 252

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 125/241 (51%), Gaps = 11/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L  R+ LVTG+S GIG   AL  AR GA VI  GR+    +KL+   Q+I ++  I    
Sbjct: 10  LQQRIILVTGASDGIGREAALTYARYGASVILLGRND---DKLRAVAQQIQQEGGIAPQW 66

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL      E       +A  + +LD ++ NAG+LG +SP+ + K + + DV+ VNV 
Sbjct: 67  FILDLLTCTPQECHTLAQKVAIHYPRLDGVLHNAGLLGDVSPMAEQKPEVWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  ++E    
Sbjct: 127 GTFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLAEE-YQG 185

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F    N
Sbjct: 186 QLRVNCINPGGTRTGMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPN 245

Query: 249 R 249
           R
Sbjct: 246 R 246


>gi|89094109|ref|ZP_01167052.1| short chain dehydrogenase [Oceanospirillum sp. MED92]
 gi|89081584|gb|EAR60813.1| short chain dehydrogenase [Oceanospirillum sp. MED92]
          Length = 246

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/229 (33%), Positives = 124/229 (54%), Gaps = 6/229 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L +R+ LVTG+  GIG   A   A  GA VI  GR++ +LE + + ++   + +  +   
Sbjct: 11  LKDRIILVTGAGDGIGRVAAKTFAAHGATVILLGRTLEKLEHVYDEIEAAGHPQPALVPL 70

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           +L   ++ + +ELT T + + +G++D ++ NA +LG  +PI       +  V+ VNV A 
Sbjct: 71  NLESAQEHDFIELTNT-LEQEFGRIDGILHNASLLGVRTPIESYDPVIWQQVMQVNVNAP 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TA 190
           + + +   P L+ S     +  SS    K +  WGAY+ SK A E L +T + E  N + 
Sbjct: 130 FMLTQILMPLLENSENPSIVFTSSSVGRKSKAYWGAYAVSKFATEGLMQTLADELSNISK 189

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIET 239
           +RV  I+PG TRT MRA A P EDP+TV  P+ +  +  +L  +   ET
Sbjct: 190 IRVNCINPGATRTQMRADAYPGEDPSTVAAPEDIMPLYLYLMGSDSQET 238


>gi|88705956|ref|ZP_01103664.1| Short-chain dehydrogenase/reductase SDR [Congregibacter litoralis
           KT71]
 gi|88699670|gb|EAQ96781.1| Short-chain dehydrogenase/reductase SDR [Congregibacter litoralis
           KT71]
          Length = 262

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 123/220 (55%), Gaps = 4/220 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  +  LVTG+S GIG   A+  A  GA V+   R++ +LE + +A++     +     F
Sbjct: 27  LAGKTILVTGASDGIGRSAAMSYAAHGATVVLLARNVEKLESVYDAIEAAGGPQPAAIPF 86

Query: 75  DL-RDSN-ALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL +D+  A       I ++ G+LD L+ NAGILG   P+ Q     + DVI +NV + +
Sbjct: 87  DLAQDTEEAFIALADVIEEQLGRLDGLLLNAGILGQRRPLEQSAWNDWRDVIHLNVHSQF 146

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            +++S  P L+++     ++ SSG     R  WGAY+ SK A E + +  + ET NT+ +
Sbjct: 147 LLIKSLMPLLRQAPRASLVLTSSGVGRTGRAYWGAYAVSKFATEGMMQVLASETENTSDI 206

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           RV  I+PG T T+MR  A PAE+P++ P P+ + +   +L
Sbjct: 207 RVNCINPGATNTAMRRAAYPAEEPDSNPSPEAIMRSYLYL 246


>gi|37526343|ref|NP_929687.1| short chain dehydrogenase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785774|emb|CAE14824.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 254

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 127/241 (52%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDI 71
           H  L  R+ LVTG+  GIG   AL  AR GA VI  GR+  +LE ++  + Q       +
Sbjct: 8   HDLLQQRIILVTGAGEGIGREAALTYARYGAQVILLGRTTHKLEAVQKEIKQAGGAPATV 67

Query: 72  FAFDLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           +  DL  + A E       +A+ +  LD ++ NAG+LG+++P+ +   + + DV+ VNV 
Sbjct: 68  YTMDLLTATAEECQAFAGDLAQYYPHLDGVLHNAGLLGAVAPMAEQPVQLWHDVMQVNVN 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  I  SS    + R  WGAYSASK A E + +  + E  +T
Sbjct: 128 ATFMLTQALLPLLLKSPDGSLIFTSSSVGREGRCGWGAYSASKFATEGMMQVLAAEYKHT 187

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGKLFSVPQN 248
           +LRV  I+PG TRT+MR +A P E+   +  P  +  +  +L  +  +  TG  F     
Sbjct: 188 SLRVNCINPGGTRTNMRTRAFPNENSAKLKTPADIMPLYLYLMGSDSLHKTGISFDAQPG 247

Query: 249 R 249
           R
Sbjct: 248 R 248


>gi|120555408|ref|YP_959759.1| short-chain dehydrogenase/reductase SDR [Marinobacter aquaeolei
           VT8]
 gi|120325257|gb|ABM19572.1| short-chain dehydrogenase/reductase SDR [Marinobacter aquaeolei
           VT8]
          Length = 250

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/226 (34%), Positives = 123/226 (54%), Gaps = 11/226 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK------I 69
           L +R+ +VTG+  GIG   A   A  GA VI  GR++S+LE++ + ++           +
Sbjct: 11  LKDRIVMVTGAGSGIGRAAAKAYAAHGATVILVGRTVSRLEEVYDEIEAAGHPKPAIVPM 70

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           +     ++D   L +T   +   +G+LD L+ NAGILG+ SP+     +++  V+ VN  
Sbjct: 71  NFEGAAVKDYEELAMT---LEDNFGRLDGLLHNAGILGARSPVELYDPETWNKVMHVNAT 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + R+  P L+KS     I  SSG   + R  WGAY+ SK A+E LA+  + E  + 
Sbjct: 128 APFLLSRAMIPLLRKSEDASMIFTSSGVGRQARAYWGAYAVSKFAVEGLAQLLADELDDE 187

Query: 190 A--LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
              +RV +++PG TRT MR  A PAEDP   P P+++  I  +L  
Sbjct: 188 RHNIRVNSLNPGATRTGMRVLAYPAEDPKKNPDPEQLMPIYLYLMG 233


>gi|239994300|ref|ZP_04714824.1| short chain dehydrogenase [Alteromonas macleodii ATCC 27126]
          Length = 247

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 123/228 (53%), Gaps = 5/228 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKL-KNALQKINKKIDIFAF 74
           L +++ L+TG+  GIG   A   A  GA  I  GR++S+LE +  + +    ++  I   
Sbjct: 11  LRDKVILITGAGDGIGAQAAKTYAAHGAICILLGRTVSKLEAVYDDIVAAGGQEPAIVPL 70

Query: 75  DLRD---SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++    S+  ++T+T I  ++G+LD ++ NA ILG +S    I  + + DV+ +N+   
Sbjct: 71  DIKGATPSHYQQMTQTII-DQFGRLDGVLHNASILGHLSAFKDIDAQEWQDVMQINLNGM 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P L+K+     I  +S    K R  WG Y+ SK A E + +T + E  N +L
Sbjct: 130 VFMTQALIPALEKAESASVIFTTSSVGRKGRAFWGTYAVSKFATEGVMQTLADEYRNKSL 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIET 239
           R   I+PG TRT MRA+A PAE+P+T+  P+ +     +L      ET
Sbjct: 190 RFNCINPGGTRTQMRAQAFPAENPDTLKTPEDIMPTYLYLMGEDSKET 237


>gi|15801908|ref|NP_287928.1| short chain dehydrogenase [Escherichia coli O157:H7 EDL933]
 gi|15831097|ref|NP_309870.1| short chain dehydrogenase [Escherichia coli O157:H7 str. Sakai]
 gi|157160776|ref|YP_001458094.1| short chain dehydrogenase [Escherichia coli HS]
 gi|168751159|ref|ZP_02776181.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4113]
 gi|168758355|ref|ZP_02783362.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4401]
 gi|168763582|ref|ZP_02788589.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4501]
 gi|168771269|ref|ZP_02796276.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4486]
 gi|168775079|ref|ZP_02800086.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4196]
 gi|168783773|ref|ZP_02808780.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4076]
 gi|168790070|ref|ZP_02815077.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC869]
 gi|168801617|ref|ZP_02826624.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC508]
 gi|170020365|ref|YP_001725319.1| short chain dehydrogenase [Escherichia coli ATCC 8739]
 gi|188493263|ref|ZP_03000533.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli 53638]
 gi|195939204|ref|ZP_03084586.1| short chain dehydrogenase [Escherichia coli O157:H7 str. EC4024]
 gi|208811017|ref|ZP_03252850.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4206]
 gi|208814805|ref|ZP_03255984.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4045]
 gi|208821596|ref|ZP_03261916.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4042]
 gi|209399345|ref|YP_002270325.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4115]
 gi|217329378|ref|ZP_03445458.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. TW14588]
 gi|254792859|ref|YP_003077696.1| short chain dehydrogenase [Escherichia coli O157:H7 str. TW14359]
 gi|261224253|ref|ZP_05938534.1| predicted oxoacyl-(acyl carrier protein) reductase [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261257491|ref|ZP_05950024.1| predicted oxoacyl-(acyl carrier protein) reductase [Escherichia
           coli O157:H7 str. FRIK966]
 gi|291282358|ref|YP_003499176.1| Oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O55:H7 str. CB9615]
 gi|293414603|ref|ZP_06657252.1| oxidoreductase yciK [Escherichia coli B185]
 gi|312971460|ref|ZP_07785635.1| short chain dehydrogenase family protein [Escherichia coli 1827-70]
 gi|331652311|ref|ZP_08353330.1| putative oxidoreductase [Escherichia coli M718]
 gi|12515526|gb|AAG56544.1|AE005380_3 putative oxidoreductase [Escherichia coli O157:H7 str. EDL933]
 gi|13361308|dbj|BAB35266.1| putative oxidoreductase [Escherichia coli O157:H7 str. Sakai]
 gi|157066456|gb|ABV05711.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli HS]
 gi|169755293|gb|ACA77992.1| short-chain dehydrogenase/reductase SDR [Escherichia coli ATCC
           8739]
 gi|187769235|gb|EDU33079.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4196]
 gi|188014785|gb|EDU52907.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4113]
 gi|188488462|gb|EDU63565.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli 53638]
 gi|188998949|gb|EDU67935.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4076]
 gi|189354835|gb|EDU73254.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4401]
 gi|189359923|gb|EDU78342.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4486]
 gi|189366274|gb|EDU84690.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4501]
 gi|189370430|gb|EDU88846.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC869]
 gi|189376285|gb|EDU94701.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC508]
 gi|208724523|gb|EDZ74231.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4206]
 gi|208731453|gb|EDZ80141.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4045]
 gi|208741719|gb|EDZ89401.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4042]
 gi|209160745|gb|ACI38178.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. EC4115]
 gi|209771998|gb|ACI84311.1| putative oxidoreductase [Escherichia coli]
 gi|209772000|gb|ACI84312.1| putative oxidoreductase [Escherichia coli]
 gi|209772002|gb|ACI84313.1| putative oxidoreductase [Escherichia coli]
 gi|209772004|gb|ACI84314.1| putative oxidoreductase [Escherichia coli]
 gi|209772006|gb|ACI84315.1| putative oxidoreductase [Escherichia coli]
 gi|217317817|gb|EEC26245.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O157:H7 str. TW14588]
 gi|254592259|gb|ACT71620.1| predicted oxoacyl-(acyl carrier protein) reductase [Escherichia
           coli O157:H7 str. TW14359]
 gi|290762231|gb|ADD56192.1| Oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli O55:H7 str. CB9615]
 gi|291434661|gb|EFF07634.1| oxidoreductase yciK [Escherichia coli B185]
 gi|310336057|gb|EFQ01257.1| short chain dehydrogenase family protein [Escherichia coli 1827-70]
 gi|320189978|gb|EFW64630.1| Putative oxidoreductase [Escherichia coli O157:H7 str. EC1212]
 gi|320637165|gb|EFX06991.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           O157:H7 str. G5101]
 gi|320642531|gb|EFX11779.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           O157:H- str. 493-89]
 gi|320647884|gb|EFX16592.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           O157:H- str. H 2687]
 gi|320653486|gb|EFX21591.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320663979|gb|EFX31166.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326341069|gb|EGD64862.1| Putative oxidoreductase [Escherichia coli O157:H7 str. 1125]
 gi|326343310|gb|EGD67077.1| Putative oxidoreductase [Escherichia coli O157:H7 str. 1044]
 gi|331050589|gb|EGI22647.1| putative oxidoreductase [Escherichia coli M718]
          Length = 252

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 129/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL   R  +  +L +  IA  + +LD ++ NAG+LG + P+ +   + + DVI VNV A 
Sbjct: 70  DLLTCRSEDCQQLAQR-IAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVIQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|254785504|ref|YP_003072933.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Teredinibacter turnerae T7901]
 gi|237686018|gb|ACR13282.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Teredinibacter turnerae T7901]
          Length = 255

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 120/239 (50%), Gaps = 5/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   +L  A  GA VI  GR+I++LE + + ++     K  I   
Sbjct: 17  LQDKIILVTGAGDGIGKTASLTFAAHGATVILLGRTIAKLEAVYDQIEAAGGAKPAIIPM 76

Query: 75  DLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +   +   +  + +  + + +G+LD L+ NA  LG  +P+     +++  V+ VNV A +
Sbjct: 77  NFEGATEQDYVEIHNVLEQEFGRLDGLLHNAAELGPRTPVANYGLEAWQKVMMVNVTAPF 136

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + ++  P LK++     +  SSG   K    WG Y+ SKAA + L  T + E       
Sbjct: 137 QLTKAVLPLLKQAPSASVVFTSSGVGRKGHAYWGGYAVSKAASDNLMETLADEMDGLPGP 196

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIET-GKLFSVPQNR 249
           RV  ++PGP RT MRA A PAEDP TV   Q +     +L     I   GKLF     R
Sbjct: 197 RVNALNPGPVRTRMRATAFPAEDPATVTEAQAIMSAYLYLMGDDSIGVNGKLFDAQATR 255


>gi|320659186|gb|EFX26775.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           O55:H7 str. USDA 5905]
          Length = 252

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 129/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL   R  +  +L +  IA  + +LD ++ NAG+LG + P+ +   + + DVI VNV A 
Sbjct: 70  DLLTCRSEDCQQLAQR-IAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVIQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQLRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|218549038|ref|YP_002382829.1| short chain dehydrogenase [Escherichia fergusonii ATCC 35469]
 gi|218356579|emb|CAQ89202.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia
           fergusonii ATCC 35469]
          Length = 252

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L +R+ LVTG+S GIG   AL  AR GA VI  GR+  +L ++  A+ ++ ++K   +  
Sbjct: 10  LHDRIILVTGASDGIGREAALTYARYGATVILLGRNEDKLRQVAKAITEETDRKTQWYIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL   ++ +       I++ + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCSSEDCYHLAAQISENYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|284007500|emb|CBA72984.1| short chain dehydrogenase [Arsenophonus nasoniae]
          Length = 261

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 126/241 (52%), Gaps = 8/241 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL---QKINKKIDIF 72
           L+ +  L+TG+  GIG   AL  +  GA +I  GR++++LE +K  +    K    + I+
Sbjct: 11  LNQKNILITGAGDGIGREAALTYSSYGANLILVGRTLAKLEHVKQEIISNSKFIPSVSIY 70

Query: 73  AFDL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
             DL    +S   EL  T I + +  LD ++ NA ILG I+PI     K + DV+ VNV 
Sbjct: 71  PLDLLTITESQCHELA-TDINQNYTYLDGVLHNASILGKIAPIIDQPIKLWHDVMQVNVN 129

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L ++     I  +S    + R  WGAYS SK A E L +  S E   T
Sbjct: 130 ATFMLTQALLPLLLQAPNSSLIFTTSSVGRRGRANWGAYSVSKFATEGLMQVLSDEYKET 189

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P+EDP  +  PQ++  +  +L     I E+G  F    N
Sbjct: 190 NLRVNCINPGGTRTQMRADAFPSEDPMKLKTPQEIMPLYLYLMGEDSIKESGISFDAQPN 249

Query: 249 R 249
           R
Sbjct: 250 R 250


>gi|58584732|ref|YP_198305.1| Short-chain alcohol dehydrogenase family enzyme [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58419048|gb|AAW71063.1| Short-chain alcohol dehydrogenase family enzyme [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 257

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 120/220 (54%), Gaps = 11/220 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK----KIDI 71
           L+ ++AL+ G+S G+G   A    R GAYVI   RSI  L++L + ++K+++     + +
Sbjct: 12  LEGKIALIAGASGGMGSAVAKRFVREGAYVILISRSIDNLKQLYDEIEKLDEFKEGSVKL 71

Query: 72  FAFDLRDSNALELTKTYIAK----RWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
              DL D   +++    I        G LDIL+A  GILG ++ +   + +   +V++ N
Sbjct: 72  IQLDLLDFENVKILANMIESLKLSESGALDILVACTGILGKLNLVHDCELEELQNVMNTN 131

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAY--KCRPLWGAYSASKAAIEALARTWSKE 185
             ANW ++++ DP LKKS+ GR I ++S         P W  Y+ASKAA+E + + ++ E
Sbjct: 132 FTANWYLLKNLDPVLKKSNSGRVIFMTSEVTLSPSSYPYWVPYAASKAALEIMVKIYASE 191

Query: 186 TVNTALRVINI-DPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           T +T L V  +   GP  + M  +A P +D + +  P K+
Sbjct: 192 TKHTKLCVNAVYSEGPVDSEMYKQAFPGKDISELILPNKL 231


>gi|307545159|ref|YP_003897638.1| short-chain dehydrogenase/reductase SDR [Halomonas elongata DSM
           2581]
 gi|307217183|emb|CBV42453.1| short-chain dehydrogenase/reductase SDR [Halomonas elongata DSM
           2581]
          Length = 253

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 117/216 (54%), Gaps = 10/216 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ LVTG+  GIG   AL  AR GA VI  GR+I++LEK+ + ++     +  IF  
Sbjct: 14  LADRIILVTGAGDGIGRAAALSYARHGATVILLGRTIAKLEKVYDEIEAAGCPQPAIFPL 73

Query: 75  D-----LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           +     L+D + +  T   +   +G+LD ++ NAG+LG I+P  Q     +  V+ VNV 
Sbjct: 74  NFEGATLKDFHDMAET---LDGEFGRLDGILHNAGLLGRITPFEQYDPALWEQVMQVNVN 130

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN- 188
               + ++  P L+ S     I  SS    K R  WGAYS SK A E      ++E  + 
Sbjct: 131 GPLWMTQALLPLLRASQDASVIFTSSSVGRKGRAYWGAYSVSKFATEGFVEVLAEEVEHL 190

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
            +LR+ +++PG TRT+MR  A P EDP T+  P+ +
Sbjct: 191 GSLRINSLNPGATRTAMRKAAYPGEDPMTLRSPEDI 226


>gi|254430018|ref|ZP_05043725.1| NAD dependent epimerase/dehydratase family [Alcanivorax sp. DG881]
 gi|196196187|gb|EDX91146.1| NAD dependent epimerase/dehydratase family [Alcanivorax sp. DG881]
          Length = 255

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/218 (35%), Positives = 117/218 (53%), Gaps = 18/218 (8%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKN----------ALQKINK 67
           +R+ LVTG+  GIG   AL LA  GA VI  GR+  +LE + +          AL  +N 
Sbjct: 20  DRIILVTGAGAGIGRTAALTLAAHGATVILLGRTQEKLEAVYDEIKAAGGPEPALAPVNL 79

Query: 68  KIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
            +       R  +  EL   +  K +G+LD ++ NA +LG I+P+ +    ++  V+  N
Sbjct: 80  TV------ARPEDFQELAGLF-DKEFGRLDGILHNASMLGDITPMDRYGAGTWESVMQTN 132

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           V + + + ++  P L+ S   R +  SS    K R  WGAY+ SKAA E LA+  ++E  
Sbjct: 133 VNSAFYLTQAMLPLLRASDDARLLFTSSSVGRKGRAFWGAYAVSKAATENLAQVLAEELE 192

Query: 188 NTA-LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           NT+ +RV  ++PG TRT MRA A P EDP T+  P  +
Sbjct: 193 NTSNIRVNTLNPGGTRTDMRALAYPGEDPQTLKTPADI 230


>gi|50121217|ref|YP_050384.1| short chain dehydrogenase [Pectobacterium atrosepticum SCRI1043]
 gi|49611743|emb|CAG75192.1| putative short chain dehydrogenase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 253

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 121/239 (50%), Gaps = 6/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L NR+ LVTG+  GIG   AL  AR GA+VI  GR+ S+L+ +K  + Q+      +   
Sbjct: 10  LQNRIILVTGAGDGIGREAALNYARHGAHVILLGRTESKLQSVKQQIEQEHGTTAHVVVC 69

Query: 75  D---LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D   L  +   +L    +A+    LD ++ NAG+LG I P+ Q   + +  V+ VNV A 
Sbjct: 70  DMLTLSSAQCFQLADE-LAQVVPHLDGVLHNAGLLGEIVPVVQQTPEIWHQVMQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS C   +  SS    + R  WGAYS SK A E L +  + E  +  L
Sbjct: 129 FMLTQALLPLLLKSPCSSLVFTSSSVGREGRANWGAYSVSKFATEGLMQVLADEYRSHNL 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT MR  A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 RVNCINPGGTRTDMRVSAFPNEDPMKLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPGR 247


>gi|170768041|ref|ZP_02902494.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia albertii TW07627]
 gi|170122807|gb|EDS91738.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia albertii TW07627]
          Length = 252

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 124/241 (51%), Gaps = 11/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI----NKKIDI 71
           L++R+ LVTG+S GIG   AL  AR GA VI  GR+    EKL+   QKI    ++    
Sbjct: 10  LNDRIILVTGASDGIGREAALTYARYGATVILLGRN---EEKLRQVTQKIVDETHRPAQW 66

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL      +  +    IA  + +LD ++ NAG+LG I PI +   + + DV+ VNV 
Sbjct: 67  FILDLLTCTPEDCQQLAQRIAVNYPRLDGVLHNAGLLGDICPISEQNPQVWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS  G  +  SS      R  WGAY+ASK A E + +  + E    
Sbjct: 127 ATFMLTQALLPLLLKSDAGSLVFTSSSVGRHGRANWGAYAASKFATEGMMQVLADE-YQH 185

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 186 RLRVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPG 245

Query: 249 R 249
           R
Sbjct: 246 R 246


>gi|332968817|gb|EGK07865.1| short-chain dehydrogenase/reductase family oxidoreductase
           [Psychrobacter sp. 1501(2011)]
          Length = 259

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 123/221 (55%), Gaps = 6/221 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ +  LVTG+  GIG   AL  A+ GA V+  G+++S+LE + + ++    K+  I   
Sbjct: 22  LEGKTILVTGAGAGIGRVAALTYAKYGATVLLLGKTLSKLEAVYDEIEAAGGKQPAIMPM 81

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  ++  ++ +    I    G+L  ++ NAGILG+++P+      +F  V+ VN  A +
Sbjct: 82  NLETASYSDMQQLANLIQTEIGELHGVLHNAGILGALTPLEMYDIVTFEQVMRVNTTATF 141

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + +   P +K    G  +  SS      R  WGAY+ SK A+E ++  +++ET N T L
Sbjct: 142 MLTQVLMPLVKAVENGSFVFTSSSVGTHPRAFWGAYALSKQAVEGMSDIFTQETQNTTTL 201

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
           R   I+PG TRT+MRA A P E+P ++  P+ +  + +++C
Sbjct: 202 RFNCINPGGTRTNMRAHAYPGENPMSLKTPEDL--MPAYVC 240


>gi|324113143|gb|EGC07118.1| short chain dehydrogenase [Escherichia fergusonii B253]
 gi|325497455|gb|EGC95314.1| short chain dehydrogenase [Escherichia fergusonii ECD227]
          Length = 252

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L +R+ LVTG+S GIG   AL  AR GA VI  GR+  +L ++  A+ ++ ++K   +  
Sbjct: 10  LHDRIILVTGASDGIGREAALTYARYGATVILLGRNEDKLRQVAKAITEETDRKTQWYIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL   ++ +       I+  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCSSEDCYHLAAQISANYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|237731715|ref|ZP_04562196.1| short chain dehydrogenase [Citrobacter sp. 30_2]
 gi|226907254|gb|EEH93172.1| short chain dehydrogenase [Citrobacter sp. 30_2]
          Length = 253

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 83/238 (34%), Positives = 120/238 (50%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  R+ LVTG+S GIG   A   AR GA VI  GR+  +L ++   +   N  +   F  
Sbjct: 10  LQGRIILVTGASDGIGREAAQTYARYGATVILLGRNEEKLRQVARTIADENGTQPQWFTL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + E  +    IA  + +LD ++ NAG+LG I P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEECHQLAQRIAAHFPRLDGVLHNAGLLGDICPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N  LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNRHLR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 190 VNCINPGGTRTGMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 247


>gi|110641502|ref|YP_669232.1| short chain dehydrogenase [Escherichia coli 536]
 gi|191171106|ref|ZP_03032657.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli F11]
 gi|218689261|ref|YP_002397473.1| short chain dehydrogenase [Escherichia coli ED1a]
 gi|300971796|ref|ZP_07171630.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 200-1]
 gi|110343094|gb|ABG69331.1| hypothetical oxidoreductase YciK [Escherichia coli 536]
 gi|190908838|gb|EDV68426.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli F11]
 gi|218426825|emb|CAR07675.2| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           ED1a]
 gi|222033075|emb|CAP75815.1| Uncharacterized oxidoreductase yciK [Escherichia coli LF82]
 gi|300309302|gb|EFJ63822.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 200-1]
 gi|312945905|gb|ADR26732.1| short chain dehydrogenase [Escherichia coli O83:H1 str. NRG 857C]
 gi|320195716|gb|EFW70341.1| Putative oxidoreductase [Escherichia coli WV_060327]
 gi|324006119|gb|EGB75338.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 57-2]
 gi|324011316|gb|EGB80535.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 60-1]
          Length = 252

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++I ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEEIGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQDPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|91210562|ref|YP_540548.1| short chain dehydrogenase [Escherichia coli UTI89]
 gi|117623531|ref|YP_852444.1| short chain dehydrogenase [Escherichia coli APEC O1]
 gi|218558256|ref|YP_002391169.1| short chain dehydrogenase [Escherichia coli S88]
 gi|237705294|ref|ZP_04535775.1| short chain dehydrogenase [Escherichia sp. 3_2_53FAA]
 gi|91072136|gb|ABE07017.1| hypothetical oxidoreductase YciK [Escherichia coli UTI89]
 gi|115512655|gb|ABJ00730.1| hypothetical oxidoreductase YciK [Escherichia coli APEC O1]
 gi|218365025|emb|CAR02728.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           S88]
 gi|226900051|gb|EEH86310.1| short chain dehydrogenase [Escherichia sp. 3_2_53FAA]
 gi|294491718|gb|ADE90474.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli IHE3034]
 gi|307627155|gb|ADN71459.1| short chain dehydrogenase [Escherichia coli UM146]
 gi|315289109|gb|EFU48507.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 110-3]
 gi|323949126|gb|EGB45018.1| short chain dehydrogenase [Escherichia coli H252]
 gi|323953858|gb|EGB49659.1| short chain dehydrogenase [Escherichia coli H263]
          Length = 252

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++I ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEEIGRQPQWFIL 69

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S   +     IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|218699980|ref|YP_002407609.1| short chain dehydrogenase [Escherichia coli IAI39]
 gi|218369966|emb|CAR17740.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           IAI39]
          Length = 252

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  +++  F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQLQWFIL 69

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S   +     IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|330719780|gb|EGG98290.1| Putative oxidoreductase [gamma proteobacterium IMCC2047]
          Length = 246

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 126/234 (53%), Gaps = 5/234 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ LVTG+  GIG   A+  A+ GA VI  GR   +L+ + + ++     +  I + 
Sbjct: 11  LKDRIILVTGAGDGIGKAAAMSYAKHGATVILVGRGRKKLDAVYDEIEANGWPQPVIVSL 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L D+ A    +    I   +G+LD ++ NA  LG  +P+    ++++ +V+ +NV + +
Sbjct: 71  NLADATAENFKELANMIGAEFGRLDGVLHNASTLGKRTPLASYDDETWQEVMHLNVTSPF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + ++  P ++++  G  +  SS    K R  WGAY+ SKAA E +  T + E    T +
Sbjct: 131 MLTKALLPLVEEADNGSIVFTSSSVGRKGRAFWGAYAISKAATENMMETLADEQDGVTNI 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGKLFS 244
           RV  I+PG TRT+MR KA P EDP+ +  P+++  +  +L     I   GK F 
Sbjct: 191 RVNCINPGATRTNMRMKAYPGEDPDKLATPEQIMPLYLYLMGDDSIAMNGKSFD 244


>gi|82776630|ref|YP_402979.1| short chain dehydrogenase [Shigella dysenteriae Sd197]
 gi|309789067|ref|ZP_07683662.1| short chain dehydrogenase family protein [Shigella dysenteriae
           1617]
 gi|81240778|gb|ABB61488.1| putative oxidoreductase [Shigella dysenteriae Sd197]
 gi|308923338|gb|EFP68850.1| short chain dehydrogenase family protein [Shigella dysenteriae
           1617]
          Length = 252

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 128/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL   R  +  +L +  I   + +LD ++ NAG+LG + P+ +   + + DVI VNV A 
Sbjct: 70  DLLTCRSEDCQQLAQR-ITVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVIQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|170681806|ref|YP_001743914.1| short chain dehydrogenase [Escherichia coli SMS-3-5]
 gi|170519524|gb|ACB17702.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli SMS-3-5]
          Length = 252

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASNGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    IA  + +LD ++ NAG+LG + P+ +   + + DVI VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVIQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|218704794|ref|YP_002412313.1| short chain dehydrogenase [Escherichia coli UMN026]
 gi|293404812|ref|ZP_06648804.1| short chain dehydrogenase [Escherichia coli FVEC1412]
 gi|298380453|ref|ZP_06990052.1| oxidoreductase yciK [Escherichia coli FVEC1302]
 gi|300897323|ref|ZP_07115754.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 198-1]
 gi|331662683|ref|ZP_08363606.1| putative oxidoreductase [Escherichia coli TA143]
 gi|218431891|emb|CAR12776.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           UMN026]
 gi|291427020|gb|EFF00047.1| short chain dehydrogenase [Escherichia coli FVEC1412]
 gi|298277895|gb|EFI19409.1| oxidoreductase yciK [Escherichia coli FVEC1302]
 gi|300358902|gb|EFJ74772.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 198-1]
 gi|331061105|gb|EGI33069.1| putative oxidoreductase [Escherichia coli TA143]
          Length = 252

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 128/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLHQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A 
Sbjct: 70  DLLTCTSENCQQLAQR-IAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRANAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|294635990|ref|ZP_06714430.1| 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase
           [Edwardsiella tarda ATCC 23685]
 gi|291090688|gb|EFE23249.1| 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase
           [Edwardsiella tarda ATCC 23685]
          Length = 260

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 82/242 (33%), Positives = 127/242 (52%), Gaps = 11/242 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK------KI 69
           L +R+ LVTG+S GIG   AL  AR GA +I  GR  ++LE L   +           + 
Sbjct: 17  LQDRIILVTGASAGIGREAALSYARHGAQLILLGRDGTRLETLAQQIVAEGAPRPHLIRC 76

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+   +   S AL      + +R  +LD L+ +AG+LG I+P+ Q     +  V+ VNV 
Sbjct: 77  DLLTLNEAQSRAL---VADLGQRVDRLDGLLHSAGLLGDIAPLAQQDYDQWQAVMQVNVN 133

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + R   P L+++     I  SS    + R  WGAY+ SK A E + + W++E   +
Sbjct: 134 AQFLLTRDLLPLLQRAPRASLIFTSSSVGRQGRAGWGAYAVSKFATEGMMQVWAEELAAS 193

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA--TQKIETGKLFSVPQ 247
           ++RV  I+PG TRT+MRA A P EDP+T+  P ++  +  +L    +Q +    L + P 
Sbjct: 194 SVRVNAINPGATRTAMRASAYPDEDPHTLLTPAQIMPLYLYLMGDDSQNVHGRSLDAQPG 253

Query: 248 NR 249
            R
Sbjct: 254 RR 255


>gi|332342863|gb|AEE56197.1| short chain dehydrogenase YciK [Escherichia coli UMNK88]
          Length = 252

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S   +     IA  + +LD ++ NAG+LG + P+ +   + + DVI VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVIQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|153872048|ref|ZP_02001053.1| short chain dehydrogenase [Beggiatoa sp. PS]
 gi|152071487|gb|EDN68948.1| short chain dehydrogenase [Beggiatoa sp. PS]
          Length = 248

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 118/222 (53%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKL-KNALQKINKKIDIFA- 73
           L +R+ LVTG+  GIG   A   A  GA VI  GR+IS+LE +  + +Q  + +  I+  
Sbjct: 11  LADRVILVTGAGSGIGQVAAKSFAAHGATVILLGRTISKLEAVYDDIIQAGHPQPAIYPM 70

Query: 74  -FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            F+    +  E   + +   +G+LD L+ NAG LG+++PI     K +  ++ VN+ A +
Sbjct: 71  NFETATPDDYEKLTSILNNEFGRLDGLLHNAGQLGTLTPIEHYDIKQWYQIMQVNLNAPF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE-TVNTAL 191
            + ++    LK++     +  SS    K R  WGAYS S   IE L +  + E   +  +
Sbjct: 131 LLTKACLGLLKRTKEASIVFTSSNVGQKGRAYWGAYSVSHFGIEGLMQILADELEAHATI 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           RV +I+PG  RT+MR  A P E+P T+P P+ +  +  +L  
Sbjct: 191 RVNSINPGAVRTAMRVNAYPGENPQTIPLPEDIMPLYLYLMG 232


>gi|156933741|ref|YP_001437657.1| short chain dehydrogenase [Cronobacter sakazakii ATCC BAA-894]
 gi|156531995|gb|ABU76821.1| hypothetical protein ESA_01567 [Cronobacter sakazakii ATCC BAA-894]
          Length = 253

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 125/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK----KIDI 71
           L NR+ LVTG+S GIG   AL  AR GA+V+  GRS    EKL+    +I +    +   
Sbjct: 10  LQNRIILVTGASDGIGREAALTYARYGAHVLLLGRSD---EKLRGVAHEIEQEGLAQAHW 66

Query: 72  FAFDLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  D   +   A +     IA+R  +LD ++ NAG+LG I P+ Q     +++V+ VNV 
Sbjct: 67  FTLDYATATPEACQQLAQAIAQRVPRLDGVLHNAGVLGDIVPMDQQNPAVWSEVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L KS  G  +  +S    + R  WGAY+ SK A E + +  ++E  + 
Sbjct: 127 VTFFLTQALLPLLLKSEAGSLVFTTSSVGRQGRANWGAYAVSKFATEGMMQVLAEEYQSR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP+ +  P  +  +  +L     + +TG  F     
Sbjct: 187 HLRVNCINPGGTRTKMRASAFPTEDPDKLKTPADLMPLYLWLMGDDSRRKTGISFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|311694116|gb|ADP96989.1| oxidoreductase, short chain dehydrogenase/reductase family [marine
           bacterium HP15]
          Length = 249

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 130/242 (53%), Gaps = 13/242 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK------I 69
           L +R+ +VTG+  GIG   A   A  GA V+  GR++S+LE + + ++           +
Sbjct: 11  LKDRIVMVTGAGSGIGRAAAKAYAAHGATVVLVGRTVSKLETVYDEIEAAGHPKPAIVPM 70

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           +     ++D   L +T   +   +G+LD L+ NA ILG  SP+     +++  V+ VN  
Sbjct: 71  NFEGAAVKDYEELAMT---LEDNFGQLDGLLHNAAILGDRSPVELYDPETWNKVMHVNAT 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + R+  P L+KS     I  SSG   K +  WGAY+ SK A+E L++  S+E  + 
Sbjct: 128 APFLLSRAMIPLLRKSDDASVIFTSSGVGRKAKAYWGAYAVSKFAVEGLSQLLSEELDDE 187

Query: 190 A--LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA--TQKIETGKLFSV 245
              +RV +++PG TRT+MRA A PAE+P   P P+ +  I  +L    +Q +   KL + 
Sbjct: 188 RHNVRVNSLNPGATRTNMRAHAYPAENPQQNPAPEDLMPIYLYLMGKDSQGVNGQKLDAQ 247

Query: 246 PQ 247
           P+
Sbjct: 248 PK 249


>gi|90408617|ref|ZP_01216771.1| short chain dehydrogenase [Psychromonas sp. CNPT3]
 gi|90310261|gb|EAS38392.1| short chain dehydrogenase [Psychromonas sp. CNPT3]
          Length = 245

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 118/201 (58%), Gaps = 5/201 (2%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAFDLR--- 77
           L+TG+  GIG   A+E A+ GA VI  G+++S+LE + ++++ +NK +  I   DL+   
Sbjct: 17  LITGAGDGIGKSLAIESAKLGATVILLGKTLSKLESVYDSIEALNKAQASILPLDLQGAT 76

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           + + ++L  T I + +G LD L+ NA  LG + P  QI +  + +V+ VNV A + + +S
Sbjct: 77  EQHYIDLADT-IKREYGHLDALVHNASQLGILGPFEQIPQDMWDNVMQVNVNAPFLLTKS 135

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L+++     I  +SG   K R  WGAY  SK A E + +  + E  N+ LR   I+
Sbjct: 136 LLPLLQQAPHASIIFTTSGVGNKGRAYWGAYCVSKFATEGMMQLLADEYENSTLRFNAIN 195

Query: 198 PGPTRTSMRAKAMPAEDPNTV 218
           PG TRT+MRA A PAED + +
Sbjct: 196 PGATRTAMRASAYPAEDKDAL 216


>gi|16129232|ref|NP_415787.1| predicted oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC
           system [Escherichia coli str. K-12 substr. MG1655]
 gi|89108117|ref|AP_001897.1| predicted oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC
           system [Escherichia coli str. K-12 substr. W3110]
 gi|170080948|ref|YP_001730268.1| oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC system
           [Escherichia coli str. K-12 substr. DH10B]
 gi|194437042|ref|ZP_03069141.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli 101-1]
 gi|238900504|ref|YP_002926300.1| putative oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC
           system [Escherichia coli BW2952]
 gi|253773732|ref|YP_003036563.1| short chain dehydrogenase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254161351|ref|YP_003044459.1| short chain dehydrogenase [Escherichia coli B str. REL606]
 gi|256023021|ref|ZP_05436886.1| short chain dehydrogenase [Escherichia sp. 4_1_40B]
 gi|297518963|ref|ZP_06937349.1| short chain dehydrogenase [Escherichia coli OP50]
 gi|300927777|ref|ZP_07143341.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 187-1]
 gi|300951919|ref|ZP_07165723.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 116-1]
 gi|300955864|ref|ZP_07168203.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 175-1]
 gi|301022793|ref|ZP_07186635.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 196-1]
 gi|301647235|ref|ZP_07247054.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 146-1]
 gi|307137908|ref|ZP_07497264.1| short chain dehydrogenase [Escherichia coli H736]
 gi|331641829|ref|ZP_08342964.1| putative oxidoreductase [Escherichia coli H736]
 gi|2506151|sp|P31808|YCIK_ECOLI RecName: Full=Uncharacterized oxidoreductase yciK
 gi|213424580|pdb|3F1L|A Chain A, The 0.95 A Structure Of An Oxidoreductase, Ycik From
           E.Coli
 gi|213424581|pdb|3F1L|B Chain B, The 0.95 A Structure Of An Oxidoreductase, Ycik From
           E.Coli
 gi|1742066|dbj|BAA14808.1| predicted oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC
           system [Escherichia coli str. K12 substr. W3110]
 gi|1787526|gb|AAC74353.1| predicted oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC
           system [Escherichia coli str. K-12 substr. MG1655]
 gi|169888783|gb|ACB02490.1| predicted oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC
           system [Escherichia coli str. K-12 substr. DH10B]
 gi|194424025|gb|EDX40013.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli 101-1]
 gi|238862778|gb|ACR64776.1| predicted oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC
           system [Escherichia coli BW2952]
 gi|242377050|emb|CAQ31774.1| predicted oxidoreductase [Escherichia coli BL21(DE3)]
 gi|253324776|gb|ACT29378.1| short-chain dehydrogenase/reductase SDR [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973252|gb|ACT38923.1| short chain dehydrogenase [Escherichia coli B str. REL606]
 gi|253977466|gb|ACT43136.1| short chain dehydrogenase [Escherichia coli BL21(DE3)]
 gi|260449599|gb|ACX40021.1| short-chain dehydrogenase/reductase SDR [Escherichia coli DH1]
 gi|299881094|gb|EFI89305.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 196-1]
 gi|300317266|gb|EFJ67050.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 175-1]
 gi|300448863|gb|EFK12483.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 116-1]
 gi|300464170|gb|EFK27663.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 187-1]
 gi|301074597|gb|EFK89403.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 146-1]
 gi|309701569|emb|CBJ00876.1| putative short chain dehydrogenase [Escherichia coli ETEC H10407]
 gi|315135907|dbj|BAJ43066.1| short chain dehydrogenase [Escherichia coli DH1]
 gi|315619349|gb|EFU99893.1| short chain dehydrogenase family protein [Escherichia coli 3431]
 gi|323937592|gb|EGB33860.1| short chain dehydrogenase [Escherichia coli E1520]
 gi|323942385|gb|EGB38555.1| short chain dehydrogenase [Escherichia coli E482]
 gi|323962571|gb|EGB58151.1| short chain dehydrogenase [Escherichia coli H489]
 gi|323973489|gb|EGB68675.1| short chain dehydrogenase [Escherichia coli TA007]
 gi|331038627|gb|EGI10847.1| putative oxidoreductase [Escherichia coli H736]
          Length = 252

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 128/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A 
Sbjct: 70  DLLTCTSENCQQLAQR-IAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|308094721|ref|ZP_05891504.2| short chain dehydrogenase [Vibrio parahaemolyticus AN-5034]
 gi|308093556|gb|EFO43251.1| short chain dehydrogenase [Vibrio parahaemolyticus AN-5034]
          Length = 210

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 105/184 (57%), Gaps = 5/184 (2%)

Query: 45  VIACGRSISQLEKLKNALQKIN-KKIDIFAFDLRDS---NALELTKTYIAKRWGKLDILI 100
           +I  GR++  LE + + ++     +  I   DL+ +   N +++ +T I  ++G+LD L+
Sbjct: 1   MILLGRNVKNLESIYDEIEAAGYPQAAIIPLDLKGATKQNYIDMAET-IEGQFGQLDGLL 59

Query: 101 ANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK 160
            NAG+L ++ P  QI E+ F D++ +NV A   + ++  P ++KS  GR I  SS   + 
Sbjct: 60  HNAGVLSALCPFEQINEEDFDDIMQINVKAEVLMTQALLPVMRKSEAGRIIFTSSTVGHS 119

Query: 161 CRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPH 220
            R  WG Y+ SK A+E + +  + E  +T +RV  I+PG TRT MR KA P ED NT+  
Sbjct: 120 GRAFWGPYAISKFAVEGMMQVLADELSDTPMRVNAINPGATRTRMREKAYPGEDANTLKT 179

Query: 221 PQKV 224
           P  +
Sbjct: 180 PLDI 183


>gi|118602502|ref|YP_903717.1| short-chain dehydrogenase/reductase SDR [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567441|gb|ABL02246.1| short-chain dehydrogenase/reductase SDR [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 250

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 125/232 (53%), Gaps = 5/232 (2%)

Query: 6   SKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI 65
           S N S     L +++ LVTG++RG G    L LA++GA VI  GR +  LE   + +  +
Sbjct: 4   STNYSITKGELRDKVILVTGANRGFGRAITLNLAKAGASVIMLGRDLGSLESTYDEVLDL 63

Query: 66  NKKIDI-FAFDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFA 121
             +  I +  DL  +   +  +L K  I   + +LD LI NA I+G++ PI Q   K + 
Sbjct: 64  GYQEPILYPLDLEGATPEHYKQLQKD-ILDSFEQLDGLIHNASIIGTMMPIEQYDIKLWY 122

Query: 122 DVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALART 181
             + +NV A + + ++  P L KS   R + LSS      +  WGAYS SK AIE +++T
Sbjct: 123 STMQINVNAPFMLTQALIPALNKSSDARILFLSSSVGRFAKAYWGAYSVSKFAIEGMSKT 182

Query: 182 WSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            S+E   T ++V +++PG  RT MR  A PAE+ +  P P+  +  I +L +
Sbjct: 183 LSEELEKTNIQVNSLNPGRMRTKMRQIAYPAENADNNPLPEIKSPAIVYLMS 234


>gi|119476911|ref|ZP_01617192.1| short chain dehydrogenase [marine gamma proteobacterium HTCC2143]
 gi|119449718|gb|EAW30955.1| short chain dehydrogenase [marine gamma proteobacterium HTCC2143]
          Length = 259

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 116/222 (52%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L NR  ++TG+  GIG   AL  A  GA VI  G++I++LE + + ++K    +  I+  
Sbjct: 22  LQNRTIVITGAGDGIGRCAALTFAAHGATVILVGKTIAKLESIYDEIEKAGYPQAAIYPL 81

Query: 75  DLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            L  +   +    +  +AK +G +D ++ NA ILG   PI Q     + +V+ VNV A +
Sbjct: 82  HLGGAVMKDYQDMHDTLAKEFGVIDGILHNASILGDRKPIAQTDSTEWQEVMHVNVNAPF 141

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + ++  P L++S     I  SS      R  WG Y+ SK A E L +T + E  NT+ +
Sbjct: 142 MMTKALLPLLEQSQDASIIFTSSSVGRVGRAYWGPYAVSKFATEGLMQTLADELANTSNI 201

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           RV  I+PG T T+MR  A PAE P   P P ++  +  +L  
Sbjct: 202 RVNAINPGATNTAMRRTAYPAEIPTVNPLPDQIMPLYLYLMG 243


>gi|297374019|emb|CBJ20844.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374022|emb|CBJ20846.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
          Length = 103

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (73%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  RP WGAY+ASKAA+E +AR W++E   T ++V  ++PG TRT+MRAKAMP+ED
Sbjct: 1   SSVAHVARPFWGAYAASKAALEMIARCWAEELKQTPIKVNCVNPGATRTAMRAKAMPSED 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P T+P PQKVAK +  L +    ETGKLF+V +NRFV+Y  P+
Sbjct: 61  PQTLPSPQKVAKKVVHLLSPDLKETGKLFNVHKNRFVDYHVPD 103


>gi|300935367|ref|ZP_07150366.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 21-1]
 gi|300459397|gb|EFK22890.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 21-1]
 gi|323964609|gb|EGB60082.1| short chain dehydrogenase [Escherichia coli M863]
 gi|323977097|gb|EGB72184.1| short chain dehydrogenase [Escherichia coli TW10509]
 gi|327253962|gb|EGE65591.1| short chain dehydrogenase family protein [Escherichia coli STEC_7v]
          Length = 252

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASNGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|288817325|ref|YP_003431672.1| short-chain dehydrogenase [Hydrogenobacter thermophilus TK-6]
 gi|288786724|dbj|BAI68471.1| short-chain dehydrogenase [Hydrogenobacter thermophilus TK-6]
 gi|308750932|gb|ADO44415.1| short-chain dehydrogenase/reductase SDR [Hydrogenobacter
           thermophilus TK-6]
          Length = 223

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 112/209 (53%), Gaps = 7/209 (3%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIF--AFDLRDS 79
           ++TG SRGIG  T +   + G  V  C R+    E LK   +++ K  ++F  A D+ + 
Sbjct: 4   VITGGSRGIGKATVIRFIKEGHQVCTCSRN---EEALKFLWEELGKPENLFIKACDVSER 60

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
            + +    + AK  GK D+LI NA +LG    I    E  + +VI VN+   + I +   
Sbjct: 61  QSAKEFVKFCAKLMGKFDVLINNASVLGLRESIEHYPEDVWEEVIRVNINGVFYITKYAI 120

Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199
           P++K    G  I LSSGA  +  P WGAY+ SK  IE  +   ++E  +  ++V   +PG
Sbjct: 121 PFMKDG--GIIINLSSGAGKRPAPYWGAYAVSKFGIEGFSLLLAEELKSRNIKVYAFNPG 178

Query: 200 PTRTSMRAKAMPAEDPNTVPHPQKVAKII 228
            TRT MRA A P EDP+T+  P+KVA  +
Sbjct: 179 ATRTQMRALAYPQEDPSTLKPPEKVADFL 207


>gi|331682758|ref|ZP_08383377.1| putative oxidoreductase [Escherichia coli H299]
 gi|331080389|gb|EGI51568.1| putative oxidoreductase [Escherichia coli H299]
          Length = 252

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSNVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|293409657|ref|ZP_06653233.1| oxidoreductase yciK [Escherichia coli B354]
 gi|301019497|ref|ZP_07183666.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 69-1]
 gi|291470125|gb|EFF12609.1| oxidoreductase yciK [Escherichia coli B354]
 gi|300399238|gb|EFJ82776.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 69-1]
          Length = 252

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S   +     IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|220702492|pdb|3F5Q|A Chain A, Crystal Structure Of Putative Short Chain Dehydrogenase
           From Escherichia Coli Cft073
 gi|220702493|pdb|3F5Q|B Chain B, Crystal Structure Of Putative Short Chain Dehydrogenase
           From Escherichia Coli Cft073
 gi|226888000|pdb|3GZ4|A Chain A, Crystal Structure Of Putative Short Chain Dehydrogenase
           From Escherichia Coli Cft073 Complexed With Nadph
 gi|226888001|pdb|3GZ4|B Chain B, Crystal Structure Of Putative Short Chain Dehydrogenase
           From Escherichia Coli Cft073 Complexed With Nadph
          Length = 262

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 12  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 71

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S   +     IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 72  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQDPQVWQDVMQVNVNATF 131

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 132 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 190

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 191 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 248


>gi|26247600|ref|NP_753640.1| short chain dehydrogenase [Escherichia coli CFT073]
 gi|215486566|ref|YP_002328997.1| short chain dehydrogenase [Escherichia coli O127:H6 str. E2348/69]
 gi|227886301|ref|ZP_04004106.1| short chain dehydrogenase/reductase family oxidoreductase
           [Escherichia coli 83972]
 gi|300982410|ref|ZP_07176107.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 45-1]
 gi|306813706|ref|ZP_07447887.1| short chain dehydrogenase [Escherichia coli NC101]
 gi|312966801|ref|ZP_07781019.1| short chain dehydrogenase family protein [Escherichia coli 2362-75]
 gi|331646594|ref|ZP_08347697.1| putative oxidoreductase [Escherichia coli M605]
 gi|331657318|ref|ZP_08358280.1| putative oxidoreductase [Escherichia coli TA206]
 gi|26108002|gb|AAN80202.1|AE016760_61 Hypothetical oxidoreductase yciK [Escherichia coli CFT073]
 gi|215264638|emb|CAS09009.1| predicted oxoacyl-(acyl carrier protein) reductase, EmrKY-TolC
           system [Escherichia coli O127:H6 str. E2348/69]
 gi|227836505|gb|EEJ46971.1| short chain dehydrogenase/reductase family oxidoreductase
           [Escherichia coli 83972]
 gi|281178461|dbj|BAI54791.1| putative oxidoreductase [Escherichia coli SE15]
 gi|300408748|gb|EFJ92286.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 45-1]
 gi|305852980|gb|EFM53425.1| short chain dehydrogenase [Escherichia coli NC101]
 gi|307553329|gb|ADN46104.1| oxidoreductase [Escherichia coli ABU 83972]
 gi|312288265|gb|EFR16167.1| short chain dehydrogenase family protein [Escherichia coli 2362-75]
 gi|315294754|gb|EFU54097.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 153-1]
 gi|315297260|gb|EFU56540.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 16-3]
 gi|323187502|gb|EFZ72811.1| short chain dehydrogenase family protein [Escherichia coli RN587/1]
 gi|330911136|gb|EGH39646.1| putative oxidoreductase [Escherichia coli AA86]
 gi|331045346|gb|EGI17473.1| putative oxidoreductase [Escherichia coli M605]
 gi|331055566|gb|EGI27575.1| putative oxidoreductase [Escherichia coli TA206]
          Length = 252

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQDPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|148653916|ref|YP_001281009.1| short chain dehydrogenase [Psychrobacter sp. PRwf-1]
 gi|148573000|gb|ABQ95059.1| short-chain dehydrogenase/reductase SDR [Psychrobacter sp. PRwf-1]
          Length = 258

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ +  LVTG+  GIG   AL  A+ GA V+  G+++S+LE + + ++    K+  I   
Sbjct: 21  LEGKTILVTGAGDGIGRVAALTYAKYGATVLLLGKTLSKLEAVYDEIEAAGGKQPAIMPM 80

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  ++  ++ +    I    G L  ++ NAGILG+++P+      +F  V+ VN  A +
Sbjct: 81  NLESASYSDMQQLANLIQSEIGTLHGVLHNAGILGALTPLEMYDVVTFEQVMRVNTTATF 140

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + +   P +K    G  +  SS      R  WGAY+ SK A+E ++  +++ET N T+L
Sbjct: 141 MLTQVLMPLVKSVDNGSFVFTSSSVGTHPRAFWGAYALSKQAVEGMSDIFTQETQNTTSL 200

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           R   I+PG TRT+MRA A P E+P
Sbjct: 201 RFNCINPGATRTNMRAHAFPGENP 224


>gi|284921152|emb|CBG34218.1| putative short chain dehydrogenase [Escherichia coli 042]
          Length = 252

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAITYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S   +     IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|82544275|ref|YP_408222.1| short chain dehydrogenase [Shigella boydii Sb227]
 gi|187730412|ref|YP_001880100.1| short chain dehydrogenase [Shigella boydii CDC 3083-94]
 gi|81245686|gb|ABB66394.1| putative oxidoreductase [Shigella boydii Sb227]
 gi|187427404|gb|ACD06678.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Shigella boydii CDC 3083-94]
 gi|320187509|gb|EFW62195.1| Putative oxidoreductase [Shigella flexneri CDC 796-83]
 gi|332094840|gb|EGI99884.1| short chain dehydrogenase family protein [Shigella boydii 3594-74]
          Length = 252

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 127/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  +   + +LD ++ NAG+LG I P+ +   + + DV+ VNV A 
Sbjct: 70  DLLTCTSENCQQLAQRIVVN-YPRLDGVLHNAGLLGDICPMSEQNPQVWQDVMQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|192360034|ref|YP_001982595.1| oxidoreductase [Cellvibrio japonicus Ueda107]
 gi|190686199|gb|ACE83877.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Cellvibrio japonicus Ueda107]
          Length = 280

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 122/232 (52%), Gaps = 10/232 (4%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFA 73
           +L  ++ LVTG+  GIG   A   AR GA VI  GR++ +LE++ + ++   + +  +F 
Sbjct: 43  SLSQKVILVTGAGDGIGKVAATTFARCGATVILAGRTLGKLEQVYDNIESAGHPQAALFP 102

Query: 74  FDL-----RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
            +      +D +AL      +   +G+LD ++ NA  LG  +PI      ++   + VNV
Sbjct: 103 INFEHAVEQDYDAL---CNALFDTFGRLDGILHNAADLGERTPISNYSLGAWQRCMQVNV 159

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A + + R+  P L+KS     +  SS  A+  R  WG Y+ASKAA E L +T + E   
Sbjct: 160 NAPFMLTRALLPLLEKSPSASVLFTSSSVAFNGRAYWGGYAASKAAQENLMQTLADEHEG 219

Query: 189 TA-LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIET 239
            + +R  +I+PG TRT MRAKA PAEDP ++  P  +     +L   Q   T
Sbjct: 220 ISRIRFNSINPGGTRTRMRAKAYPAEDPTSIKAPDALMPAYVYLLGDQSAGT 271


>gi|193062742|ref|ZP_03043836.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli E22]
 gi|193069934|ref|ZP_03050882.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli E110019]
 gi|194425920|ref|ZP_03058476.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli B171]
 gi|209918510|ref|YP_002292594.1| short chain dehydrogenase [Escherichia coli SE11]
 gi|260843618|ref|YP_003221396.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           O103:H2 str. 12009]
 gi|300822567|ref|ZP_07102706.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 119-7]
 gi|300904133|ref|ZP_07122006.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 84-1]
 gi|300919451|ref|ZP_07135952.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 115-1]
 gi|301304779|ref|ZP_07210885.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 124-1]
 gi|307309976|ref|ZP_07589626.1| short-chain dehydrogenase/reductase SDR [Escherichia coli W]
 gi|331667655|ref|ZP_08368519.1| putative oxidoreductase [Escherichia coli TA271]
 gi|331677048|ref|ZP_08377744.1| putative oxidoreductase [Escherichia coli H591]
 gi|192931864|gb|EDV84464.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli E22]
 gi|192956687|gb|EDV87142.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli E110019]
 gi|194415975|gb|EDX32241.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli B171]
 gi|209911769|dbj|BAG76843.1| putative oxidoreductase [Escherichia coli SE11]
 gi|257758765|dbj|BAI30262.1| predicted oxoacyl-(acyl carrier protein) reductase [Escherichia
           coli O103:H2 str. 12009]
 gi|300403898|gb|EFJ87436.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 84-1]
 gi|300413473|gb|EFJ96783.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 115-1]
 gi|300524983|gb|EFK46052.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 119-7]
 gi|300839900|gb|EFK67660.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 124-1]
 gi|306909694|gb|EFN40188.1| short-chain dehydrogenase/reductase SDR [Escherichia coli W]
 gi|315060521|gb|ADT74848.1| Dehydrogenases with different specificities [Escherichia coli W]
 gi|323162369|gb|EFZ48224.1| short chain dehydrogenase family protein [Escherichia coli E128010]
 gi|323172374|gb|EFZ58011.1| short chain dehydrogenase family protein [Escherichia coli LT-68]
 gi|323378916|gb|ADX51184.1| short-chain dehydrogenase/reductase SDR [Escherichia coli KO11]
 gi|323947449|gb|EGB43453.1| short chain dehydrogenase [Escherichia coli H120]
 gi|324018878|gb|EGB88097.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 117-3]
 gi|331065240|gb|EGI37135.1| putative oxidoreductase [Escherichia coli TA271]
 gi|331075737|gb|EGI47035.1| putative oxidoreductase [Escherichia coli H591]
          Length = 252

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 125/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S   +     I   + +LD ++ NAG+LG + P+ +   + + DVI VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRITVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVIQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|57239369|ref|YP_180505.1| putative oxidoreductase [Ehrlichia ruminantium str. Welgevonden]
 gi|58579336|ref|YP_197548.1| hypothetical protein ERWE_CDS_06720 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161448|emb|CAH58373.1| putative oxidoreductase [Ehrlichia ruminantium str. Welgevonden]
 gi|58417962|emb|CAI27166.1| Conserved hypothetical protein (similar to oxidoreductase)
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 249

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 126/234 (53%), Gaps = 2/234 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L+ ++A++TG+S  IG   A   A+ GA +I   + I++L  + +++Q++     +   
Sbjct: 4   QLEGKVAIITGASERIGSAVAQRFAKEGALLILVAKDINKLNAVYDSIQELGGDAILAPV 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D + ++     I  R+  +DILI NA +LG++SP+   +  ++  ++++N  ANW +
Sbjct: 64  DLEDFDTIKDFAMSIENRFKSIDILILNAAVLGNLSPVQDYEYSTWNRIMNINFTANWYL 123

Query: 135 MRSFDPWLKKSHCGRAIILSS--GAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           ++ FDP LK S  GR I  +S    +    P W  Y++SKAA+E + + ++ ET ++ L 
Sbjct: 124 IKCFDPLLKLSPAGRIIATTSEITQSLSNYPYWSPYASSKAALETMMKIYATETKHSKLC 183

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
           +  + P    + +  KA P +D      P+        L ++Q   TG+++ +P
Sbjct: 184 INMVYPSLIDSGIYVKAFPTKDTPESLLPESFTDKFVELSSSQCNVTGQVYQLP 237


>gi|260598143|ref|YP_003210714.1| putative oxoacyl-(acyl carrier protein) reductase [Cronobacter
           turicensis z3032]
 gi|260217320|emb|CBA31303.1| Uncharacterized oxidoreductase yciK [Cronobacter turicensis z3032]
          Length = 253

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 125/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK----KIDI 71
           L NR+ LVTG+S GIG   AL  AR GA+V+  GRS    EKL+   ++I +    +   
Sbjct: 10  LQNRIILVTGASDGIGREAALTYARYGAHVLLLGRS---EEKLRGVAREIEQEGLAQAHW 66

Query: 72  FAFDLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  D   +   A +     + +R  +LD ++ NAG+LG I P+ Q     +++V+ VNV 
Sbjct: 67  FTLDYATATPEACQRVAQAVGERVPRLDGVLHNAGVLGDIVPMDQQNPAVWSEVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L KS  G  +  +S    + R  WGAY+ SK A E + +  ++E  + 
Sbjct: 127 VTFFLTQALLPLLLKSEAGSLVFTTSSVGRQGRANWGAYAVSKFATEGMMQVLAEEYQSR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP+ +  P  +  +  +L     + +TG  F     
Sbjct: 187 QLRVNCINPGGTRTKMRASAFPTEDPDKLKTPANLMPLYLWLMGDDSRRKTGISFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|291085290|ref|ZP_06352652.2| oxidoreductase, short-chain dehydrogenase/reductase family
           [Citrobacter youngae ATCC 29220]
 gi|291071516|gb|EFE09625.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Citrobacter youngae ATCC 29220]
          Length = 262

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 120/238 (50%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ LVTG+S GIG   A   AR GA VI  GR+  +L ++  A+   N  +   F  
Sbjct: 19  LQDRIILVTGASDGIGREAAQTYARYGATVILLGRNDEKLRQVARAIADENGTQPHWFTL 78

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    ++        IA  + +LD ++ NAG+LG I P+ +   + +  V+ VNV A +
Sbjct: 79  DLLTCTADGCHQLAQRIAAHFPRLDGVLHNAGLLGDIGPMSEQNPQVWQAVMQVNVNATF 138

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  + E  N  LR
Sbjct: 139 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNRHLR 198

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 199 VNCINPGGTRTGMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 256


>gi|74312360|ref|YP_310779.1| short chain dehydrogenase [Shigella sonnei Ss046]
 gi|110805273|ref|YP_688793.1| short chain dehydrogenase [Shigella flexneri 5 str. 8401]
 gi|73855837|gb|AAZ88544.1| putative oxidoreductase [Shigella sonnei Ss046]
 gi|110614821|gb|ABF03488.1| putative oxidoreductase [Shigella flexneri 5 str. 8401]
 gi|323168245|gb|EFZ53930.1| short chain dehydrogenase family protein [Shigella sonnei 53G]
 gi|332757923|gb|EGJ88250.1| short chain dehydrogenase family protein [Shigella flexneri
           4343-70]
 gi|333004585|gb|EGK24109.1| short chain dehydrogenase family protein [Shigella flexneri VA-6]
 gi|333005440|gb|EGK24958.1| short chain dehydrogenase family protein [Shigella flexneri K-218]
          Length = 252

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 127/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  +   + +LD ++ NAG+LG + P+ +   + + DV+ VNV A 
Sbjct: 70  DLLTCTSENCQQLAQRIVVN-YPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|251789768|ref|YP_003004489.1| short chain dehydrogenase [Dickeya zeae Ech1591]
 gi|247538389|gb|ACT07010.1| short-chain dehydrogenase/reductase SDR [Dickeya zeae Ech1591]
          Length = 253

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 124/238 (52%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNA-LQKINKKIDIFAF 74
           L +R+ LVTG+  GIG   AL  AR GA ++  GR+ S+L+ ++   LQ+      +   
Sbjct: 10  LQHRIILVTGAGDGIGREAALTYARYGARLVLLGRTESKLQDVEQQILQECGNHSYLIPC 69

Query: 75  DLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           D+  ++  +  +    I +   +LD ++ NAG+LG + P+ +    ++  V+ VNV A +
Sbjct: 70  DMLTASHHDFIQIAGQIGQALPRLDGVLHNAGLLGDVVPMAEQSATTWHQVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS     I  SS    + R  WGAYS SK A E + +  ++E  N  LR
Sbjct: 130 MLTQALLPLLLKSTSPSLIFTSSSVGRQGRANWGAYSVSKFATEGMMQVLAEEYRNRNLR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRTSMRA A P EDPN +  P  +  +  +L     + +TG  F     R
Sbjct: 190 VNCINPGGTRTSMRAAAFPDEDPNKLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPGR 247


>gi|301046934|ref|ZP_07194048.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 185-1]
 gi|300301160|gb|EFJ57545.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 185-1]
          Length = 252

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    IA  + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQDPQVWQDVMLVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|157158085|ref|YP_001462567.1| short chain dehydrogenase [Escherichia coli E24377A]
 gi|191166675|ref|ZP_03028503.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli B7A]
 gi|218694841|ref|YP_002402508.1| short chain dehydrogenase [Escherichia coli 55989]
 gi|293433630|ref|ZP_06662058.1| yciK [Escherichia coli B088]
 gi|300820145|ref|ZP_07100314.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 107-1]
 gi|300926653|ref|ZP_07142429.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 182-1]
 gi|301327004|ref|ZP_07220293.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 78-1]
 gi|309793257|ref|ZP_07687684.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 145-7]
 gi|157080115|gb|ABV19823.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli E24377A]
 gi|190903324|gb|EDV63045.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Escherichia coli B7A]
 gi|218351573|emb|CAU97285.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           55989]
 gi|291324449|gb|EFE63871.1| yciK [Escherichia coli B088]
 gi|300417319|gb|EFK00630.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 182-1]
 gi|300527300|gb|EFK48362.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 107-1]
 gi|300846387|gb|EFK74147.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 78-1]
 gi|308122844|gb|EFO60106.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Escherichia coli MS 145-7]
          Length = 252

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 125/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S   +     I   + +LD ++ NAG+LG I P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIVVNYPRLDGVLHNAGLLGDICPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|297374028|emb|CBJ20850.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374031|emb|CBJ20852.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
          Length = 103

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (72%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  RP WGAY+ASKAA+E +AR W++E   T ++V  ++PG TRT+MRAKAMP ED
Sbjct: 1   SSVAHVARPFWGAYAASKAALEMIARCWAEELKQTPIKVNCVNPGATRTAMRAKAMPGED 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P T+P PQ+VAK +  L +    ETGKLF+V +NRFV+Y  P+
Sbjct: 61  PQTLPSPQEVAKKVVHLLSPDLKETGKLFNVHKNRFVDYHVPD 103


>gi|297373962|emb|CBJ20822.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297373965|emb|CBJ20824.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297373968|emb|CBJ20826.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297373995|emb|CBJ20828.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297373998|emb|CBJ20830.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374001|emb|CBJ20832.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374004|emb|CBJ20834.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374007|emb|CBJ20836.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374010|emb|CBJ20838.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374016|emb|CBJ20842.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374034|emb|CBJ20854.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374037|emb|CBJ20856.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
          Length = 103

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (72%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  RP WGAY+ASKAA+E +AR W++E   T ++V  ++PG TRT+MRA+AMP ED
Sbjct: 1   SSVAHAARPFWGAYAASKAALEMIARCWAEELKQTPIKVNCVNPGATRTAMRAEAMPGED 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P T+P PQ+VAK I  L +    ETGKLF+V +NRFV+Y  P+
Sbjct: 61  PQTLPSPQEVAKKIVHLLSPDLKETGKLFNVHKNRFVDYHVPD 103


>gi|24112668|ref|NP_707178.1| short chain dehydrogenase [Shigella flexneri 2a str. 301]
 gi|30062793|ref|NP_836964.1| short chain dehydrogenase [Shigella flexneri 2a str. 2457T]
 gi|24051582|gb|AAN42885.1| putative oxidoreductase [Shigella flexneri 2a str. 301]
 gi|30041041|gb|AAP16771.1| putative oxidoreductase [Shigella flexneri 2a str. 2457T]
 gi|281600692|gb|ADA73676.1| putative oxidoreductase [Shigella flexneri 2002017]
 gi|313649459|gb|EFS13890.1| short chain dehydrogenase family protein [Shigella flexneri 2a str.
           2457T]
 gi|332759508|gb|EGJ89816.1| short chain dehydrogenase family protein [Shigella flexneri
           2747-71]
 gi|332760365|gb|EGJ90655.1| short chain dehydrogenase family protein [Shigella flexneri K-671]
 gi|332767505|gb|EGJ97699.1| putative oxidoreductase [Shigella flexneri 2930-71]
 gi|333019150|gb|EGK38440.1| short chain dehydrogenase family protein [Shigella flexneri K-304]
          Length = 252

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 127/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  +   + +LD ++ NAG+LG + P+ +   + + DV+ +NV A 
Sbjct: 70  DLLTCTSENCQQLAQRIVVN-YPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQINVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|330991086|ref|ZP_08315040.1| Putative oxidoreductase yciK [Gluconacetobacter sp. SXCC-1]
 gi|329761907|gb|EGG78397.1| Putative oxidoreductase yciK [Gluconacetobacter sp. SXCC-1]
          Length = 249

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 118/219 (53%), Gaps = 2/219 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L  R+ALVTG+SRGIG   A+ LAR+GA  I   R+   LE+  + + Q   +   +   
Sbjct: 9   LAGRVALVTGASRGIGRAVAVALARAGARCIITARTQGALEQTDDLIRQHTGQGATLLPL 68

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D + ++     I  + G+LD  +  AG LG +SP+  ++ + +   +    M  W +
Sbjct: 69  DLGDGDRVDTLGPSIMAQEGRLDCAVHCAGELGVLSPLVHLQPQDWERGLQAGPMTTWRL 128

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE-TVNTALRV 193
           +R+  P L+++  GRA+ L+        P WG  +A++AA +A+ RTW +E   ++ LR+
Sbjct: 129 IRTLAPLLERAPAGRAVFLTDRHGRAPEPFWGLVAATRAAQDAIVRTWVRELPAHSPLRI 188

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
              +PG   T +R  AMPA D  ++P P  +A  I  LC
Sbjct: 189 NLFEPGMVATRLRRLAMPALDMTSLPAPDAIAPHIVRLC 227


>gi|256018483|ref|ZP_05432348.1| short chain dehydrogenase [Shigella sp. D9]
 gi|332279539|ref|ZP_08391952.1| short chain dehydrogenase [Shigella sp. D9]
 gi|324117537|gb|EGC11443.1| short chain dehydrogenase [Escherichia coli E1167]
 gi|332101891|gb|EGJ05237.1| short chain dehydrogenase [Shigella sp. D9]
          Length = 252

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 125/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    S   +     I   + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRITVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|194435051|ref|ZP_03067290.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Shigella dysenteriae 1012]
 gi|194416708|gb|EDX32838.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Shigella dysenteriae 1012]
 gi|320181713|gb|EFW56624.1| Putative oxidoreductase [Shigella boydii ATCC 9905]
 gi|332091663|gb|EGI96743.1| short chain dehydrogenase family protein [Shigella boydii 5216-82]
 gi|332098172|gb|EGJ03145.1| short chain dehydrogenase family protein [Shigella dysenteriae
           155-74]
          Length = 252

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    IA  + +LD ++ NAG+LG + P+ +   + + DVI VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVIQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 MLTQTLLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|215261441|pdb|3F5S|A Chain A, Crystal Structure Of Putatitve Short Chain Dehydrogenase
           From Shigella Flexneri 2a Str. 301
 gi|215261442|pdb|3F5S|B Chain B, Crystal Structure Of Putatitve Short Chain Dehydrogenase
           From Shigella Flexneri 2a Str. 301
 gi|226887990|pdb|3GY0|A Chain A, Crystal Structure Of Putatitve Short Chain Dehydrogenase
           From Shigella Flexneri 2a Str. 301 Complexed With Nadp
          Length = 255

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 127/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 8   LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 67

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  +   + +LD ++ NAG+LG + P+ +   + + DV+ +NV A 
Sbjct: 68  DLLTCTSENCQQLAQRIVVN-YPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQINVNAT 126

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 127 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 185

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 186 RVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 244


>gi|58617390|ref|YP_196589.1| hypothetical protein ERGA_CDS_06630 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417002|emb|CAI28115.1| Conserved hypothetical protein (similar to oxidoreductase)
           [Ehrlichia ruminantium str. Gardel]
          Length = 249

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 125/234 (53%), Gaps = 2/234 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L+ ++A++TG+S  IG   A   A+ G  +I   + I++L  + +++Q++     +   
Sbjct: 4   QLEGKVAIITGASERIGSAVAQRFAKEGVLLILVAKDINKLNAVYDSIQELGGDAILAPV 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D + ++     I  R+  +DILI NA +LG++SP+   +  ++  ++++N  ANW +
Sbjct: 64  DLEDFDTIKDFAMSIENRFKSIDILILNAAVLGNLSPVQDYEYSTWNRIMNINFTANWYL 123

Query: 135 MRSFDPWLKKSHCGRAIILSS--GAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           ++ FDP LK S  GR I  +S    +    P W  Y++SKAA+E + + ++ ET ++ L 
Sbjct: 124 IKCFDPLLKLSPAGRIIATTSEITQSLSNYPYWSPYASSKAALETMMKIYATETKHSKLC 183

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
           +  + P    + +  KA P +D      P+        L ++Q   TG+++ +P
Sbjct: 184 INMVYPSLIDSGIYVKAFPTKDTPESLLPESFTDKFVELSSSQCNVTGQVYQLP 237


>gi|332161871|ref|YP_004298448.1| short chain dehydrogenase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318605615|emb|CBY27113.1| putative oxidoreductase [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325666101|gb|ADZ42745.1| short chain dehydrogenase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 253

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 124/241 (51%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI- 71
           H  LDNR  LVTG+  GIG   AL  AR GA +I  GR++ +L  ++  + K   +  I 
Sbjct: 7   HDLLDNRTILVTGAGDGIGREAALTYARFGARLILVGRTLHKLVAVQQQIAKATGQTAIV 66

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           +  DL  + A +  +    ++++   LD ++ NAG+LG I P+ +     + DV+ VNV 
Sbjct: 67  WELDLLHATAQDCQQLADALSQQISHLDGVLHNAGLLGEIVPMAEQDITVWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS     +  SS    + R  WGAY+ SK A E + +  ++E   +
Sbjct: 127 ATFMLTQALLPLLLKSPSASLVFTSSSVGRQGRSGWGAYAVSKFATEGMMQVLAEEYKQS 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P ED N +  P  +  +  +L     + +TG  F     
Sbjct: 187 NLRVNCINPGGTRTQMRASAFPDEDANKLKTPADIMPLYLYLMGDDSRRKTGISFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|108805586|ref|YP_645523.1| short-chain dehydrogenase/reductase SDR [Rubrobacter xylanophilus
           DSM 9941]
 gi|108766829|gb|ABG05711.1| short-chain dehydrogenase/reductase SDR [Rubrobacter xylanophilus
           DSM 9941]
          Length = 235

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 123/230 (53%), Gaps = 5/230 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++ALVTG+S+G+G   AL  A++GA +    R    +  +   + +   ++   A D
Sbjct: 2   LEGKVALVTGASQGLGRALALAYAQAGARLAINARREESIRPVAEEIARAGAQVLAVAAD 61

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +  S  +        +R+G++DIL+ NAG+LG   PI +  E+ +  VI VN+   + + 
Sbjct: 62  VSRSEDVGRFVGEAVERFGRIDILVNNAGLLGPRVPIVEYPEEEWRRVIDVNLTGAFLVS 121

Query: 136 RSFDPWLKKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           ++  P +     G +II + SG + + RP WGAYS SK  +E L +  + E  +  +RV 
Sbjct: 122 KAAIPHMPP---GSSIINVVSGVSVEGRPRWGAYSVSKFGLEGLTQILAAELKDRGIRVN 178

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGKLF 243
            +DPG  RT MRA A P EDP +   P++   +   L + +  E TG+ F
Sbjct: 179 AVDPGGMRTKMRAAAYPEEDPMSRIPPEENVGVFLHLSSEESREVTGQRF 228


>gi|297374025|emb|CBJ20848.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
          Length = 103

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (72%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  RP WGAY+ASKAA+E +AR W++E   T ++V  ++PG TRT+MRAKAMP ED
Sbjct: 1   SSVAHVARPFWGAYAASKAALEMIARCWAEELKQTPIKVNCVNPGATRTAMRAKAMPGED 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P T+P PQ+VAK +  L +    ETGKLF+V +NRFV+Y  P+
Sbjct: 61  PQTLPSPQEVAKKVVHLLSPDLKETGKLFNVYKNRFVDYHVPD 103


>gi|320176686|gb|EFW51724.1| putative oxidoreductase [Shigella dysenteriae CDC 74-1112]
          Length = 252

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 127/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  +   + +LD ++ NAG+LG I P+ +   + + DV+ VNV A 
Sbjct: 70  DLLTCTSENCQQLAQRIVVN-YPRLDGVLHNAGLLGDICPMSEQNPQVWQDVMQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P E+P  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEEPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|88607033|ref|YP_504853.1| short chain dehydrogenase/reductase family oxidoreductase
           [Anaplasma phagocytophilum HZ]
 gi|88598096|gb|ABD43566.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Anaplasma phagocytophilum HZ]
          Length = 248

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 126/232 (54%), Gaps = 2/232 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R+AL+TG+S  IG   A   A  GA V+   R++S+++ L +++Q +   + +   D
Sbjct: 5   LRGRVALITGASGSIGSAVAKRYAAEGASVVLASRNVSKMKALYDSIQGLGGDVILAPID 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D  ++      I  ++G LDIL++ A +LG+++P+ +     + +V+ VN+ ANW ++
Sbjct: 65  LNDYESVGNLALSIENKYGLLDILVSAAAVLGNLAPVQECDPVKWKEVMGVNLNANWYLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKC--RPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + FD  LK+S  GRAI ++S A         +  Y+ SK A+EAL + ++ ET ++ L V
Sbjct: 125 KHFDALLKQSAAGRAIFVTSEATRTLLNYSYFAPYATSKVALEALVQVYAAETKHSKLCV 184

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSV 245
             + PG   + +       ++ +  P P+++      L + +   TG+++ +
Sbjct: 185 NMVYPGQVDSGIHVAIFSTQEQSKFPSPEELTDKFVELASPECTVTGQVYEL 236


>gi|238751908|ref|ZP_04613394.1| Uncharacterized oxidoreductase yciK [Yersinia rohdei ATCC 43380]
 gi|238709888|gb|EEQ02120.1| Uncharacterized oxidoreductase yciK [Yersinia rohdei ATCC 43380]
          Length = 253

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 125/244 (51%), Gaps = 10/244 (4%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK---- 68
           H  L+NR  LVTG+  GIG   AL  AR GA ++  GR++ +L  ++  +     +    
Sbjct: 7   HDLLENRTILVTGAGDGIGREAALTYARFGAKLVLVGRTMGKLIAVQQQISDAKGQPALA 66

Query: 69  --IDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISV 126
             +D+     +D   L  T   +++    LD ++ NAG+LG I+P+ +     + DV+ V
Sbjct: 67  LELDLLHATTQDCQHLAET---LSRTIPHLDGVLHNAGLLGEIAPMAEQDIALWQDVMQV 123

Query: 127 NVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKET 186
           NV A + + ++  P L  + CG  I  SS    + R  WGAY+ SK A E + +  ++E 
Sbjct: 124 NVNATFMLTQALLPLLLNAPCGSLIFTSSSVGRQGRAGWGAYAVSKFATEGMMQVLAEEY 183

Query: 187 VNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSV 245
            ++ LRV  I+PG TRT MRA A P ED N +  P ++  +  +L     + +TG  F  
Sbjct: 184 KHSTLRVNCINPGGTRTPMRASAFPDEDANKLKTPAEIMPLYLYLMGDDSRRKTGISFDA 243

Query: 246 PQNR 249
              R
Sbjct: 244 QPGR 247


>gi|146311851|ref|YP_001176925.1| short chain dehydrogenase [Enterobacter sp. 638]
 gi|145318727|gb|ABP60874.1| short-chain dehydrogenase/reductase SDR [Enterobacter sp. 638]
          Length = 253

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 126/239 (52%), Gaps = 6/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L NR+ LVTG+S GIG   AL  AR GA V+  GR+  +L  + + + +I+      +  
Sbjct: 10  LQNRIILVTGASDGIGREAALTYARYGASVVLLGRNEDKLRSVADEITEISGTPPHWYIL 69

Query: 75  DLRDSNALELTK---TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL  S   EL +    +IA+ + +LD ++ NAG+LG + P+ +   + +  V+ VN+   
Sbjct: 70  DLL-SCTQELCRELAQHIARDYPRLDGVLHNAGLLGEVRPMDEQNAEIWQQVMQVNINGT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ SK A E + +  ++E  +  L
Sbjct: 129 FFLTQALLPLLLKSDSGSLVFTSSSVGRQGRANWGAYAVSKFATEGMMQVLAEEYQSRHL 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT MRA A P+EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 RVNCINPGGTRTKMRASAFPSEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 247


>gi|269138900|ref|YP_003295601.1| short chain dehydrogenase [Edwardsiella tarda EIB202]
 gi|267984561|gb|ACY84390.1| short chain dehydrogenase [Edwardsiella tarda EIB202]
 gi|304558886|gb|ADM41550.1| Putative oxidoreductase [Edwardsiella tarda FL6-60]
          Length = 254

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 119/241 (49%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK------I 69
           L  R  LVTG+S GIG   AL  AR GA +I  GR   +L+ +   +             
Sbjct: 11  LQGRTILVTGASAGIGREAALSYARHGARLILLGRDAERLDAVSRQIVADGAPRPHALCC 70

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+       S AL      +A+R+G LD L+  AG+LGSI+P+ Q     +  V+ VN+ 
Sbjct: 71  DLMTLSPTQSQAL---ADDLAQRFGHLDGLLHCAGLLGSITPLAQQAYSEWQSVMQVNLN 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + R   P L+++     I  SS      R  WGAY+ SK A E L + W++E   +
Sbjct: 128 AAFLLTRDLLPLLRRAERASIIFTSSSVGRAGRAGWGAYAVSKFATEGLMQVWAQELAGS 187

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLFSVPQN 248
           A+RV  I+PG TRT+MRA A P EDP  +  P ++  +  +L     + E G+       
Sbjct: 188 AIRVNAINPGATRTAMRASAFPDEDPQALRTPAQIMPLYLYLMGDDSLGENGRSLDAQPG 247

Query: 249 R 249
           R
Sbjct: 248 R 248


>gi|291326243|ref|ZP_06123716.2| oxidoreductase, short-chain dehydrogenase/reductase family
           [Providencia rettgeri DSM 1131]
 gi|291315163|gb|EFE55616.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Providencia rettgeri DSM 1131]
          Length = 263

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 124/241 (51%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK------I 69
           L  +  LVTG+  GIG   AL  AR GA +I  GR++ +L+ + + +  ++ K      +
Sbjct: 20  LKGKTILVTGAGDGIGREAALTYARYGASLILVGRTLHKLQSVSDEIAALDGKNPPCFIL 79

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+    + D + L    + +A     LD ++ NAGILG ++PI +     + DV+ +NV 
Sbjct: 80  DLLTATIDDCHTL---ASQVASITPYLDGVLHNAGILGVVAPISEQPSDLWHDVMQINVN 136

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L K+     +  SS    + R  WGAYS SK A E L +  S+E  ++
Sbjct: 137 ATFMLTQALLPLLLKAPNASLVFTSSSVGKQGRAGWGAYSVSKFATEGLMQILSEEYKHS 196

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLFSVPQN 248
            LRV  I+PG TRTSMRA A P EDP  +  P  +  I  +L     + +TG  +     
Sbjct: 197 NLRVNCINPGGTRTSMRASAFPDEDPLKLKTPADIMPIYIYLMGDDSLRKTGSSYDAQPG 256

Query: 249 R 249
           R
Sbjct: 257 R 257


>gi|218553822|ref|YP_002386735.1| short chain dehydrogenase [Escherichia coli IAI1]
 gi|218360590|emb|CAQ98148.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           IAI1]
          Length = 252

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    I   + +LD ++ NAG+LG + PI +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRITVNYPRLDGVLHNAGLLGDVCPISEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 LLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|333007607|gb|EGK27085.1| short chain dehydrogenase family protein [Shigella flexneri K-272]
 gi|333019541|gb|EGK38821.1| short chain dehydrogenase family protein [Shigella flexneri K-227]
          Length = 252

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 127/239 (53%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  +   + +LD ++ NAG+LG + P+ +   + + DV+ VNV A 
Sbjct: 70  DLLTCTSENCQQLAQRIVVN-YPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     L
Sbjct: 129 FMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P E+P  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEEPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|294818111|ref|ZP_06776753.1| Short-chain dehydrogenase/reductase SDR [Streptomyces clavuligerus
           ATCC 27064]
 gi|326446780|ref|ZP_08221514.1| short-chain dehydrogenase/reductase SDR [Streptomyces clavuligerus
           ATCC 27064]
 gi|294322926|gb|EFG05061.1| Short-chain dehydrogenase/reductase SDR [Streptomyces clavuligerus
           ATCC 27064]
          Length = 247

 Score =  118 bits (295), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 121/234 (51%), Gaps = 20/234 (8%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            LDNR ALVTG+S GIG   A   A  GA V   GR  ++L   K+A++++  +      
Sbjct: 3   QLDNRTALVTGASTGIGLAIARRFAAEGATVYLTGRREAEL---KSAVEQVGDRAIGIRS 59

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ +   L+     IA+R G+LDI++ANAG+ G   P+  I E+ +    S+N+      
Sbjct: 60  DVSELGDLDRLFAGIAERSGRLDIVVANAGV-GDSGPLGTITEEEYERTTSINLKGTVFT 118

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           ++   P L        I+LSS AA +  P  G Y+A+KAAI +LARTW+ E  +  +RV 
Sbjct: 119 VQKALPLLPAGAS--VILLSSSAALRGVPGLGVYAATKAAIRSLARTWAAELADRGIRVN 176

Query: 195 NIDPGPTRT----SMRAKAMPAED--PNTVP-------HPQKVAKIISFLCATQ 235
            + PGP  T     +RA A+P +D   +  P       HP +VA    +L   Q
Sbjct: 177 ALTPGPVTTPGADELRA-ALPLDDHAGSAAPTPLGRSGHPDEVAATALYLAGAQ 229


>gi|238919607|ref|YP_002933122.1| hypothetical protein NT01EI_1706 [Edwardsiella ictaluri 93-146]
 gi|238869176|gb|ACR68887.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 254

 Score =  118 bits (295), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 119/241 (49%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI------ 69
           L  R  LVTG+S GIG   AL  AR GA +I  GR   +L+ +   +             
Sbjct: 11  LQGRTILVTGASAGIGREAALSYARHGARLILLGRDAERLDTVSRQIIADGAPCPHVLCC 70

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+       S AL      +A+R+G LD L+  AG+LGSI+P+ Q     +  V+ VN+ 
Sbjct: 71  DLMTLSPSQSQAL---ADDLARRFGHLDGLLHCAGLLGSITPLAQQAYSEWQSVMQVNLN 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + R   P L+++     I  SS      R  WGAY+ SK A E + + W++E   +
Sbjct: 128 AAFLLTRDLLPLLRRAGRASIIFTSSSVGRAGRAGWGAYAVSKFATEGVMQVWAQELAGS 187

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLFSVPQN 248
            +RV  I+PG TRT+MRA A P EDP T+  P ++  +  +L     + E G+       
Sbjct: 188 TIRVNAINPGATRTAMRASAFPGEDPQTLRTPAQIMPLYLYLMGDDSLGENGRSLDAQPG 247

Query: 249 R 249
           R
Sbjct: 248 R 248


>gi|289548084|ref|YP_003473072.1| short-chain dehydrogenase/reductase SDR [Thermocrinis albus DSM
           14484]
 gi|289181701|gb|ADC88945.1| short-chain dehydrogenase/reductase SDR [Thermocrinis albus DSM
           14484]
          Length = 233

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 112/210 (53%), Gaps = 7/210 (3%)

Query: 21  ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF--DLRD 78
           A+VTG SRGIG        +    V  C R    L  LK   +++   I++FA   D++D
Sbjct: 10  AVVTGGSRGIGRAIVEAFLKENYRVCTCARHQEGLLVLK---RELGDPINLFAMPCDVKD 66

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
            ++++    +     GK+D+L+ NAG+LG    I    E  + +V+ VN+   + + + F
Sbjct: 67  RDSVKSFVNHCVSFLGKVDVLVNNAGVLGVREKIEGYPEDVWEEVLRVNLNGMFFVTKYF 126

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P++++   G  I +SSG   +  P WGAY+ SK   E  +   ++E     +RV   +P
Sbjct: 127 IPYMERG--GFIINMSSGVGKRPAPTWGAYAVSKFGTEGFSLLLAEELRERDIRVYAFNP 184

Query: 199 GPTRTSMRAKAMPAEDPNTVPHPQKVAKII 228
           G TRT+MRA+A P EDP  +  P++VA+ +
Sbjct: 185 GATRTTMRAQAYPQEDPTRLKSPEEVARAV 214


>gi|119945660|ref|YP_943340.1| short-chain dehydrogenase/reductase SDR [Psychromonas ingrahamii
           37]
 gi|119864264|gb|ABM03741.1| short-chain dehydrogenase/reductase SDR [Psychromonas ingrahamii
           37]
          Length = 245

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 112/204 (54%), Gaps = 5/204 (2%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK-IDIFA 73
           +L+ +  L+TG+  GIG   AL  A  GA VI  G+++ +LE + + ++   K+   I  
Sbjct: 10  SLNGKTILITGAGAGIGKTLALHCATLGAKVILLGKTVKKLEAVYDQIELQGKQQAAILP 69

Query: 74  FDLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
            DL    + +  +L  T I + +GKLD L+ NA  LG + P  QI++ ++ ++I  NV A
Sbjct: 70  VDLNGATEEHYADLADT-IKREYGKLDALVHNASQLGVLGPFAQIEKSTWDEIIQTNVTA 128

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            + + ++  P L  +     I  +S   +  R  WGAYS SK A E + +  + E  +++
Sbjct: 129 QFLLTKALIPVLSLAPQASVIFTTSSVGHAGRAYWGAYSISKFASEGMMQVLADEYEHSS 188

Query: 191 LRVINIDPGPTRTSMRAKAMPAED 214
           LR   I+PG TRT MRA A PAED
Sbjct: 189 LRFNAINPGATRTEMRASAYPAED 212


>gi|297374013|emb|CBJ20840.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
          Length = 103

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (72%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  RP WGAY+ASKAA+E +AR W++E   T ++V  ++PG TRT+MRA+AMP E+
Sbjct: 1   SSVAHAARPFWGAYAASKAALEMIARCWAEELKQTPIKVNCVNPGATRTAMRAEAMPGEE 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P T+P PQ+VAK I  L +    ETGKLF+V +NRFV+Y  P+
Sbjct: 61  PQTLPSPQEVAKKIVHLLSPDLKETGKLFNVHKNRFVDYHVPD 103


>gi|307130980|ref|YP_003882996.1| putative oxoacyl-(acyl carrier protein) reductase [Dickeya dadantii
           3937]
 gi|306528509|gb|ADM98439.1| predicted oxoacyl-(acyl carrier protein) reductase [Dickeya
           dadantii 3937]
          Length = 253

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 125/241 (51%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNA-LQKINKKIDI 71
           H  L +R+ LVTG+  GIG   AL  AR GA ++  GR+ S+L++++   LQ+      +
Sbjct: 7   HDLLQHRIILVTGAGDGIGREAALTYARYGAKLVLLGRTESKLQEVEQQILQECGVHSYL 66

Query: 72  FAFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
              D+  ++  +  +    I +   +LD ++ NAG+LG + P+ +     +  V+ VNV 
Sbjct: 67  IPCDMLTASHHDFIQIAGQIGQALPRLDGVLHNAGLLGDVVPMEEQSATVWHQVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS     I  SS    + R  WGAYS SK A E + +  ++E  N 
Sbjct: 127 ATFMLTQALLPLLLKSTSPSLIFTSSSVGRQGRANWGAYSVSKFATEGMMQVLAEEYRNR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRTSMRA A P EDP+ +  P  +  +  +L     + +TG  F     
Sbjct: 187 NLRVNCINPGGTRTSMRAAAFPDEDPDKLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|254481720|ref|ZP_05094963.1| KR domain superfamily protein [marine gamma proteobacterium
           HTCC2148]
 gi|214037849|gb|EEB78513.1| KR domain superfamily protein [marine gamma proteobacterium
           HTCC2148]
          Length = 252

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 115/227 (50%), Gaps = 6/227 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L  +  LVTG+  GIG   AL  A  GA V+  GR+ S+LE + + ++   + K  +   
Sbjct: 17  LAGKTVLVTGAGDGIGRVAALTYAAHGATVVLLGRTESKLEAVYDEIEVAGHPKPGLVTM 76

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL    D   ++L +  +A+ +G LD L+ NA +LG   PI       + +V+ VNV A 
Sbjct: 77  DLSQVTDDQCVQLAQG-LAEEFGHLDGLLHNASLLGERRPIESSSYAVWQEVMQVNVNAQ 135

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-A 190
           + + R   P L+ +     I+ SSG     +  WGAY  SK A E   +  + E  NT +
Sbjct: 136 FVLTRRLLPMLQAAPSSSIILTSSGVGRIGKAFWGAYCVSKFATEGFMQVLASELENTSS 195

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
           +RV  I+PG T T+MR  A PAE+P   P P+ +  +  +L     I
Sbjct: 196 IRVNCINPGGTNTAMRRTAFPAENPTDNPAPEDIMGVYLYLMGEDSI 242


>gi|297374046|emb|CBJ20862.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374049|emb|CBJ20864.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
          Length = 103

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (72%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  RP WGAY+ASKAA+E +AR W++E   T +++  ++PG TRT+MRA+AMP ED
Sbjct: 1   SSVAHVARPFWGAYAASKAALEMIARCWAEELKQTPIKINCVNPGATRTAMRAEAMPGED 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P T+P PQ+VAK I  L +    ETGKLF+V +NRFV+Y  P+
Sbjct: 61  PQTLPSPQEVAKKIVHLLSPDLKETGKLFNVRKNRFVDYHIPD 103


>gi|271500647|ref|YP_003333672.1| short-chain dehydrogenase/reductase SDR [Dickeya dadantii Ech586]
 gi|270344202|gb|ACZ76967.1| short-chain dehydrogenase/reductase SDR [Dickeya dadantii Ech586]
          Length = 253

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 124/240 (51%), Gaps = 8/240 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNA-LQKINKKIDIFAF 74
           L +R+ LVTG+  GIG   AL  AR GA ++  GR+ S+L  ++   LQ+      +   
Sbjct: 10  LQHRIILVTGAGDGIGREAALTYARHGASMVLLGRTESKLRDVEQQILQECGTHSYLIPC 69

Query: 75  DLRDSNALELTKTYIAKRWG----KLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
           D+  ++  +  +  IA + G    +LD ++ NAG+LG I P+ +     +  V+ VNV A
Sbjct: 70  DMLTASHHDFVQ--IAGQLGQALPRLDGVLHNAGLLGDIVPMAEQSATVWHQVMQVNVNA 127

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            + + ++  P L KS     I  SS    + R  WGAYS SK A E + +  ++E  N  
Sbjct: 128 TFMLTQALLPLLLKSATPSLIFTSSSVGRQGRANWGAYSVSKFATEGMMQVLAEEYRNRN 187

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           LRV  I+PG TRT MRA A P EDPN +  P  +  +  +L     + +TG  F    +R
Sbjct: 188 LRVNCINPGGTRTPMRAAAFPNEDPNKLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPDR 247


>gi|238894326|ref|YP_002919060.1| short chain dehydrogenase [Klebsiella pneumoniae NTUH-K2044]
 gi|238546642|dbj|BAH62993.1| short chain dehydrogenase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 253

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 122/241 (50%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L +R+ LVTG+S GIG   AL  AR  A VI  GR+    +KL+   Q+I ++  I    
Sbjct: 10  LKDRIILVTGASDGIGREAALTYARYSASVILLGRND---DKLRTVAQEIEREGGIPPRW 66

Query: 72  FAFDLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL      A +     I+  + +LD ++ NAG+LG I P+ + K + +  V+ VNV 
Sbjct: 67  FTLDLLTCTPQACQQLAQQISMHYPRLDGVLHNAGLLGDICPMEEQKPEVWQQVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L +S  G  +  SS    + R  WGAY+ SK A E + +  + E  + 
Sbjct: 127 GTFMLTQALLPLLLRSESGSLVFTSSSVGRQGRANWGAYAVSKFATEGMMQVLADEYQSR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 HLRVNCINPGGTRTGMRASAFPTEDPLKLKTPADIMPVYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|152969821|ref|YP_001334930.1| short chain dehydrogenase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|150954670|gb|ABR76700.1| short chain dehydrogenase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
          Length = 266

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 122/241 (50%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L +R+ LVTG+S GIG   AL  AR  A VI  GR+    +KL+   Q+I ++  I    
Sbjct: 23  LKDRIILVTGASDGIGREAALTYARYSASVILLGRND---DKLRTVAQEIEREGGIPPRW 79

Query: 72  FAFDLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL      A +     I+  + +LD ++ NAG+LG I P+ + K + +  V+ VNV 
Sbjct: 80  FTLDLLTCTPQACQQLAQQISMHYPRLDGVLHNAGLLGDICPMEEQKPEVWQQVMQVNVN 139

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L +S  G  +  SS    + R  WGAY+ SK A E + +  + E  + 
Sbjct: 140 GTFMLTQALLPLLLRSESGSLVFTSSSVGRQGRANWGAYAVSKFATEGMMQVLADEYQSR 199

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 200 HLRVNCINPGGTRTGMRASAFPTEDPLKLKTPADIMPVYLWLMGDDSRRKTGMTFDAQPG 259

Query: 249 R 249
           R
Sbjct: 260 R 260


>gi|254515163|ref|ZP_05127224.1| short chain dehydrogenase [gamma proteobacterium NOR5-3]
 gi|219677406|gb|EED33771.1| short chain dehydrogenase [gamma proteobacterium NOR5-3]
          Length = 257

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 120/231 (51%), Gaps = 8/231 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ +  LVTG+S GIG   AL  A  GA V+   R++ +LE + + ++     +     F
Sbjct: 22  LEGKTILVTGASDGIGRAAALSFAAHGATVVLLARNVEKLEAVYDLIEAAGGPQPAAIPF 81

Query: 75  DLRDSNA---LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL   N    +EL +  I ++ GKLD L+ NA +LG    + Q     + DV+ +NV + 
Sbjct: 82  DLSQDNEEAFIELARV-IDEQLGKLDGLLLNASMLGQRRALEQSAWNDWRDVLQLNVHSQ 140

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA- 190
           +   +   P L+++     +  SSG     R  WGAY+ SK A E + +  + ET NT+ 
Sbjct: 141 FLTAKCLMPLLREAPKASVVFTSSGVGRTGRAYWGAYAVSKFATEGMMQVLASETENTSN 200

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGK 241
           +RV  I+PG T T+MR  A PAE+P + P P+ + +  S+L        GK
Sbjct: 201 IRVNCINPGATNTAMRRAAYPAEEPGSNPSPEHIMR--SYLYLMDDASEGK 249


>gi|206576589|ref|YP_002238997.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Klebsiella pneumoniae 342]
 gi|206565647|gb|ACI07423.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Klebsiella pneumoniae 342]
          Length = 253

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 122/241 (50%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L +R+ LVTG+S GIG   AL  AR  A VI  GR+    EKL+   Q+I ++  I    
Sbjct: 10  LKDRIILVTGASDGIGREAALTYARYSASVILLGRND---EKLRAVAQEIEREGGIPARW 66

Query: 72  FAFDLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL      A +     I+  + +LD ++ NAG+LG I P+ + K + +  V+ VNV 
Sbjct: 67  FTLDLLTCTPQACQQLAQQISMHYPRLDGVLHNAGLLGDICPMDEQKPEVWQQVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L +S  G  +  SS    + R  WGAY+ SK A E + +  + E  + 
Sbjct: 127 GTFMLTQALLPLLLRSDAGSLVFTSSSVGRQGRANWGAYAVSKFATEGMMQVLADEYQSR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 HLRVNCINPGGTRTGMRASAFPTEDPLKLKTPADIMPVYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|260867719|ref|YP_003234121.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           O111:H- str. 11128]
 gi|257764075|dbj|BAI35570.1| predicted oxoacyl-(acyl carrier protein) reductase [Escherichia
           coli O111:H- str. 11128]
 gi|320199305|gb|EFW73896.1| Putative oxidoreductase [Escherichia coli EC4100B]
 gi|323153298|gb|EFZ39556.1| short chain dehydrogenase family protein [Escherichia coli EPECa14]
 gi|323179778|gb|EFZ65339.1| short chain dehydrogenase family protein [Escherichia coli 1180]
 gi|323185571|gb|EFZ70932.1| short chain dehydrogenase family protein [Escherichia coli 1357]
          Length = 252

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    I   + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRITVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 LLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|270262111|ref|ZP_06190383.1| short chain dehydrogenase [Serratia odorifera 4Rx13]
 gi|270043987|gb|EFA17079.1| short chain dehydrogenase [Serratia odorifera 4Rx13]
          Length = 284

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 125/241 (51%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI- 71
           H  L+ R+ LVTG+  GIG   AL  A+ GA ++  GR+ S+L  +++ +  +       
Sbjct: 38  HDLLEQRIILVTGAGDGIGREAALTYAKFGAQLVLLGRTESKLRAVQSEIALLGGAPSFT 97

Query: 72  FAFDLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
              DL  +   +  +    +A +  +LD ++ NAG+LG I+P+  +  + + DV+ VNV 
Sbjct: 98  VTLDLLHTTQEQCKQVADDLATQIPRLDGVLHNAGLLGDIAPMADLSMEMWHDVMQVNVN 157

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS+ G  +  SS      R  WGAY+ SK A E + +  ++E  + 
Sbjct: 158 ATFMLTQALLPLLLKSNSGSLVFTSSSVGRTGRANWGAYAVSKFATEGMMQVLAEEYKSR 217

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P ED N +  P  +  +  +L     + +TG  F    N
Sbjct: 218 HLRVNCINPGGTRTQMRASAFPNEDKNKLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPN 277

Query: 249 R 249
           R
Sbjct: 278 R 278


>gi|297374043|emb|CBJ20860.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
          Length = 103

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (72%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  RP WGAY+ASKAA+E +AR W++E   T +++  ++PG TRT+MRA+AMP ED
Sbjct: 1   SSVAHVARPFWGAYAASKAALEMIARCWAEELKQTPIKINCVNPGATRTAMRAEAMPGED 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P T+P PQ+VAK I  L +    ETGKLF+V +NRFV+Y  P+
Sbjct: 61  PQTLPSPQEVAKKIIHLLSPDLKETGKLFNVRKNRFVDYHIPD 103


>gi|254387867|ref|ZP_05003105.1| short-chain dehydrogenase/reductase SDR [Streptomyces clavuligerus
           ATCC 27064]
 gi|197701592|gb|EDY47404.1| short-chain dehydrogenase/reductase SDR [Streptomyces clavuligerus
           ATCC 27064]
          Length = 262

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 121/234 (51%), Gaps = 20/234 (8%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            LDNR ALVTG+S GIG   A   A  GA V   GR  ++L   K+A++++  +      
Sbjct: 3   QLDNRTALVTGASTGIGLAIARRFAAEGATVYLTGRREAEL---KSAVEQVGDRAIGIRS 59

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ +   L+     IA+R G+LDI++ANAG+ G   P+  I E+ +    S+N+      
Sbjct: 60  DVSELGDLDRLFAGIAERSGRLDIVVANAGV-GDSGPLGTITEEEYERTTSINLKGTVFT 118

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           ++   P L        I+LSS AA +  P  G Y+A+KAAI +LARTW+ E  +  +RV 
Sbjct: 119 VQKALPLLPAGAS--VILLSSSAALRGVPGLGVYAATKAAIRSLARTWAAELADRGIRVN 176

Query: 195 NIDPGPTRT----SMRAKAMPAED--PNTVP-------HPQKVAKIISFLCATQ 235
            + PGP  T     +RA A+P +D   +  P       HP +VA    +L   Q
Sbjct: 177 ALTPGPVTTPGADELRA-ALPLDDHAGSAAPTPLGRSGHPDEVAATALYLAGAQ 229


>gi|320540530|ref|ZP_08040180.1| putative predicted oxoacyl-(acyl carrier protein) reductase,
           EmrKY-TolC system [Serratia symbiotica str. Tucson]
 gi|320029461|gb|EFW11490.1| putative predicted oxoacyl-(acyl carrier protein) reductase,
           EmrKY-TolC system [Serratia symbiotica str. Tucson]
          Length = 253

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 122/238 (51%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L  R+ LVTG+S GIG   AL  AR GA ++  GR+ S+L+ ++  +  +      I   
Sbjct: 10  LKQRIILVTGASAGIGREAALTYARFGAQLVLLGRTESKLQAVQAKIAAMGSLPAHIVTL 69

Query: 75  DLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +   +  +    +  +  +LD ++ NAG+LG I+P+ ++    + +V+ VNV A  
Sbjct: 70  DLLHTTPAQCQQVADDLTAQIPRLDGVLHNAGVLGDIAPMIELSMTMWQEVMHVNVNATV 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L +SH G  +  SS      R  WGAY+ SK A E + +  + E  +  LR
Sbjct: 130 MLTQALLPLLLRSHAGTLVFTSSSVGRTGRANWGAYAVSKFATEGIMQVLADEYRSRNLR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TR+ MRA A P ED N +  P  +  +  +L     + +TG  F    +R
Sbjct: 190 VNCINPGGTRSKMRAAAFPHEDSNKLKTPADIMPLYLYLMGDDSRFKTGMTFDAQPHR 247


>gi|162453254|ref|YP_001615621.1| oxidoreductase [Sorangium cellulosum 'So ce 56']
 gi|161163836|emb|CAN95141.1| Oxidoreductase [Sorangium cellulosum 'So ce 56']
          Length = 270

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 112/237 (47%), Gaps = 9/237 (3%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R ALVTG+SRG+G   A ELAR GA V+   R    LE +   +     +    A D+ D
Sbjct: 34  RAALVTGASRGLGAALARELARQGAKVVLVARERGPLEAVAAEIAAQGGEAHAIAADIGD 93

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSIS-PIWQIKE-KSFADVISVNVMANWNIMR 136
                      A   G +D+L+ NA  LG    PI    E +     + VNV+  + + +
Sbjct: 94  KGQTHAIAGAAAALVGPIDLLVHNASTLGKTPLPILLDTECEDLGRALEVNVVGPFRLTK 153

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
                +     G  + +SS AA    P WGAY ASKAA++ L+RTW+ E   T +    +
Sbjct: 154 VVAGAMALRRRGVVVHISSDAAVNAYPRWGAYGASKAALDHLSRTWAAELEGTGVAFYAV 213

Query: 197 DPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC-------ATQKIETGKLFSVP 246
           DPG   T M A+A+P  DP+T+  P  VA+ I  L        +  ++E  +L   P
Sbjct: 214 DPGEMNTRMHAEAIPDADPSTLADPADVARRIVGLVGRAGAVPSGARLEAARLEEAP 270


>gi|297374040|emb|CBJ20858.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374052|emb|CBJ20866.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
          Length = 103

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 75/103 (72%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  RP WGAY+ASKAA+E +AR W++E   T +++  ++PG TRT+MRA+AMP ED
Sbjct: 1   STVAHAARPFWGAYAASKAALEVIARCWAEELKQTPIKINCVNPGATRTAMRAEAMPGED 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P T+P PQ++AK I  L +    ETGKLF+V +NRFV+Y  P+
Sbjct: 61  PQTLPSPQEIAKKIIHLLSPDLKETGKLFNVRKNRFVDYHIPD 103


>gi|317048301|ref|YP_004115949.1| short-chain dehydrogenase/reductase SDR [Pantoea sp. At-9b]
 gi|316949918|gb|ADU69393.1| short-chain dehydrogenase/reductase SDR [Pantoea sp. At-9b]
          Length = 254

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 124/238 (52%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK---IDIF 72
           L+NR+ LVTG+S GIG   AL  AR GA VI  GR+   L+  + A+ +++KK     + 
Sbjct: 10  LENRIILVTGASDGIGREAALTYARYGAQVILLGRNPETLQHTEQAINQLHKKPASTLLL 69

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            F      + +     +A++  +LD ++ NAGILG I P+ +++   +  V+ +N+ A +
Sbjct: 70  DFAHATPESCQQLAEQLAQQVPRLDGVLHNAGILGEIVPLAELEPHIWRQVMQINLDATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  I  +S      R  WGAY+ SK A E + +  + E  N  LR
Sbjct: 130 YLTQALLPLLLKSEAGSLIFTTSSVGRVGRSGWGAYAVSKFATEGMMQVLADEYKNRHLR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT MRA A P ED + +  P  +  +  +L     + +TG  F     R
Sbjct: 190 VNCINPGGTRTKMRASAFPHEDASLLKTPADLMPLYLYLMGDDSRRKTGISFDAQPGR 247


>gi|123442463|ref|YP_001006442.1| short chain dehydrogenase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089424|emb|CAL12272.1| putative short chain dehydrogenase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 253

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 123/241 (51%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI- 71
           H  LDN   LVTG+  GIG   AL  AR GA +I  GR++ +L  ++  + K   +  I 
Sbjct: 7   HDLLDNHTILVTGAGDGIGREAALTYARFGARLILVGRTLHKLVAVQQQIAKAGGQAAIV 66

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           +  DL  + A +  +    ++++   LD ++ NAG+LG I P+ +     + DV+ VNV 
Sbjct: 67  WELDLLHATAQDCQQLADALSQQISHLDGVLHNAGLLGEIVPMAEQDITVWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS     +  SS    + R  WGAY+ SK A E + +  ++E   +
Sbjct: 127 ATFMLTQALLPLLLKSPSASLVFTSSSVGRQGRSGWGAYAVSKFATEGMMQVLAEEYKQS 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P ED N +  P  +  +  +L     + +TG  F     
Sbjct: 187 NLRVNCINPGGTRTQMRASAFPDEDTNKLKTPADIMPLYLYLMGDDSRRKTGISFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|288935906|ref|YP_003439965.1| short-chain dehydrogenase/reductase SDR [Klebsiella variicola
           At-22]
 gi|290512949|ref|ZP_06552313.1| oxidoreductase yciK [Klebsiella sp. 1_1_55]
 gi|288890615|gb|ADC58933.1| short-chain dehydrogenase/reductase SDR [Klebsiella variicola
           At-22]
 gi|289774562|gb|EFD82566.1| oxidoreductase yciK [Klebsiella sp. 1_1_55]
          Length = 253

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 122/241 (50%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L +R+ LVTG+S GIG   AL  AR  A VI  GR+    EKL+   Q+I ++  +    
Sbjct: 10  LKDRIILVTGASDGIGREAALTYARYSASVILLGRND---EKLRAVAQEIEREGGLPARW 66

Query: 72  FAFDLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           F  DL      A +     I+  + +LD ++ NAG+LG I P+ + K + +  V+ VNV 
Sbjct: 67  FTLDLLTCTPQACQQLAQQISMHYPRLDGVLHNAGLLGDICPMDEQKPEVWQQVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L +S  G  +  SS    + R  WGAY+ SK A E + +  + E  + 
Sbjct: 127 GTFMLTQALLPLLLRSDAGSLVFTSSSVGRQGRANWGAYAVSKFATEGMMQVLADEYQSR 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F     
Sbjct: 187 HLRVNCINPGGTRTGMRASAFPTEDPLKLKTPADIMPVYLWLMGDDSRRKTGMTFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|126665972|ref|ZP_01736952.1| short chain dehydrogenase [Marinobacter sp. ELB17]
 gi|126629294|gb|EAZ99911.1| short chain dehydrogenase [Marinobacter sp. ELB17]
          Length = 249

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN---KKIDIF 72
           L +R+ +VTG+  GIG   A+  A  GA VI  GR++S+LE + + ++        I   
Sbjct: 11  LKDRIIMVTGAGSGIGRTAAIAYAAHGATVILVGRTVSKLESVYDEIENAGYPKPAIVPM 70

Query: 73  AFD---LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            FD   ++D   L +T   +   +GKLD L+ NA ILG  SP+     + +A V+ VN M
Sbjct: 71  NFDGAAMKDYEELAMT---LEDNFGKLDGLLHNAAILGDRSPVELSDPEKWAKVMQVNSM 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN- 188
           A + + R+  P L+KS     I  SS      R  WGAY+ SK A+E L++  + E  + 
Sbjct: 128 APFLLSRAMIPLLRKSGDASMIFTSSSVGRSARAYWGAYAVSKFAVEGLSQLLADELDDE 187

Query: 189 -TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
              +RV  ++PG TRT+MRA A PAE+P     P+++  I  +L  
Sbjct: 188 RNNIRVNTLNPGATRTNMRAHAYPAENPQQNRAPEELMPIYLYLMG 233


>gi|24374462|ref|NP_718505.1| short chain dehydrogenase [Shewanella oneidensis MR-1]
 gi|24349041|gb|AAN55949.1|AE015733_1 oxidoreductase, short-chain dehydrogenase/reductase family
           [Shewanella oneidensis MR-1]
          Length = 245

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 126/234 (53%), Gaps = 6/234 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  +  LVTG+  GIG   A+E A+ GA VI  G+++ +LE + + ++        I   
Sbjct: 11  LKGKTILVTGAGAGIGRAAAIEFAKHGATVILLGKTVKKLEAVYDVIELAGYPTPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++  T I++++G LD L+ NA +LG++ P   I   S  DV+ VNV A 
Sbjct: 71  DLKGATEQNYRDMADT-ISEQFGHLDGLLHNASLLGALGPFEHIDIPSLEDVLKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P L+++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPVLRQAPNASIIFTSSSVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGKLFS 244
           RV +I+PG TRT MRAKA PAE+P  +  P+++     +L      E  G+ F+
Sbjct: 190 RVNSINPGATRTEMRAKAYPAENPFDLKTPEEIMPTYLYLMGQDSSEINGQQFN 243


>gi|149374312|ref|ZP_01892086.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Marinobacter algicola DG893]
 gi|149361015|gb|EDM49465.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Marinobacter algicola DG893]
          Length = 249

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/223 (33%), Positives = 122/223 (54%), Gaps = 5/223 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L  R+ +VTG+  GIG   A   A  GA VI  GR++S+LE + + ++   + K  I   
Sbjct: 11  LKERIIMVTGAGSGIGRAAAKAYAAHGATVILVGRTVSKLESVYDEIEAAGHPKPAIVPL 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +   +   E  +    I   + ++D L+ NA ILG+ SPI     + +  V+ VN  A +
Sbjct: 71  NFEGAAVKEYEELAMTIEDNFDRIDGLLHNAAILGTRSPIELYDPEIWNKVMHVNATAPF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-- 190
            + R+  P L+KS     I  +SG   + +P WGAY+ SK AIE L++  ++E  +    
Sbjct: 131 LLSRAMIPLLRKSDDASVIFTASGVGRRAKPYWGAYAVSKFAIEGLSQMLAEELDDDRHN 190

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           +RV +++PG TRT+MRA A PAE+P+  P P+++  +  +L  
Sbjct: 191 VRVNSLNPGATRTNMRATAYPAENPDQNPAPEELMPVYLYLMG 233


>gi|300777118|ref|ZP_07086976.1| possible carbonyl reductase (NADPH) [Chryseobacterium gleum ATCC
           35910]
 gi|300502628|gb|EFK33768.1| possible carbonyl reductase (NADPH) [Chryseobacterium gleum ATCC
           35910]
          Length = 273

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 119/234 (50%), Gaps = 21/234 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
             N+LA+VTG + GIG+  A EL   GA VI  GR    +EK    L  I      F  D
Sbjct: 29  FSNKLAVVTGGNSGIGFSAAKELISEGATVIITGRRKEAVEKAAQELGAIP-----FIAD 83

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
             + N ++L K  I  ++GK+DIL  NAGI G+++PI  +  ++F  V+++N    +  +
Sbjct: 84  QANLNDIDLLKEEIETQFGKIDILFINAGITGTLTPIENMDVENFDQVMNINFRGAYFTL 143

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
             F P L  +     I LSS  A   +P   AY ASKAA+ ++A+T + E     +RV  
Sbjct: 144 SKFIPIL--NDGASVIFLSSIVASTYKPNSSAYQASKAALNSIAKTAAAELAPRKIRVNM 201

Query: 196 IDPGPTRTSMRAKAMPAEDP--NTVPH------------PQKVAKIISFLCATQ 235
           I PGP +T + +KA   E+   N   H             ++VAK++++L   Q
Sbjct: 202 ISPGPIKTEIMSKAGLDEETLKNIQTHLIEQIPLKKTGTAEEVAKLVTYLSDDQ 255


>gi|157370900|ref|YP_001478889.1| short chain dehydrogenase [Serratia proteamaculans 568]
 gi|157322664|gb|ABV41761.1| short-chain dehydrogenase/reductase SDR [Serratia proteamaculans
           568]
          Length = 276

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L+ R+ LVTG+  GIG   AL  A+ GA ++  GR+ S+L+ ++  + +++     I   
Sbjct: 33  LEKRIILVTGAGDGIGREAALTYAKFGAQLVLLGRTESKLQAVQAEIARLSSAPTYIITL 92

Query: 75  DLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +   +  +    +A +  +LD ++ NAG+LG I+P+ ++  + + +V+ VNV A +
Sbjct: 93  DLLHTTQEQCQQVAEELATQVPRLDGVLHNAGLLGDIAPMAELSMEMWNEVMQVNVNATF 152

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS+ G  +  SS      R  WGAY+ SK A E + +  + E  +  LR
Sbjct: 153 MLTQALLPLLLKSNAGSLVFTSSSVGRSGRANWGAYAVSKFATEGMMQVLADEYKSRNLR 212

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT MRA A P ED + +  P  +  +  +L     + +TG  F    NR
Sbjct: 213 VNCINPGGTRTQMRATAFPHEDKSKLKTPADIMPLYLYLMGDDSRRKTGMSFDAQPNR 270


>gi|269958553|ref|YP_003328340.1| putative dehydrogenase [Anaplasma centrale str. Israel]
 gi|269848382|gb|ACZ49026.1| putative dehydrogenase [Anaplasma centrale str. Israel]
          Length = 253

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++ALVTG+S GIG   A   A+ GA V+   R++ +L+ L + +Q+   +  +   D
Sbjct: 15  LRGKVALVTGASCGIGAAVARRFAKEGASVVLVARNMDRLKALCDCIQESGGEAILAPID 74

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           ++D  +++     +  R+G LDIL++ A +LGS+ P+ + +  ++ +++ VN+ ANW ++
Sbjct: 75  IQDYESVKNLALSVKSRFGCLDILVSVAALLGSLGPVQEYEPAAWKEIMHVNLFANWYLI 134

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPL-----WGAYSASKAAIEALARTWSKETVNTA 190
           + FD  LK +  GRAI ++S AA   R L     +  Y+ASK A+EA+ + ++ ET ++ 
Sbjct: 135 KHFDALLKSAQAGRAIFVTSEAA---RSLLNYSYFAPYAASKVALEAMVQVYAVETKHSK 191

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQN 248
           L    + P    +++ ++   A++ + +  P  +      L + +   TG+++ +  N
Sbjct: 192 LCANVVYPCGVDSNIYSQIFSAQEQSKLLAPDSLTDKFVELASEECCVTGQIYELTPN 249


>gi|253999132|ref|YP_003051195.1| short-chain dehydrogenase/reductase SDR [Methylovorus sp. SIP3-4]
 gi|253985811|gb|ACT50668.1| short-chain dehydrogenase/reductase SDR [Methylovorus sp. SIP3-4]
          Length = 248

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 117/220 (53%), Gaps = 4/220 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L + + LVTG+ +GIG   AL  AR GA VI CGR++ +LE + +A++     +  IF  
Sbjct: 11  LADHVILVTGAGQGIGREAALAFARHGATVILCGRTLKKLEAVYDAIEAAGYPQAVIFPL 70

Query: 75  DLR--DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL   D  +       I ++ G+LD ++ NA    ++SP+     + F  +  VNV A +
Sbjct: 71  DLSKTDEPSFAAMAEGIYQQLGRLDGILHNAAHYDNLSPLEIQTMEQFESMFKVNVTAPF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + ++  P LK+      I  SS A ++    WG++  SK A+E L +TW+ E  NT  +
Sbjct: 131 ALTKACLPLLKRGTDTSVIFTSSTAGHQAGAYWGSHGISKQAVEHLVKTWALELENTPNV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           R+  + PGP ++  R K+ P E  +++P  + +  +  +L
Sbjct: 191 RLNAVIPGPVQSPQRKKSHPGEVHDSLPTAESLMSVYLYL 230


>gi|329297658|ref|ZP_08254994.1| putative oxoacyl-(acyl carrier protein) reductase [Plautia stali
           symbiont]
          Length = 254

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 116/219 (52%), Gaps = 3/219 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK-IDIFAF 74
           LDNR+ LVTG+S GIG   AL  AR GA VI  GR+ + L++   A+ ++NK+       
Sbjct: 10  LDNRIILVTGASDGIGREAALTYARYGARVILLGRNATTLQQTAEAINQLNKQPAATLLL 69

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +   + +     +A    +LD ++ NAGILG I P+ ++    +  V+ +N+ A +
Sbjct: 70  DLAHATPESCQQLAQQVAALVPRLDGVLHNAGILGEIVPLAELDPAVWQQVMQINLDATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  +S      R  WGAY+ SK A E + +  + E  N  LR
Sbjct: 130 YLTQALLPLLLKSDAGSLVFTTSSVGRTGRAGWGAYAVSKFATEGMMQVLADEYKNRHLR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           V  I+PG TRT MRA A   E+ + +  P  +  +  +L
Sbjct: 190 VNCINPGGTRTKMRASAFSEENASLLKTPADLMPLYLYL 228


>gi|330964792|gb|EGH65052.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 246

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 121/222 (54%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L  R+ LVTG++RGIG   A   +  GA V+  GR+ + L ++ + ++   + +  I A 
Sbjct: 11  LKGRVILVTGAARGIGAAAARAYSAHGASVVLLGRTEASLAEVSDQIKSAGQPQPLIIAL 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  + A +  +  T +   +G+LD L+ NA I+G  +P+ Q+ ++ F  V+ VNV A +
Sbjct: 71  DLESATAQQYRELATRVEHEFGRLDGLLHNASIIGPRTPLEQLPDEDFMQVMHVNVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + R+  P LK+S        SS    K R  WGAY  SK A E L +T + E    TA+
Sbjct: 131 MLTRALLPLLKRSEDASIAFTSSSVGRKGRANWGAYGVSKFATEGLMQTLADELEGVTAV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA+A P E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTGMRAQAYPDENPLNNPAPEDIMPVYLYLMG 232


>gi|110834616|ref|YP_693475.1| short chain dehydrogenase/reductase family oxidoreductase
           [Alcanivorax borkumensis SK2]
 gi|110647727|emb|CAL17203.1| oxidoreductase, short chaindehydrogenase/reductase family
           [Alcanivorax borkumensis SK2]
          Length = 255

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 118/227 (51%), Gaps = 18/227 (7%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKN----------ALQKINK 67
            R+ LVTG+  GIG   AL LA  GA VI  GR+  +LE + +          AL  +N 
Sbjct: 20  GRIILVTGAGAGIGRSAALALAAHGATVILLGRTQEKLEAVYDEIKAAGGPEPALAPVNL 79

Query: 68  KIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
            +       R  +  EL   +  K +G+LD ++ NA +LG I+P+ +    ++  V+  N
Sbjct: 80  TV------ARPEDFQELAGLF-DKEFGRLDGILHNASMLGDITPMDRYATGTWDSVMQTN 132

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           V + + + ++  P L+ S   R +  SS    K R  WGAY+ SKAA E LA+  ++E  
Sbjct: 133 VNSAFYLTQAMLPLLRASDDARLLFTSSSVGRKGRAFWGAYAVSKAATENLAQVLAEELE 192

Query: 188 NTA-LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           NT+ +RV  ++PG TRT MRA A P EDP T+  P  +     FL  
Sbjct: 193 NTSNIRVNTVNPGGTRTDMRAMAYPGEDPLTLKTPADIMAPYLFLLG 239


>gi|313201233|ref|YP_004039891.1| short-chain dehydrogenase/reductase sdr [Methylovorus sp. MP688]
 gi|312440549|gb|ADQ84655.1| short-chain dehydrogenase/reductase SDR [Methylovorus sp. MP688]
          Length = 248

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 117/220 (53%), Gaps = 4/220 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L + + LVTG+ +GIG   AL  AR GA VI CGR++ +LE + +A++     +  IF  
Sbjct: 11  LADHVILVTGAGQGIGREAALAFARHGATVILCGRTLKKLEAVYDAIEAAGYPQAVIFPL 70

Query: 75  DLR--DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL   D  +       I ++ G+LD ++ NA    ++SP+     + F  +  VNV A +
Sbjct: 71  DLSKTDEPSFAAMAEGIYQQLGRLDGILHNAAHYDNLSPLEIQTMEQFESMFKVNVTAPF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + ++  P LK+      I  SS A ++    WG++  SK A+E L +TW+ E  NT  +
Sbjct: 131 ALTKACLPLLKRGTDTSVIFTSSTAGHQAGAYWGSHGISKQAVEHLVKTWALELENTPNV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           R+  + PGP ++  R K+ P E  +++P  + +  +  +L
Sbjct: 191 RLNAVIPGPVQSPQRKKSHPGEVHDSLPTAESLMPVYLYL 230


>gi|261340034|ref|ZP_05967892.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Enterobacter cancerogenus ATCC 35316]
 gi|288317954|gb|EFC56892.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Enterobacter cancerogenus ATCC 35316]
          Length = 253

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 122/242 (50%), Gaps = 12/242 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  +  GA VI  GR+    EKLK   Q+I +        
Sbjct: 10  LQNRIILVTGASDGIGREAALTYSEYGANVILVGRN---EEKLKAVAQEIERAGGTSTPW 66

Query: 72  FAFDL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           +  DL     +   EL +  I+  + +LD ++ NAG+LG + P+ +     +  V+ VNV
Sbjct: 67  YTLDLLTCTPATCKELAQR-ISAHYPRLDGVLHNAGLLGEVRPMDEQDPDIWQQVMQVNV 125

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
              + + ++  P L  S  G  +  SS    + R  WGAY+ASK A E + +  ++E  N
Sbjct: 126 NGTFFLTQALLPLLLNSDSGSLVFTSSSVGREGRANWGAYAASKFATEGMMQVLAEEYQN 185

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQ 247
             LRV  I+PG TRT MRA A P EDP+ +  P  +  +  +L     + +TG  F    
Sbjct: 186 RHLRVNCINPGGTRTKMRASAFPTEDPHKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQP 245

Query: 248 NR 249
            R
Sbjct: 246 GR 247


>gi|92113979|ref|YP_573907.1| short-chain dehydrogenase/reductase SDR [Chromohalobacter
           salexigens DSM 3043]
 gi|91797069|gb|ABE59208.1| short-chain dehydrogenase/reductase SDR [Chromohalobacter
           salexigens DSM 3043]
          Length = 261

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 122/239 (51%), Gaps = 5/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L+ R+ LVTG+  GIG   A   A  GA +I  GR++++LE + + ++     +  IF  
Sbjct: 14  LEGRVILVTGAGDGIGRAAARCFAAHGATLILVGRTLAKLEAVYDEIEVAGGPQPAIFPL 73

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +   + + E  +    +++ +G+LD L+ NAG+LG ++P      + +  V+ VNV    
Sbjct: 74  NFEGATSKEYHELAGTLSREFGRLDGLLHNAGLLGDMAPFADYDLELWERVMHVNVTGPL 133

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-AL 191
            + ++  P L+ S     I+ SS    K R  WGAY+ SK A E   +  + E   T ++
Sbjct: 134 WMTQALLPLLQASRDASVILTSSSVGRKARAKWGAYAVSKFATEGFMQLLADELAGTSSV 193

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGKLFSVPQNR 249
           RV  ++PG TRT+MR +A P EDP T+  P  +     +L      E TG+ F     R
Sbjct: 194 RVNTLNPGATRTAMRRRAYPEEDPTTLRTPDAIMPTYLWLMGPDSRERTGEAFDAQPPR 252


>gi|297374055|emb|CBJ20868.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
 gi|297374058|emb|CBJ20870.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella grahamii]
          Length = 103

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (71%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  RP WGAY+ASKAA+E +AR W++E   T +++  ++PG TRT+MRA+AMP ED
Sbjct: 1   SSVAHVARPFWGAYAASKAALEMIARCWAEELKQTPIKINCVNPGATRTAMRAEAMPGED 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P  +P PQ+VAK I  L +    ETGKLF+V +NRFV+Y  P+
Sbjct: 61  PQNLPSPQEVAKKIIHLLSPDLKETGKLFNVRKNRFVDYHAPD 103


>gi|261343649|ref|ZP_05971294.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Providencia rustigianii DSM 4541]
 gi|282568032|gb|EFB73567.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Providencia rustigianii DSM 4541]
          Length = 254

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 121/229 (52%), Gaps = 4/229 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI-DIFAF 74
           L+ +  L+TG++ GIG   AL  AR GA VI  GR+  +L+ +K  +  +  K  +    
Sbjct: 11  LNGKTILITGATDGIGQEAALTYARFGASVILLGRNPQKLDAVKKHIFDLTGKTAETHLI 70

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL +  S   +   + IAK+   LD ++ +AG LG I+PI +     + DV+ +NV A +
Sbjct: 71  DLLNATSEDCQTIASNIAKQHSHLDGVLHSAGALGVIAPITEQPPHIWHDVMQINVNAGF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L K+     I  SS    + R  WGAY+ SK A E L +  + E  ++ LR
Sbjct: 131 MLTQALLPLLLKAPQASLIFTSSSVGKQGRANWGAYAVSKFATEGLMQVLADEYKDSTLR 190

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETG 240
           V  I+PG TRT+MRA A P EDP T+  P  +     +L     + +TG
Sbjct: 191 VNCINPGRTRTAMRAGAAPNEDPTTLKTPADIMPTYLYLMGDDSLGQTG 239


>gi|56417032|ref|YP_154106.1| hypothetical protein AM947 [Anaplasma marginale str. St. Maries]
 gi|222475400|ref|YP_002563817.1| hypothetical protein AMF_726 [Anaplasma marginale str. Florida]
 gi|255003386|ref|ZP_05278350.1| hypothetical protein AmarPR_03970 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004507|ref|ZP_05279308.1| hypothetical protein AmarV_04271 [Anaplasma marginale str.
           Virginia]
 gi|56388264|gb|AAV86851.1| hypothetical protein AM947 [Anaplasma marginale str. St. Maries]
 gi|222419538|gb|ACM49561.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 243

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 132/238 (55%), Gaps = 8/238 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++AL+TG+S GIG   A  LA+ GA V+   R++ +L+ L + +Q+   +  +   D
Sbjct: 5   LRGKVALITGASGGIGAAVARRLAKEGARVVLVARNMGKLKTLCDEIQESGGEAILAPID 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           ++D  ++      +  ++G LDILI+ A  LG + P+ + +   + +V++VN+ ANW ++
Sbjct: 65  IQDYESVHSLALSVKSKFGCLDILISVAASLGGLGPVQEYEPAVWKEVMNVNLFANWYLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPL-----WGAYSASKAAIEALARTWSKETVNTA 190
           + FD  LK +  GRA+ ++S AA   R L     +  Y+ASK A+EA+ + ++ ET ++ 
Sbjct: 125 KHFDALLKSAPAGRAVFVTSEAA---RSLLNYSYFAPYAASKVALEAMVQVYAVETKHSK 181

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQN 248
           L V  + P    +++ ++   A+  + +  P  V      L + +   TG+++ + QN
Sbjct: 182 LCVNIVYPCSIDSNIYSQIFSAQKQSKLLAPDSVTDKFVELASEECCVTGQIYELTQN 239


>gi|21225427|ref|NP_631206.1| ketoreductase [Streptomyces coelicolor A3(2)]
 gi|256783551|ref|ZP_05521982.1| ketoreductase [Streptomyces lividans TK24]
 gi|289767432|ref|ZP_06526810.1| ketoreductase [Streptomyces lividans TK24]
 gi|9716967|emb|CAC01636.1| putative ketoreductase [Streptomyces coelicolor A3(2)]
 gi|289697631|gb|EFD65060.1| ketoreductase [Streptomyces lividans TK24]
          Length = 255

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 114/202 (56%), Gaps = 12/202 (5%)

Query: 6   SKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI 65
           S N S  H      + +VTG+  GIG  TA+  A SGA+V+A GR  + L++   A    
Sbjct: 2   SPNQS--HETFSGHVVIVTGAGTGIGRATAVAFAESGAHVLAVGRREALLKETAAA---- 55

Query: 66  NKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVIS 125
           +  ID+ A D+    A         +RWG+LD LI NAG   ++ P+ + ++++  D+++
Sbjct: 56  HSHIDVLAIDICGDEAPGKVVDAAVERWGRLDHLINNAGAT-AVMPLAEAEKQTIVDLLA 114

Query: 126 VNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA--YSASKAAIEALARTWS 183
           +NV+A   + R   P L+++  G  I LSS   Y  RP+ G   YSA+KAA+E + R+W+
Sbjct: 115 LNVVAPSLLAREALPHLRRT-SGSIINLSS--TYGHRPMAGGAHYSATKAAVEQMTRSWA 171

Query: 184 KETVNTALRVINIDPGPTRTSM 205
            E  +  +RV ++ PGPTRT +
Sbjct: 172 LELADEGVRVNSVAPGPTRTDV 193


>gi|295698502|ref|YP_003603157.1| short chain dehydrogenase [Candidatus Riesia pediculicola USDA]
 gi|291157324|gb|ADD79769.1| short chain dehydrogenase [Candidatus Riesia pediculicola USDA]
          Length = 245

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 122/229 (53%), Gaps = 6/229 (2%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK---IDIFAFDLRD 78
           L+TG+S GIG   +    ++GA +   G+   ++  +  +L +IN+    + I+ FDL +
Sbjct: 8   LITGASDGIGKEVSKTYFQNGANLALIGKDQKKMHTISKSLNRINRSSQIVKIYIFDLSE 67

Query: 79  SNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
               E  +    I K +  LD L+ NAG+LG ISP+     KS+ +V+ +N+ +++ I +
Sbjct: 68  KKESEYRRITQEIKKEFPILDGLLHNAGVLGRISPVINQSIKSWYEVLQINLNSSFIITK 127

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
              P L  S     +  +S  + K +  W  YS SK AIE L +T S+E   + LRV  I
Sbjct: 128 FLLPCLMNSKNSSLLFTTSNVSRKGKKNWSPYSVSKFAIEGLMKTLSQEYEGSTLRVNCI 187

Query: 197 DPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGKLFS 244
           +PG  RT MR +A P+E+   +  P+++     +L + + I  +G +F+
Sbjct: 188 NPGAVRTKMRFQAYPSENQKNIRSPKEIMSTYLYLMSDESIGFSGHIFN 236


>gi|119775256|ref|YP_927996.1| short chain dehydrogenase [Shewanella amazonensis SB2B]
 gi|119767756|gb|ABM00327.1| short chain dehydrogenase [Shewanella amazonensis SB2B]
          Length = 245

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 121/234 (51%), Gaps = 6/234 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  +  LVTG+  GIG   AL  A  GA VI  GR++ +LE + + ++   +    I   
Sbjct: 11  LKGKTILVTGAGDGIGRAAALAYAAHGATVILLGRTVKKLEAVYDEIEAAGQPTPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           D++   + N  ++  T I +++G LD ++ NA +LG + P   I   S  +V+ VNV A 
Sbjct: 71  DMKGATEQNYRDMADT-IEEQFGHLDGVLHNASVLGVLGPFEHIDLASLEEVMKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + +S    L+K+     I  SSG     R  WG Y+ SK A E + +  + E   T +
Sbjct: 130 AIMTKSLLKVLRKAPAASVIFTSSGVGRTGRAYWGPYAFSKFATEGMMQVLAHECDGTNV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFS 244
           R  +I+PG TRT MRA A P EDP T+   +++  +  +L A   K + G+ FS
Sbjct: 190 RANSINPGATRTKMRANAYPGEDPQTLKTAEELMPLYVYLMADDSKDQNGQAFS 243


>gi|260854968|ref|YP_003228859.1| putative oxoacyl-(acyl carrier protein) reductase [Escherichia coli
           O26:H11 str. 11368]
 gi|257753617|dbj|BAI25119.1| predicted oxoacyl-(acyl carrier protein) reductase [Escherichia
           coli O26:H11 str. 11368]
          Length = 252

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 125/238 (52%), Gaps = 5/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LV G+S GIG   A+  AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVMGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL    + +  +    I   + +LD ++ NAG+LG + P+ +   + + DV+ VNV A +
Sbjct: 70  DLLTCTSEDCQQLAQRITVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS  G  +  SS    + R  WGAY+ASK A E + +  + E     LR
Sbjct: 130 LLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADE-YQQRLR 188

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 189 VNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 246


>gi|330877046|gb|EGH11195.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
          Length = 246

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 121/222 (54%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L  R+ LVTG++RGIG   A   +  GA V+  GR+ + L ++ + ++   + +  I A 
Sbjct: 11  LKGRVILVTGAARGIGAAAARAYSAHGASVVLLGRTEASLAEVSDQIKSAGQPQPLIIAL 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  + A +  +  T +   +G+LD L+ NA ++G  +P+ Q+ ++ F  V+ VNV A +
Sbjct: 71  DLESATAQQYRELATRVEHEFGRLDGLLHNASVIGPRTPLEQLPDEDFMQVMHVNVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + R+  P LK+S        SS    K R  WGAY  SK A E L +T + E    TA+
Sbjct: 131 MLTRALLPLLKRSEDASIAFTSSSVGRKGRANWGAYGVSKFATEGLMQTLADELEGVTAV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA+A P E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTGMRAQAYPDENPLNNPAPEDIMPVYLYLMG 232


>gi|68171312|ref|ZP_00544711.1| Short-chain dehydrogenase/reductase SDR [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88657734|ref|YP_507186.1| short chain dehydrogenase/reductase family oxidoreductase
           [Ehrlichia chaffeensis str. Arkansas]
 gi|67999263|gb|EAM85914.1| Short-chain dehydrogenase/reductase SDR [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599191|gb|ABD44660.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Ehrlichia chaffeensis str. Arkansas]
          Length = 242

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 126/232 (54%), Gaps = 2/232 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++A++TG+S  IG   A   A+ GA +I   ++I++L  + ++++++     + A D
Sbjct: 5   LAGKVAIITGASGSIGSAVAKRFAKEGACLILVAKNINKLNAVYDSIKELGGDAMLAAVD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L+D + ++     I  ++  +DILI NA ++G +SP    +  ++  ++ +N +ANW+++
Sbjct: 65  LQDFDTIKNFAMSIGNKFKNIDILILNAAVVGDLSPTQDYEYDTWKRIMDINFIANWHLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCR--PLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + FDP LK S  GR I ++S         P W  Y++SKAA+E + R ++ ET ++ L V
Sbjct: 125 KYFDPLLKLSPAGRVIAVTSEVTQSPSRYPYWSTYASSKAALETMLRIYATETKHSKLCV 184

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSV 245
             + P      + A+A+P ++      P+        L + Q   TG+++ +
Sbjct: 185 NMVYPSLMDNDIYAQALPIKETAQSVLPENFTDKFIELSSNQCNVTGQIYKI 236


>gi|146282669|ref|YP_001172822.1| short chain dehydrogenase [Pseudomonas stutzeri A1501]
 gi|145570874|gb|ABP79980.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Pseudomonas stutzeri A1501]
          Length = 246

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 117/222 (52%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L  R+ LVTG+ RGIG   A   A  GA V+  G++   L ++ + ++   + +  +  F
Sbjct: 11  LAGRIILVTGAGRGIGEAAAKAYAAHGATVLLLGKNEDNLNRVYDEIEAAGHPRPAVIPF 70

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  +     I + +G LD L+ NA I+G  +PI Q+   +F  V+ +NV A +
Sbjct: 71  NLETALPHQYDELAAMIEREFGHLDGLLHNAAIVGPRTPIEQLSGDNFMRVMQINVNAMF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            +  +  P LK S     I  SS    K R  WGAY+ SK A E L +  + E  +TA +
Sbjct: 131 MLTSTLLPLLKLSKDASVIFTSSSVGRKGRAYWGAYAVSKFATEGLMQVLADELDDTAPV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRAKA P E+P   P P+++  +  +L  
Sbjct: 191 RANSINPGATRTDMRAKAYPGENPLVNPLPEEIMPVYLYLMG 232


>gi|126640147|ref|YP_001083131.1| short chain dehydrogenase [Acinetobacter baumannii ATCC 17978]
          Length = 205

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 109/195 (55%), Gaps = 9/195 (4%)

Query: 49  GRSISQLEKLKNALQKIN-KKIDIFAFDL-----RDSNALELTKTYIAKRWGKLDILIAN 102
           GR++++LE + + ++ +   +  I    L     RD + L  T   + K++G+LD ++ N
Sbjct: 3   GRTLNKLEVIYDEIEGLGAPQPAILPLQLSSASDRDYDFLVST---LEKQFGRLDGILHN 59

Query: 103 AGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCR 162
           AGILG    +     + + DV++VN+ A + + ++  P L+KS     +  SSG   + R
Sbjct: 60  AGILGERVELAHYPAEVWDDVMAVNLRAPFALTQALLPLLQKSENASVVFTSSGVGREAR 119

Query: 163 PLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQ 222
            LWGAYS SK AIEA+++ ++ E     +R   I+PG TRT+MRAKA P EDP T+P P+
Sbjct: 120 ALWGAYSVSKVAIEAVSKIFAAEHTYPNIRFNCINPGATRTAMRAKAYPEEDPKTLPTPE 179

Query: 223 KVAKIISFLCATQKI 237
            +     +L     +
Sbjct: 180 SIMPAYLYLMGEDSL 194


>gi|213424554|pdb|3F1K|A Chain A, Crystal Structure Of Ycik From E. Coli, An Oxidoreductase,
           Complexed With Nadp+ At 2.6a Resolution
          Length = 252

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 124/239 (51%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A   AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 10  LNDRIILVTGASDGIGREAAXTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 69

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  IA  + +LD ++ NAG+LG + P  +   + + DV  VNV A 
Sbjct: 70  DLLTCTSENCQQLAQR-IAVNYPRLDGVLHNAGLLGDVCPXSEQNPQVWQDVXQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E   +  + E     L
Sbjct: 129 FXLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGXXQVLADE-YQQRL 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+MRA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 188 RVNCINPGGTRTAMRASAFPTEDPQKLKTPADIXPLYLWLXGDDSRRKTGMTFDAQPGR 246


>gi|229505346|ref|ZP_04394856.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae BX 330286]
 gi|229357569|gb|EEO22486.1| oxidoreductase short-chain dehydrogenase/reductase family [Vibrio
           cholerae BX 330286]
          Length = 209

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 109/198 (55%), Gaps = 5/198 (2%)

Query: 45  VIACGRSISQLEKLKNALQKINKKID-IFAFDLRDS---NALELTKTYIAKRWGKLDILI 100
           +I  GR++ +LE+  +A++        I   D++ +   N L++  T I  ++G+LD ++
Sbjct: 1   MILLGRTVKKLEQTYDAIEAAGYPTPAIVPLDMKGATKQNYLDMVDT-IEDQFGRLDGVL 59

Query: 101 ANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYK 160
            NA +LG +SP  QI E SF +V+ VNV A + + ++  P L KS   R +  +S   + 
Sbjct: 60  HNASLLGVLSPFDQIGEDSFDEVMQVNVKAQFLMTQALLPLLHKSADARIVFTTSTVGHI 119

Query: 161 CRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPH 220
            R  W  Y+ SK A E + +  + E   + +RV  I+PG TRT+MRAKA PAED + +  
Sbjct: 120 GRAFWATYAISKFATEGMMQILADELSESTIRVNAINPGGTRTAMRAKAYPAEDADKLKT 179

Query: 221 PQKVAKIISFLCATQKIE 238
           P  +  +  +L A +  E
Sbjct: 180 PLDIMPLYLYLMAPEGRE 197


>gi|120598429|ref|YP_963003.1| short chain dehydrogenase [Shewanella sp. W3-18-1]
 gi|120558522|gb|ABM24449.1| short-chain dehydrogenase/reductase SDR [Shewanella sp. W3-18-1]
 gi|319426796|gb|ADV54870.1| short-chain dehydrogenase/reductase SDR [Shewanella putrefaciens
           200]
          Length = 245

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  +  LVTG+  GIG   A+  A+ GA VI  G+++ +LE + + +++    K  I   
Sbjct: 11  LQGKTILVTGAGAGIGKAAAIAFAKHGATVILLGKTVKKLEAVYDLIEQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++  T IA+++G LD L+ NA +LG++ P   I   S  DV+ VNV A 
Sbjct: 71  DLKGATEQNYQDMADT-IAEQFGHLDGLLHNASLLGALGPFEHIDISSLEDVLKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPVMRQAPSASIIFTSSSVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           RV +I+PG TRT MRAKA PAE+P
Sbjct: 190 RVNSINPGATRTEMRAKAYPAENP 213


>gi|254995213|ref|ZP_05277403.1| hypothetical protein AmarM_04480 [Anaplasma marginale str.
           Mississippi]
          Length = 243

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 131/238 (55%), Gaps = 8/238 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++AL+TG+S GIG   A  LA+ GA V+   R++ +L+ L + +Q+   +  +   D
Sbjct: 5   LRGKVALITGASGGIGAAVARRLAKEGARVVLVARNMGKLKTLCDEIQESGGEAILAPID 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           ++D  ++      +   +G LDILI+ A  LG + P+ + +   + +V++VN+ ANW ++
Sbjct: 65  IQDYESVRSLALSVKSEFGCLDILISVAASLGGLGPVQEYEPAVWKEVMNVNLFANWYLI 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPL-----WGAYSASKAAIEALARTWSKETVNTA 190
           + FD  LK +  GRA+ ++S AA   R L     +  Y+ASK A+EA+ + ++ ET ++ 
Sbjct: 125 KHFDALLKSAPAGRAVFVTSEAA---RSLLNYSYFAPYAASKVALEAMVQVYAVETKHSK 181

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQN 248
           L V  + P    +++ ++   A+  + +  P  V      L + +   TG+++ + QN
Sbjct: 182 LCVNIVYPCSIDSNIYSQIFSAQKQSKLLAPDSVTDKFVELASEECCVTGQIYELTQN 239


>gi|146293492|ref|YP_001183916.1| short chain dehydrogenase [Shewanella putrefaciens CN-32]
 gi|145565182|gb|ABP76117.1| short-chain dehydrogenase/reductase SDR [Shewanella putrefaciens
           CN-32]
          Length = 245

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  +  LVTG+  GIG   A+  A+ GA VI  G+++ +LE + + +++    K  I   
Sbjct: 11  LQGKTILVTGAGAGIGKAAAIAFAKHGATVILLGKTVKKLEAVYDLIEQAGYPKPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++  T IA+++G LD L+ NA +LG++ P   I   S  DV+ VNV A 
Sbjct: 71  DLKGATEQNYQDMADT-IAEQFGHLDGLLHNASLLGALGPFEHIDISSLEDVLKVNVTAQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPVMRQAPSASIIFTSSNVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           RV +I+PG TRT MRAKA PAE+P
Sbjct: 190 RVNSINPGATRTEMRAKAYPAENP 213


>gi|117919976|ref|YP_869168.1| short chain dehydrogenase [Shewanella sp. ANA-3]
 gi|117612308|gb|ABK47762.1| short-chain dehydrogenase/reductase SDR [Shewanella sp. ANA-3]
          Length = 245

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  +  LVTG+  GIG   A+E A+ GA VI  G+++ +LE + + +++       I   
Sbjct: 11  LQGKTILVTGAGAGIGRAAAIEFAKHGATVILLGKTVKKLEAVYDVIEQAGYPTPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++ +T I +++G LD L+ NA +LG++ P   I   S  DV+ VNV + 
Sbjct: 71  DLKGATEQNYRDMAET-IGEQFGHLDGLLHNASLLGALGPFEHIDIPSLEDVLKVNVTSQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPIMRQAPSASIIFTSSSVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           RV +I+PG TRT MRAKA PAE+P
Sbjct: 190 RVNSINPGATRTEMRAKAYPAENP 213


>gi|327480925|gb|AEA84235.1| short chain dehydrogenase [Pseudomonas stutzeri DSM 4166]
          Length = 246

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 117/222 (52%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L  R+ LVTG+ RGIG   A   A  GA V+  G++   L ++ + ++   + +  +  F
Sbjct: 11  LAGRIILVTGAGRGIGEAAAKAYAAHGATVLLLGKNEDNLNRVYDEIEAAGHPRPAVIPF 70

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  +     I + +G LD L+ NA I+G  +PI Q+   +F  V+ +NV A +
Sbjct: 71  NLETALPHQYDELAAMIEREFGHLDGLLHNAAIVGPRTPIEQLSGDNFMRVMQINVNAMF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            +  +  P LK S     I  SS    K R  WGAY+ SK A E L +  + E  +T+ +
Sbjct: 131 MLTSTLLPLLKLSKDASVIFTSSSVGRKGRAYWGAYAVSKFATEGLMQVLADELDDTSPV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRAKA P E+P   P P+++  +  +L  
Sbjct: 191 RANSINPGATRTDMRAKAYPGENPLVNPLPEEIMPVYLYLMG 232


>gi|238785810|ref|ZP_04629781.1| Uncharacterized oxidoreductase yciK [Yersinia bercovieri ATCC
           43970]
 gi|238713302|gb|EEQ05343.1| Uncharacterized oxidoreductase yciK [Yersinia bercovieri ATCC
           43970]
          Length = 252

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 122/240 (50%), Gaps = 9/240 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLK-----NALQKINKKID 70
           LDN   LVTG+  GIG   AL  AR GA VI  GR+ S+L  ++     N L  +   +D
Sbjct: 10  LDNHSILVTGAGDGIGREAALTYARFGARVILVGRTESKLIAVQQQIAANGLAALVITLD 69

Query: 71  IFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
           +     +D   L  T   ++++   LD ++ NAG+LG I+P+ +     + DV+ VNV A
Sbjct: 70  LLHATAQDCQQLANT---LSQQIPHLDGVLHNAGLLGDIAPMSEQNIAVWQDVMQVNVNA 126

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            + + ++  P L K+     +  SS    + R  WGAY+ SK A E + +  ++E   + 
Sbjct: 127 TFMLTQALLPLLLKAPSASLVFTSSSVGRQGRAGWGAYAVSKFATEGMMQVLAQEYKQSH 186

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           LRV  I+PG T+T MRA A P ED N +  P  +  +  +L     + +TG  F     R
Sbjct: 187 LRVNCINPGGTKTQMRATAFPDEDTNKLKTPADIMPLYLYLMGDDSRRKTGISFDAQPGR 246


>gi|331005953|ref|ZP_08329299.1| short-chain alcohol dehydrogenase-like protein [gamma
           proteobacterium IMCC1989]
 gi|330420248|gb|EGG94568.1| short-chain alcohol dehydrogenase-like protein [gamma
           proteobacterium IMCC1989]
          Length = 251

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 111/213 (52%), Gaps = 12/213 (5%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKL--------KNALQKIN 66
            L+ ++  +TG+  GIG   A   A  GA VI  GR++ +LE +         NA Q   
Sbjct: 13  ELNGKIVAITGAGAGIGRTLAKCFAAHGATVILMGRTVEKLEAIYDEIENDHPNAPQPAI 72

Query: 67  KKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISV 126
             ID   F+       +L    I   +GKL+ LI  A  LG  + I       +  +++V
Sbjct: 73  VPID---FEAAKDADYQLIHDSIETEYGKLNGLIHCAAELGERTSIGSYSLNVWEKLMAV 129

Query: 127 NVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKET 186
           NV A + + +   P L+ S     I  SS    K R  WGAY+ASKAA+E L +T + E 
Sbjct: 130 NVTAPFALTKHLLPLLRLSDSASIIFTSSSVGLKGRAYWGAYAASKAALENLMQTLADEL 189

Query: 187 VNTA-LRVINIDPGPTRTSMRAKAMPAEDPNTV 218
            +T+ +RV +++PG TRT+MRA+A PAEDP TV
Sbjct: 190 EDTSKIRVNSVNPGATRTAMRAQAFPAEDPATV 222


>gi|114047039|ref|YP_737589.1| short chain dehydrogenase [Shewanella sp. MR-7]
 gi|113888481|gb|ABI42532.1| short-chain dehydrogenase/reductase SDR [Shewanella sp. MR-7]
          Length = 245

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  +  LVTG+  GIG   A+E A+ GA VI  G+++ +LE + + +++       I   
Sbjct: 11  LKGKTILVTGAGAGIGRAAAIEFAKHGATVILLGKTVKKLEAVYDVIEQAGYPTPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++ +T I +++G LD L+ NA +LG++ P   I   S  DV+ VNV + 
Sbjct: 71  DLKGATEQNYRDMAET-IGEQFGHLDGLLHNASLLGALGPFEHIDIPSLEDVLKVNVTSQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPIMRQAPSASIIFTSSSVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           RV +I+PG TRT MRAKA PAE+P
Sbjct: 190 RVNSINPGATRTEMRAKAYPAENP 213


>gi|113969810|ref|YP_733603.1| short chain dehydrogenase [Shewanella sp. MR-4]
 gi|113884494|gb|ABI38546.1| short-chain dehydrogenase/reductase SDR [Shewanella sp. MR-4]
          Length = 245

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  +  LVTG+  GIG   A+E A+ GA VI  G+++ +LE + + +++       I   
Sbjct: 11  LKGKTILVTGAGAGIGRAAAIEFAKHGATVILLGKTVKKLEAVYDVIEQAGYPTPAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL+   + N  ++ +T I +++G LD L+ NA +LG++ P   I   S  DV+ VNV + 
Sbjct: 71  DLKGATEQNYRDMAET-IGEQFGHLDGLLHNASLLGALGPFEHIDIPSLEDVLKVNVTSQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + ++  P ++++     I  SS    + R  WG Y+ SK A E + +  + E   T++
Sbjct: 130 VMLTKALLPIMRQAPSASIIFTSSSVGRQGRAYWGPYAFSKFATEGMMQVLAHECDGTSV 189

Query: 192 RVINIDPGPTRTSMRAKAMPAEDP 215
           RV +I+PG TRT MRAKA PAE+P
Sbjct: 190 RVNSINPGATRTEMRAKAYPAENP 213


>gi|217966836|ref|YP_002352342.1| short-chain dehydrogenase/reductase SDR [Dictyoglomus turgidum DSM
           6724]
 gi|217335935|gb|ACK41728.1| short-chain dehydrogenase/reductase SDR [Dictyoglomus turgidum DSM
           6724]
          Length = 241

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 114/218 (52%), Gaps = 1/218 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L+N++AL+TG+SRGIG   A  LA+    +    R   +L +LK  L+K N  + I + 
Sbjct: 3   SLENKIALITGASRGIGEEIAKRLAKEKVNLALIARDEKRLRELKEKLEKENINVFILSI 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DLR+ NA +     + + + +LDILI NAG   S  PI +  E+ + +++++N    + +
Sbjct: 63  DLREKNAPKTVIGEVIRHFERLDILINNAGTALS-KPIIETSEEEWDEIMTINAKVPYFL 121

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            +   P+LK S     I +SS   YK      AY+ASK A+    +  ++E     +RV 
Sbjct: 122 CKYAIPYLKNSEIPTIINISSVVGYKGYVNQSAYTASKHALHGFTKVLAQEVHEYGIRVH 181

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
            I PG   T +  K  P  +   +  P ++A+II FL 
Sbjct: 182 LISPGGVATDLVNKVRPDLEKALLIQPSEIAEIIVFLL 219


>gi|296102096|ref|YP_003612242.1| short chain dehydrogenase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295056555|gb|ADF61293.1| short chain dehydrogenase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 253

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 82/242 (33%), Positives = 120/242 (49%), Gaps = 12/242 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI---- 71
           L NR+ LVTG+S GIG   AL  A  GA VI  GR+    EKLK   Q+I+    I    
Sbjct: 10  LQNRIILVTGASDGIGREAALTYADYGASVILIGRN---EEKLKGVAQEIDAAGGIPARW 66

Query: 72  FAFDL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           +  DL         EL    I+  + +LD ++ NAG+LG + P+ +   + +  V+ VN+
Sbjct: 67  YTLDLLTCTPETCQELAHR-ISTHYPRLDGVLHNAGLLGEVRPMDEQDPEIWQQVMQVNI 125

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
              + + ++  P L  S  G  +  SS    + R  WGAY+ SK A E + +  ++E  +
Sbjct: 126 NGTFFLTQALLPLLLTSDSGSLVFTSSSVGREGRANWGAYAVSKFATEGMMQVLAEEYQS 185

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQ 247
             LRV  I+PG TRT MRA A P EDP  +  P  +  +  +L     + +TG  F    
Sbjct: 186 RHLRVNCINPGGTRTKMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQP 245

Query: 248 NR 249
            R
Sbjct: 246 GR 247


>gi|238763118|ref|ZP_04624084.1| Uncharacterized oxidoreductase yciK [Yersinia kristensenii ATCC
           33638]
 gi|238698617|gb|EEP91368.1| Uncharacterized oxidoreductase yciK [Yersinia kristensenii ATCC
           33638]
          Length = 253

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 117/225 (52%), Gaps = 9/225 (4%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI--- 69
           H  LDNR  LVTG+  GIG   AL  AR GA +I  GR+  +L  ++  +     ++   
Sbjct: 7   HDLLDNRTILVTGAGDGIGREAALTYARFGARLILVGRTRHKLVAVQQQISAAGGQLATV 66

Query: 70  ---DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISV 126
              D+    + D   L  T   ++++   LD ++ NAG+LG I+P+ +     + +V+ V
Sbjct: 67  CELDLLHASVTDCQQLAET---LSQQVPSLDGVLHNAGLLGEIAPMVEQDITVWQEVMQV 123

Query: 127 NVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKET 186
           NV A + + ++  P L KS     +  SS    + R  WGAY+ SK A E + +  S+E 
Sbjct: 124 NVNATFMLTQALLPLLLKSPSASLVFTSSSVGRQGRAGWGAYAVSKFATEGMMQVLSEEY 183

Query: 187 VNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
            +  LRV  I+PG TRT MRA A P ED + +  P ++  +  +L
Sbjct: 184 KHANLRVNCINPGGTRTQMRANAFPDEDASKLKTPAEIMPLYLYL 228


>gi|152996874|ref|YP_001341709.1| short-chain dehydrogenase/reductase SDR [Marinomonas sp. MWYL1]
 gi|150837798|gb|ABR71774.1| short-chain dehydrogenase/reductase SDR [Marinomonas sp. MWYL1]
          Length = 247

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 119/224 (53%), Gaps = 7/224 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +++ LVTG+  GIG   A+  A+ GA VI  GR+  +LE + + ++K    +  I   
Sbjct: 11  LKDKVILVTGAGDGIGKEAAITYAKHGATVILLGRTTKKLEAVYDYIEKHQYPQAAIVPL 70

Query: 75  DLR---DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           +L    + + +EL  T I   +G LD ++ NA +LG  + +       F  V+ VNV + 
Sbjct: 71  NLDGAAEHDYIELANT-IENEFGHLDGILHNASLLGERTSLATYDPTLFEQVMRVNVTSQ 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA- 190
             + ++  P ++K+     I  SSG   K +  WGAY+ SK A EA+ +  S E  + + 
Sbjct: 130 LMLNQALLPIMQKAEHASIIFTSSGVGRKAKANWGAYAVSKFATEAMMQLLSSELESLSP 189

Query: 191 -LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            +R   I+PG TRT+MRA A P EDP T+P  +++  I  +L  
Sbjct: 190 NIRANAINPGATRTNMRANAYPDEDPKTLPTAEEIMPIYLYLMG 233


>gi|238790409|ref|ZP_04634180.1| Uncharacterized oxidoreductase yciK [Yersinia frederiksenii ATCC
           33641]
 gi|238721516|gb|EEQ13185.1| Uncharacterized oxidoreductase yciK [Yersinia frederiksenii ATCC
           33641]
          Length = 253

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 121/241 (50%), Gaps = 10/241 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK------I 69
           LDNR  LVTG+  GIG   AL  AR GA ++  GR+ S+L  ++  + +          +
Sbjct: 10  LDNRTILVTGAGDGIGREAALTYARFGARLVLVGRTESKLVAVQQQIAEAGGHPALVMVL 69

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+    L+D   L  T   ++ +   LD ++ NAG+LG + P+       + DV+ VNV 
Sbjct: 70  DLLHATLQDCQQLAQT---LSSQISHLDGVLHNAGLLGDVVPMCDQNIAVWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS     +  SS    + R  WGAY+ SK A E + +  ++E  ++
Sbjct: 127 ATFMLTQALLPLLLKSPSASLVFTSSSVGRQGRAEWGAYAVSKFATEGMMQVLAEEYKHS 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P E+ + +  P  +  +  +L     + +TG  F     
Sbjct: 187 NLRVNCINPGGTRTQMRASAFPDENSDKLKTPADIMPLYLYLMGDDSRRKTGISFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|254281900|ref|ZP_04956868.1| short chain dehydrogenase [gamma proteobacterium NOR51-B]
 gi|219678103|gb|EED34452.1| short chain dehydrogenase [gamma proteobacterium NOR51-B]
          Length = 250

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 114/215 (53%), Gaps = 4/215 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L  +  LVTG+  GIG   AL  AR GA V+  GR+  +LE + +A+  +  ++  I   
Sbjct: 15  LSGKTLLVTGAGDGIGRAAALAYARHGAEVLLLGRTEKKLEAVYDAIISEGLREPGIIPL 74

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +N  +  +    ++  + KLD L+ NAG+LG    + Q   + +  V+  NV A  
Sbjct: 75  DLATANEDQYRELAQQLSGTFDKLDGLLHNAGLLGDRRSMAQTSLQLWHQVMQANVNATQ 134

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + +   P L+++     ++ SSG   K R  WGAY+ SK A+E + + W+ E  +T+ +
Sbjct: 135 MLTQVLFPLLEQAPSASVVMTSSGVGRKGRAFWGAYAVSKFAVEGMMQVWADEMGDTSRI 194

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAK 226
           R  +++PG   T+MR  A PAE P   P P+ + +
Sbjct: 195 RFNSLNPGAVNTAMRRTAYPAEPPTNNPDPETLMR 229


>gi|238798378|ref|ZP_04641860.1| Uncharacterized oxidoreductase yciK [Yersinia mollaretii ATCC
           43969]
 gi|238717763|gb|EEQ09597.1| Uncharacterized oxidoreductase yciK [Yersinia mollaretii ATCC
           43969]
          Length = 253

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 121/241 (50%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDI 71
           H  LDN   LVTG+  GIG   AL  AR GA +I  GR+ S+L  ++  +   N     +
Sbjct: 7   HDLLDNHCILVTGAGDGIGREAALTYARFGARLILVGRTESKLIAVQQEIAAANGLPATV 66

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
              DL  + A +  +    + ++   LD ++ NAG+LG I+P+ +     + +V+ VNV 
Sbjct: 67  MTLDLLQATAQDCQQLADTLGQQIPHLDGVLHNAGLLGDIAPMAEQNIAVWQEVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS     +  SS    + R  WGAY+ SK A E + +  ++E  +T
Sbjct: 127 ATFMLTQALLPLLLKSPSASLVFTSSSVGRQGRAGWGAYAVSKFATEGMMQVLAEEYKHT 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG T+T MRA A P ED   +  P  +  +  +L     + +TG  F     
Sbjct: 187 HLRVNCINPGGTKTQMRATAFPDEDARKLKTPTDIMPLYLYLMGDDSRRKTGISFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|300716946|ref|YP_003741749.1| Short-chain dehydrogenase/reductase SDR [Erwinia billingiae Eb661]
 gi|299062782|emb|CAX59902.1| Short-chain dehydrogenase/reductase SDR [Erwinia billingiae Eb661]
          Length = 253

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI-DIFAF 74
           L  R+ LVTG+S GIG   A+  AR GA V+  GR+  +L+ + + +    K     F  
Sbjct: 10  LTGRIILVTGASDGIGREAAVTYARYGAEVVLLGRNAEKLQAVADDIAATGKPAPQWFIL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  ++     +    +A+   +LD ++ NAG+LG I  + +   + +  V+ VN+ A +
Sbjct: 70  DLEQASPARCQQLAAEVAQHVPRLDGVLHNAGLLGDIVSMEKQDPQVWQQVMRVNIDATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L KS C   +  +S    + R  WGAYS SK A E + +  + E  +  LR
Sbjct: 130 FLTQALLPLLLKSSCASLVFTTSSVGRQGRAGWGAYSVSKFATEGMMQVLADEYDSKHLR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           V  I+PG TRT MRA A P ED N +  P  +  +  FL
Sbjct: 190 VNCINPGGTRTKMRASAFPEEDANKLKTPADIMPLYLFL 228


>gi|297373959|emb|CBJ20820.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Bartonella vinsonii subsp. berkhoffii]
          Length = 103

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (70%)

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAED 214
           S  A+  R  WG Y+ASKAA+E +AR W++E   T +++  +DPG TRT+MRA+AMP ED
Sbjct: 1   SSVAHIARAFWGPYAASKAALEIIARCWAEELKQTPIKINCVDPGATRTAMRAQAMPGED 60

Query: 215 PNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN 257
           P T+P PQ+VA  I+ L +    ETGKLF+V +NRF++Y  P+
Sbjct: 61  PQTLPSPQEVAAKIAHLSSPDLKETGKLFNVRKNRFMDYHAPD 103


>gi|170024272|ref|YP_001720777.1| short chain dehydrogenase [Yersinia pseudotuberculosis YPIII]
 gi|169750806|gb|ACA68324.1| short-chain dehydrogenase/reductase SDR [Yersinia
           pseudotuberculosis YPIII]
          Length = 253

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 124/241 (51%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDI 71
           H  L+ R+ LVTG+  GIG   AL  AR GA +I  GR+ S+L  +K  +         +
Sbjct: 7   HDLLNQRIILVTGAGDGIGREAALTYARFGARLILVGRTESKLLAVKKQIADAGGLPALV 66

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            + DL  + A +  +    ++ +  +LD ++ NAG+LG ++P+ +     + DV+ VNV 
Sbjct: 67  LSLDLLHATAADCQQLADTVSAQVPRLDGVLHNAGLLGEVAPMSEQSIAVWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS     +  SS    + R  WGAYS SK A E + +  ++E   +
Sbjct: 127 ATFMLTQALLPLLLKSPSASLVFTSSSVGRQGRAGWGAYSVSKFATEGMMQVLAEEYKQS 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P ED + +  P  +  +  +L     + +TG  F+    
Sbjct: 187 NLRVNCINPGGTRTQMRATAFPDEDASKLKTPADIMPLYLYLMGDDSRRKTGISFNAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|51596463|ref|YP_070654.1| short chain dehydrogenase [Yersinia pseudotuberculosis IP 32953]
 gi|108807568|ref|YP_651484.1| short chain dehydrogenase [Yersinia pestis Antiqua]
 gi|108811844|ref|YP_647611.1| short chain dehydrogenase [Yersinia pestis Nepal516]
 gi|145598217|ref|YP_001162293.1| short chain dehydrogenase [Yersinia pestis Pestoides F]
 gi|149365866|ref|ZP_01887901.1| putative short chain dehydrogenase [Yersinia pestis CA88-4125]
 gi|153946851|ref|YP_001400901.1| short chain dehydrogenase [Yersinia pseudotuberculosis IP 31758]
 gi|162420707|ref|YP_001606742.1| short chain dehydrogenase [Yersinia pestis Angola]
 gi|165927433|ref|ZP_02223265.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938158|ref|ZP_02226717.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010783|ref|ZP_02231681.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166210708|ref|ZP_02236743.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167400928|ref|ZP_02306434.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167420054|ref|ZP_02311807.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167424854|ref|ZP_02316607.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167470519|ref|ZP_02335223.1| short chain dehydrogenase [Yersinia pestis FV-1]
 gi|186895512|ref|YP_001872624.1| short chain dehydrogenase [Yersinia pseudotuberculosis PB1/+]
 gi|218929311|ref|YP_002347186.1| short chain dehydrogenase [Yersinia pestis CO92]
 gi|229894899|ref|ZP_04510077.1| predicted oxoacyl-(acyl carrier protein) reductase [Yersinia pestis
           Pestoides A]
 gi|229897642|ref|ZP_04512798.1| predicted oxoacyl-(acyl carrier protein) reductase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229898287|ref|ZP_04513434.1| predicted oxoacyl-(acyl carrier protein) reductase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229902146|ref|ZP_04517267.1| predicted oxoacyl-(acyl carrier protein) reductase [Yersinia pestis
           Nepal516]
 gi|270490620|ref|ZP_06207694.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis KIM D27]
 gi|294503747|ref|YP_003567809.1| short chain dehydrogenase [Yersinia pestis Z176003]
 gi|51589745|emb|CAH21375.1| putative short chain dehydrogenase [Yersinia pseudotuberculosis IP
           32953]
 gi|108775492|gb|ABG18011.1| short-chain dehydrogenase [Yersinia pestis Nepal516]
 gi|108779481|gb|ABG13539.1| putative short chain dehydrogenase [Yersinia pestis Antiqua]
 gi|115347922|emb|CAL20844.1| putative short chain dehydrogenase [Yersinia pestis CO92]
 gi|145209913|gb|ABP39320.1| short chain dehydrogenase [Yersinia pestis Pestoides F]
 gi|149292279|gb|EDM42353.1| putative short chain dehydrogenase [Yersinia pestis CA88-4125]
 gi|152958346|gb|ABS45807.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pseudotuberculosis IP 31758]
 gi|162353522|gb|ABX87470.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis Angola]
 gi|165913819|gb|EDR32437.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165920699|gb|EDR37947.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165990485|gb|EDR42786.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166207888|gb|EDR52368.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166961749|gb|EDR57770.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167049781|gb|EDR61189.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167056041|gb|EDR65819.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|186698538|gb|ACC89167.1| short-chain dehydrogenase/reductase SDR [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681042|gb|EEO77137.1| predicted oxoacyl-(acyl carrier protein) reductase [Yersinia pestis
           Nepal516]
 gi|229688577|gb|EEO80646.1| predicted oxoacyl-(acyl carrier protein) reductase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229693979|gb|EEO84028.1| predicted oxoacyl-(acyl carrier protein) reductase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229701994|gb|EEO90015.1| predicted oxoacyl-(acyl carrier protein) reductase [Yersinia pestis
           Pestoides A]
 gi|262362133|gb|ACY58854.1| short chain dehydrogenase [Yersinia pestis D106004]
 gi|262365463|gb|ACY62020.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Yersinia pestis
           D182038]
 gi|270339124|gb|EFA49901.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Yersinia pestis KIM D27]
 gi|294354206|gb|ADE64547.1| short chain dehydrogenase [Yersinia pestis Z176003]
 gi|320014880|gb|ADV98451.1| putative oxoacyl-(acyl carrier protein) reductase [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 253

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 123/241 (51%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDI 71
           H  L+ R+ LVTG+  GIG   AL  AR GA +I  GR+ S+L  +K  +         +
Sbjct: 7   HDLLNQRIILVTGAGDGIGREAALTYARFGARLILVGRTESKLLAVKKQIADAGGLPALV 66

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            + DL  + A +  +    ++ +  +LD ++ NAG+LG ++P+ +     + DV+ VNV 
Sbjct: 67  LSLDLLHATAADCQQLADTVSAQVPRLDGVLHNAGLLGEVAPMSEQSIAVWQDVMQVNVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS     +  SS    + R  WGAYS SK A E + +  ++E   +
Sbjct: 127 ATFMLTQALLPLLLKSPSASLVFTSSSVGRQGRAGWGAYSVSKFATEGMMQVLAEEYKQS 186

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P ED + +  P  +  +  +L     + +TG  F     
Sbjct: 187 NLRVNCINPGGTRTQMRATAFPDEDASKLKTPADIMPLYLYLMGDDSRRKTGISFDAQPG 246

Query: 249 R 249
           R
Sbjct: 247 R 247


>gi|22125946|ref|NP_669369.1| short chain dehydrogenase [Yersinia pestis KIM 10]
 gi|45441812|ref|NP_993351.1| short chain dehydrogenase [Yersinia pestis biovar Microtus str.
           91001]
 gi|21958887|gb|AAM85620.1|AE013808_3 putative oxidoreductase [Yersinia pestis KIM 10]
 gi|45436674|gb|AAS62228.1| putative short chain dehydrogenase [Yersinia pestis biovar Microtus
           str. 91001]
          Length = 282

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 123/241 (51%), Gaps = 4/241 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDI 71
           H  L+ R+ LVTG+  GIG   AL  AR GA +I  GR+ S+L  +K  +         +
Sbjct: 36  HDLLNQRIILVTGAGDGIGREAALTYARFGARLILVGRTESKLLAVKKQIADAGGLPALV 95

Query: 72  FAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
            + DL  + A +  +    ++ +  +LD ++ NAG+LG ++P+ +     + DV+ VNV 
Sbjct: 96  LSLDLLHATAADCQQLADTVSAQVPRLDGVLHNAGLLGEVAPMSEQSIAVWQDVMQVNVN 155

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L KS     +  SS    + R  WGAYS SK A E + +  ++E   +
Sbjct: 156 ATFMLTQALLPLLLKSPSASLVFTSSSVGRQGRAGWGAYSVSKFATEGMMQVLAEEYKQS 215

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P ED + +  P  +  +  +L     + +TG  F     
Sbjct: 216 NLRVNCINPGGTRTQMRATAFPDEDASKLKTPADIMPLYLYLMGDDSRRKTGISFDAQPG 275

Query: 249 R 249
           R
Sbjct: 276 R 276


>gi|197106016|ref|YP_002131393.1| dehydrogenase [Phenylobacterium zucineum HLK1]
 gi|196479436|gb|ACG78964.1| dehydrogenase [Phenylobacterium zucineum HLK1]
          Length = 260

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 127/249 (51%), Gaps = 23/249 (9%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           + LD ++A+VTGS+RGIG  TA  L R+GA ++   R     E+++ AL   ++ ++  A
Sbjct: 8   LRLDGQVAVVTGSTRGIGLATARLLGRAGARIVVSSRKAEACEQVRAAL--CDEGVEAIA 65

Query: 74  FDLRDSNALELTKTYIAKR----WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
                  ALE  +  +A+     +G++D+LI+NAG+  S S +  + E+++  V  VN+ 
Sbjct: 66  APCH--TALEADRQRLAEAATAAFGRVDVLISNAGVNPSFSSLQDLPEEAWDKVFDVNLK 123

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A W + +   P + K   G  ++LSS  +    P  GAY+ +KA +  LAR  + E    
Sbjct: 124 AAWRLSQLLAPEIAKQGSGAMVLLSSIGSIVASPRSGAYAVAKAGVNHLARQLAHEWGPA 183

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNT------------VPHPQKVAKIISFLC-ATQK 236
            +RV ++ PG TRT M   AM   DP              +  P+ +A +I FL  A  +
Sbjct: 184 GIRVNSVAPGVTRTDMVRAAM--ADPKALEATLRRTPLRRIAEPEDIASVILFLVSAAGR 241

Query: 237 IETGKLFSV 245
             TG+   V
Sbjct: 242 HVTGQTLVV 250


>gi|237799013|ref|ZP_04587474.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331021867|gb|EGI01924.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 246

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 117/222 (52%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L  R+ LVTG+ RGIG   A   A  GA V+  GR+ S L ++ + ++   + +  +  F
Sbjct: 11  LKGRIVLVTGAGRGIGAAAARSYAAHGATVLLLGRTESSLSEVYDQIEAAGQPRPVVIPF 70

Query: 75  DLR--DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL        +     I   +G+LD L+ NA I+G  +P+ QI  + FA V+ +NV A +
Sbjct: 71  DLEIAGPGHYQELAGMIETEFGRLDGLLHNASIIGPRTPLEQISAEEFAQVMHINVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + ++  P L+ S        SS    K R  WGAYS SK A E L +T + E    TA+
Sbjct: 131 MLTQAMLPLLELSEDASIAFTSSSVGRKGRANWGAYSVSKFATEGLMQTLADELDGVTAI 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA+A P+E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTGMRAQAYPSENPLDNPAPEDIMPVYLYLMG 232


>gi|238794711|ref|ZP_04638315.1| Uncharacterized oxidoreductase yciK [Yersinia intermedia ATCC
           29909]
 gi|238725942|gb|EEQ17492.1| Uncharacterized oxidoreductase yciK [Yersinia intermedia ATCC
           29909]
          Length = 253

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 123/239 (51%), Gaps = 6/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQL----EKLKNALQKINKKIDI 71
           L+NR  LVTG+  GIG   AL  AR GA ++  GR+ S+L    +++  A       + +
Sbjct: 10  LNNRTILVTGAGDGIGREAALTYARFGARLVLVGRTESKLIAVQQQIAEAQGLPALALPL 69

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
                 + +  +L  T +++    LD ++ NAG+LG I+P+ +     + +V+ VNV A 
Sbjct: 70  DLLHATEQDCQQLAGT-LSQHVSHLDGVLHNAGLLGDIAPMAEQNIALWQEVMQVNVNAT 128

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KSH    +  SS    + R  WGAY+ SK A E + +  ++E  ++ L
Sbjct: 129 FMLTQALLPLLLKSHSASLVFTSSSVGRQGRSGWGAYAVSKFATEGMMQVLAEEYKHSNL 188

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT MRA A P ED   +  P  +  +  +L +   + +TG  F     R
Sbjct: 189 RVNCINPGGTRTQMRASAFPDEDAAKLKTPADIMPLYLYLMSDDSRRKTGISFDAQPGR 247


>gi|71735863|ref|YP_275814.1| short chain dehydrogenase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71556416|gb|AAZ35627.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320323357|gb|EFW79445.1| short chain dehydrogenase [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320327554|gb|EFW83566.1| short chain dehydrogenase [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 246

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 117/222 (52%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  R+ LVTG++RGIG   A   A  GA V+  GR+ + L ++ + +Q     +  +  F
Sbjct: 11  LKGRIILVTGAARGIGAAAAKTYAAHGATVLLLGRTEASLAQVHDEIQAAGHLLPLVIPF 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  ++  +     T I ++ G+LD L+ NA I+G  + +  +  + F  V+ VNV A +
Sbjct: 71  DLESADPAQYHDLATMIERKVGRLDGLLHNASIIGPRTSVEHLPGEDFMQVMHVNVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + ++  P L++S        SS    K R  WGAY  SK A E L +T + E    T+L
Sbjct: 131 MLTQALLPLLRRSTDASVAFTSSSVGRKGRAQWGAYGVSKFATEGLMQTLADELEGVTSL 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA+A P E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTGMRAQAYPDENPQNNPAPEDIMPVYLYLMG 232


>gi|206582084|pdb|3E9Q|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase From
           Shigella Flexneri
 gi|206582085|pdb|3E9Q|B Chain B, Crystal Structure Of The Short Chain Dehydrogenase From
           Shigella Flexneri
          Length = 273

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 122/239 (51%), Gaps = 7/239 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           L++R+ LVTG+S GIG   A   AR GA VI  GR+  +L ++ + + ++  ++   F  
Sbjct: 31  LNDRIILVTGASDGIGREAAXTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFIL 90

Query: 75  DL---RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL      N  +L +  +   + +LD ++ NAG+LG + P  +   + + DV  +NV A 
Sbjct: 91  DLLTCTSENCQQLAQRIVVN-YPRLDGVLHNAGLLGDVCPXSEQNPQVWQDVXQINVNAT 149

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + ++  P L KS  G  +  SS    + R  WGAY+ASK A E   +  + E     L
Sbjct: 150 FXLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGXXQVLADE-YQQRL 208

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           RV  I+PG TRT+ RA A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 209 RVNCINPGGTRTAXRASAFPTEDPQKLKTPADIXPLYLWLXGDDSRRKTGXTFDAQPGR 267


>gi|73667262|ref|YP_303278.1| Short-chain dehydrogenase/reductase SDR [Ehrlichia canis str. Jake]
 gi|72394403|gb|AAZ68680.1| Short-chain dehydrogenase/reductase SDR [Ehrlichia canis str. Jake]
          Length = 241

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 125/236 (52%), Gaps = 2/236 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L  ++A++TG+S  IG   A   A+ GA +I   ++I++L  + +++Q+   +  + A 
Sbjct: 4   QLAGKVAIITGASGNIGSAIAKRFAKEGACLILVAKNINKLNAIYDSIQESGGEAMLAAV 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL+D + ++     I  ++  +DIL+ NA I+G++SP+   +   +  ++ +N  ANW++
Sbjct: 64  DLQDFDTIKNFAMSIGTKFKCIDILVLNAAIVGALSPLQDYEYDLYKRIMDINFTANWHL 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCR--PLWGAYSASKAAIEALARTWSKETVNTALR 192
           ++  DP LK S  GR I ++S         P WG Y++SK+A+E + R ++ ET ++ L 
Sbjct: 124 IKYCDPLLKLSPAGRVIAVTSEVTQSLSRYPYWGPYASSKSALETMLRIYATETKHSKLC 183

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQN 248
           V  + P      +  +A P ++      P+        L +TQ   TG+ + +  +
Sbjct: 184 VNIVYPPLMYNDIYTQAFPTKEIAQSVLPENFTDKFIELASTQCNVTGETYKLESD 239


>gi|225677099|ref|ZP_03788101.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225590858|gb|EEH12083.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia endosymbiont of Muscidifurax uniraptor]
          Length = 251

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 105/188 (55%), Gaps = 10/188 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK----KIDI 71
           L+ ++AL+TG+S GIG   A    R GA VI   RS+  L+ L N ++++ +     + +
Sbjct: 12  LEGKVALITGASGGIGSAVAKRFIREGACVILISRSLDNLKPLYNEIEELEEFKEGSVKL 71

Query: 72  FAFDLRDSNALELTKTYIAK----RWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
              DL D   +++    I        G LDIL+A AGILG ++PI   + +   +V++ N
Sbjct: 72  IQLDLLDFENVKILTNMIESLKLSESGALDILVACAGILGKLNPIHDCEIEELQNVMNTN 131

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAY--KCRPLWGAYSASKAAIEALARTWSKE 185
             ANW ++++ DP LKKS+ GRAI ++S         P W  Y+ASK A+E + + ++ E
Sbjct: 132 FTANWYLLKNLDPMLKKSNAGRAIFMTSEVTLSPSSYPYWMPYAASKVALEIMVQIYASE 191

Query: 186 TVNTALRV 193
           T +T L V
Sbjct: 192 TKHTKLCV 199


>gi|17229376|ref|NP_485924.1| hypothetical protein all1884 [Nostoc sp. PCC 7120]
 gi|17130974|dbj|BAB73583.1| all1884 [Nostoc sp. PCC 7120]
          Length = 227

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 107/228 (46%), Gaps = 4/228 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           +L L+TG SRG+GY       + G  +I C RS   +EKL +   K     +  A D+ D
Sbjct: 3   KLILITGVSRGLGYALTERFIQEGHTIIGCARSQVTVEKLSH---KFGSPHNFVAVDVAD 59

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
              ++     I K +   DILI NA I    +P+W++    F+ +I +N+    +I+R F
Sbjct: 60  EAQVKAWAELILKEYEPPDILINNAAIANQPAPLWEVPSTDFSQLIDINIKGVVHIIRYF 119

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P + +   G  I LSSG      PL   Y ASK AIE L R  ++E +   +  I ++P
Sbjct: 120 IPAMVQKRHGIIINLSSGWGRSTSPLVAPYCASKWAIEGLTRALAQE-LPAGMAAIPLNP 178

Query: 199 GPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
           G   T M       E  N  P  Q V K + F+   +  + G   +VP
Sbjct: 179 GIIHTDMLDICFGEEAVNYPPISQWVLKAVPFILQLKPTDNGVPLTVP 226


>gi|77460304|ref|YP_349811.1| short chain dehydrogenase [Pseudomonas fluorescens Pf0-1]
 gi|77384307|gb|ABA75820.1| putative short chain dehydrogenase [Pseudomonas fluorescens Pf0-1]
          Length = 246

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 119/222 (53%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L +R+ LVTG+ RGIG   A   A  GA V+  G++ + L ++ + ++   + +  +  F
Sbjct: 11  LKDRIILVTGAGRGIGAAAAKTYAAHGATVLLLGKTEANLTEVYDEIEAAGHPQPAVIPF 70

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  +     I   +G LD L+ NA I+G  +PI Q+  ++F  V+ VNV A +
Sbjct: 71  NLETALPHQYDELAAMIETEFGHLDGLLHNASIIGPRTPIEQLSGENFMRVMQVNVNAMF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            +  +  P LK S     +  SS    K R  WGAY  SK A E L +T + E  N A +
Sbjct: 131 MLTSTLLPLLKLSQDASVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADEVENVAPV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRTSMRA+A P E+P   P P+++  +  +L  
Sbjct: 191 RSNSINPGATRTSMRAQAYPGENPLNNPTPEEIMPVYLYLMG 232


>gi|188533753|ref|YP_001907550.1| short chain dehydrogenase [Erwinia tasmaniensis Et1/99]
 gi|188028795|emb|CAO96657.1| Putative short chain dehydrogenase [Erwinia tasmaniensis Et1/99]
          Length = 255

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 115/229 (50%), Gaps = 5/229 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS---ISQLEKLKNALQKINKKIDIF 72
           L+NR+ LVTG+S GIG   AL  AR GA VI   R+   + Q+ K   A     +    F
Sbjct: 10  LNNRIILVTGASDGIGREAALTYARYGAQVILLARNAEKLLQVSKEVAACSPTKRPAVWF 69

Query: 73  AFDLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
           + DL  + A E  +    + ++   LD ++ NAG+LG + P+ Q     +  V+ VN+ A
Sbjct: 70  SLDLEQATAEECRQLAHSLEEQIPHLDGVLHNAGLLGDVLPMEQQDPAIWQRVMRVNIDA 129

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            + + ++  P L KS     +  SS    K R  WGAYS SK A E + +  ++E     
Sbjct: 130 TFFLTQALLPLLLKSPSASLVFTSSSVGRKGRAGWGAYSVSKFATEGMMQVLAQEYDPLR 189

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIET 239
           LRV  I+PG TRT MRA A P E+P  +  P  +  +  +L     I +
Sbjct: 190 LRVNCINPGGTRTKMRASAFPDEEPTKLKTPADIMPLYLWLMGDDSINS 238


>gi|213018706|ref|ZP_03334514.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|212995657|gb|EEB56297.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 254

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/217 (31%), Positives = 112/217 (51%), Gaps = 8/217 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK-IDIFAF 74
           L+ ++AL+TG+S GIG   A    R GA VI   R I  L+ L N ++++ +  + +   
Sbjct: 12  LEGKVALITGASGGIGSAVAKRFVREGACVILISRFIDHLKPLYNEIEELKEGYVKLIQL 71

Query: 75  DLRDSNALELTKTYIAK----RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
           DL D   +E     I        G LDILI    IL  +SP+   + +    V++ N  A
Sbjct: 72  DLLDFENVEKLANMIESPKLSESGTLDILITCTEILCKLSPVHDCELEDLQKVMNTNFTA 131

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAY--KCRPLWGAYSASKAAIEALARTWSKETVN 188
           +W ++++  P LKKS+ GRAI ++S         P W  Y+ASK A+EA+ + ++ ET +
Sbjct: 132 SWYLLKNLGPILKKSNAGRAIFMTSKITLSPSSYPYWMPYAASKVALEAMVKIYASETKH 191

Query: 189 TALRVINI-DPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           T L +  +    P  + M  +A P +D + +  P K+
Sbjct: 192 TNLCINAVYSEEPIDSEMYKQAFPGKDISELVPPDKL 228


>gi|190571309|ref|YP_001975667.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|190357581|emb|CAQ55022.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
          Length = 246

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/217 (31%), Positives = 112/217 (51%), Gaps = 8/217 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK-IDIFAF 74
           L+ ++AL+TG+S GIG   A    R GA VI   R I  L+ L N ++++ +  + +   
Sbjct: 4   LEGKVALITGASGGIGSAVAKRFVREGACVILISRFIDHLKPLYNEIEELKEGYVKLIQL 63

Query: 75  DLRDSNALELTKTYIAK----RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
           DL D   +E     I        G LDILI    IL  +SP+   + +    V++ N  A
Sbjct: 64  DLLDFENVEKLANMIESPKLSESGTLDILITCTEILCKLSPVHDCELEDLQKVMNTNFTA 123

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAY--KCRPLWGAYSASKAAIEALARTWSKETVN 188
           +W ++++  P LKKS+ GRAI ++S         P W  Y+ASK A+EA+ + ++ ET +
Sbjct: 124 SWYLLKNLGPILKKSNAGRAIFMTSKITLSPSSYPYWMPYAASKVALEAMVKIYASETKH 183

Query: 189 TALRVINI-DPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           T L +  +    P  + M  +A P +D + +  P K+
Sbjct: 184 TNLCINAVYSEEPIDSEMYKQAFPGKDISELVPPDKL 220


>gi|149181031|ref|ZP_01859532.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Bacillus sp. SG-1]
 gi|148851315|gb|EDL65464.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Bacillus sp. SG-1]
          Length = 254

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 113/220 (51%), Gaps = 4/220 (1%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +++ ++TG+S+G+G   A   A+ GA +  C R   +L++++  L++I  ++   A D+ 
Sbjct: 16  DKVVMITGASKGLGRELAFAFAKEGAKLAICARGEEKLKEVQRDLERIGAEVLAVAADVS 75

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISP--IWQIKEKSFADVISVNVMANWNIM 135
           +   ++   +     +G++D+LI NA + G   P  +     + F DV+ VNVM    + 
Sbjct: 76  NQRDVDRFVSITEGVYGRVDVLINNASVFGK-GPCLLLDYLNEEFEDVLRVNVMNTLMMT 134

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P +     G  I L+S A       WGAY  SK A+E + +TW+ E   T +R+  
Sbjct: 135 KRVLPGMLSRGGGSVINLTSEAGKTGFAEWGAYGISKFAVEGMTQTWADELSETGVRMNM 194

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           +DPG   T M  +A+P  D   + +P +V  +  +L + +
Sbjct: 195 VDPGEMDTEMHDRAVPDCDYE-LANPAEVVDVFLYLASDE 233


>gi|225630994|ref|YP_002727785.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia sp. wRi]
 gi|225592975|gb|ACN95994.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia sp. wRi]
          Length = 251

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 105/188 (55%), Gaps = 10/188 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK----KIDI 71
           L+ ++AL+TG+S G+G   A    R GA VI   RS+  L+ L N ++++ +     + +
Sbjct: 12  LEGKVALITGASGGVGSAVAKRFIREGACVILISRSLDNLKPLYNEIEELEEFKEGSVKL 71

Query: 72  FAFDLRDSNALELTKTYIAK----RWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
              DL D   +++    I        G LDIL+A AGILG ++PI   + +   +V++ N
Sbjct: 72  IQLDLLDFENVKILTNMIESLKLSESGALDILVACAGILGKLNPIHDCEIEELQNVMNTN 131

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAY--KCRPLWGAYSASKAAIEALARTWSKE 185
             ANW ++++ DP LKKS+ GRAI ++S         P W  Y+ASK A+E + + ++ E
Sbjct: 132 FTANWYLLKNLDPMLKKSNAGRAIFMTSEVTLSPSSYPYWMPYAASKVALEIMVQIYASE 191

Query: 186 TVNTALRV 193
           T +T L V
Sbjct: 192 TKHTKLCV 199


>gi|114769309|ref|ZP_01446935.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [alpha proteobacterium HTCC2255]
 gi|114550226|gb|EAU53107.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [alpha proteobacterium HTCC2255]
          Length = 217

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 114/216 (52%), Gaps = 4/216 (1%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           + ++ALVTG+SRG+G   +  LA +  +VIA  R+   LE+L + +Q       +   D+
Sbjct: 5   NKKIALVTGASRGLGAAVSEALAENNYHVIAIARTSGALEELDDRIQSKGGSATLVPLDI 64

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
            D  A++     I +RWG LD+ +  A     +SP+  I EK +   I++N+ A   ++ 
Sbjct: 65  TDEEAVKRMCILIHERWGGLDLWVHCAIHASPLSPVSHISEKDWEKTIAINITATGRLIT 124

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
           + +  L  ++ G AI +    +      +G Y +SKAA  AL  +W+ ETV T   ++  
Sbjct: 125 NLESLL-LANSGTAIHIDDKVS--GHKFFGNYGSSKAAQRALFESWASETVKTGPNILVF 181

Query: 197 DPGPTRTSMRAKAMPAEDPNTVPHP-QKVAKIISFL 231
            P P  T+ RA+  P ED + + HP ++ A++I  L
Sbjct: 182 SPNPMPTACRARFFPGEDRSALFHPSEEAARLIKQL 217


>gi|42521088|ref|NP_967003.1| short chain dehydrogenase/reductase family oxidoreductase
           [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|58697398|ref|ZP_00372715.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia endosymbiont of Drosophila simulans]
 gi|58698245|ref|ZP_00373164.1| 3-oxoacyl-(acyl-carrier-protein) reductase, putative [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|42410829|gb|AAS14937.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|58535217|gb|EAL59297.1| 3-oxoacyl-(acyl-carrier-protein) reductase, putative [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58536194|gb|EAL59767.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Wolbachia endosymbiont of Drosophila simulans]
          Length = 243

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 105/188 (55%), Gaps = 10/188 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK----KIDI 71
           L+ ++AL+TG+S G+G   A    R GA VI   RS+  L+ L N ++++ +     + +
Sbjct: 4   LEGKVALITGASGGVGSAVAKRFIREGACVILISRSLDNLKPLYNEIEELEEFKEGSVKL 63

Query: 72  FAFDLRDSNALELTKTYIAK----RWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
              DL D   +++    I        G LDIL+A AGILG ++PI   + +   +V++ N
Sbjct: 64  IQLDLLDFENVKILTNMIESLKLSESGALDILVACAGILGKLNPIHDCEIEELQNVMNTN 123

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAY--KCRPLWGAYSASKAAIEALARTWSKE 185
             ANW ++++ DP LKKS+ GRAI ++S         P W  Y+ASK A+E + + ++ E
Sbjct: 124 FTANWYLLKNLDPMLKKSNAGRAIFMTSEVTLSPSSYPYWMPYAASKVALEIMVQIYASE 183

Query: 186 TVNTALRV 193
           T +T L V
Sbjct: 184 TKHTKLCV 191


>gi|198284784|ref|YP_002221105.1| short-chain dehydrogenase/reductase SDR [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665265|ref|YP_002427470.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|14251202|gb|AAF76297.2|AF220499_2 putative glucose/ribitol short chain dehydrogenase
           [Acidithiobacillus ferrooxidans]
 gi|198249305|gb|ACH84898.1| short-chain dehydrogenase/reductase SDR [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517478|gb|ACK78064.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 263

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 112/222 (50%), Gaps = 9/222 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL------QKINKKI 69
           L+ R+ +VTG+  GIG   A+E AR GA V+  GR+  +LE + + +      + +   +
Sbjct: 11  LNGRVIIVTGAGEGIGRCAAVEFARLGAEVVLLGRTQRKLEGVYDEIVDSGYKEPVIHPM 70

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           D+     RD          + +  G+LD ++ NA  L  ++PI    E+ +   + VNV 
Sbjct: 71  DLLTAKGRDYQDF---AQRLKESLGRLDGILHNAAELDILTPIQYYDEELWESAMKVNVT 127

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + + ++  P L  S     + ++   A + +  WGAY+ SKAA++ L  T + E  NT
Sbjct: 128 APYLLTQACLPLLLASEDASIVFITDDCAREAKGYWGAYAVSKAAVQHLGLTLAIELQNT 187

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
            +RV  I+PGP RT MR +  P     +VP P  +  +  +L
Sbjct: 188 NVRVNVINPGPCRTGMRVRTHPGASIMSVPPPIAIMPLYEYL 229


>gi|257485855|ref|ZP_05639896.1| short chain dehydrogenase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|330986671|gb|EGH84774.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. lachrymans str. M301315]
 gi|331012941|gb|EGH92997.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 246

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 117/222 (52%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  R+ LVTG++RGIG   A   A  GA V+  GR+ + L ++ + +Q     +  +  F
Sbjct: 11  LKGRIILVTGAARGIGAAAAKTYAAHGATVLLLGRTEASLAQVHDEIQAAGHLLPLVIPF 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  ++  +     T I ++ G+LD L+ NA I+G  + +  +  + F  V+ VNV A +
Sbjct: 71  DLESADPAQYHDLATMIERKVGRLDGLLHNASIIGPRTSVEHLPGEDFMQVMHVNVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + ++  P L++S        SS    K R  WGAY  SK A E L +T + E    T++
Sbjct: 131 MLTQALLPLLRRSTDASVAFTSSSVGRKGRAQWGAYGVSKFATEGLMQTLADELEGVTSV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA+A P E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTGMRAQAYPDENPQNNPAPEDIMPVYLYLMG 232


>gi|229589159|ref|YP_002871278.1| short chain dehydrogenase [Pseudomonas fluorescens SBW25]
 gi|229361025|emb|CAY47887.1| putative short chain dehydrogenase [Pseudomonas fluorescens SBW25]
          Length = 246

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 119/222 (53%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L  R+ LVTG+ RGIG   A   A  GA V+  G++ + L ++ + ++   + +  +  F
Sbjct: 11  LKGRIILVTGAGRGIGAAAAKTYAAHGATVLLLGKTEANLAQVYDEIEAAGQPQPVVIPF 70

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  +     I K +G LD L+ NA I+G  +PI Q+  ++F  V+ VNV A +
Sbjct: 71  NLETALPHQYDELAAMIEKEFGHLDGLLHNASIIGPRTPIEQLSGENFMRVMHVNVNAMF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-AL 191
            +  +  P LK S     +  SS    K R  WGAY  SK A E L +T + E  +  A+
Sbjct: 131 MLTSTLLPLLKLSQDASVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADELEDVAAV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRTSMRA+A P E+P   P P+++  +  +L  
Sbjct: 191 RANSINPGGTRTSMRAQAYPGENPMERPAPEEIMPVYLYLMG 232


>gi|332283637|ref|YP_004415548.1| reducatse [Pusillimonas sp. T7-7]
 gi|330427590|gb|AEC18924.1| reducatse [Pusillimonas sp. T7-7]
          Length = 252

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 115/242 (47%), Gaps = 12/242 (4%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  ++ALVTGSSRGIGY  A  L   GA V+  GRS S LE    AL++   K+    F
Sbjct: 3   DLSGQVALVTGSSRGIGYAAARALGLQGATVVLNGRSASTLEPAATALREQGVKVHTAPF 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ + +        +    GK+DI  +NAGI     P+    ++ F  +IS N+ A W +
Sbjct: 63  DILEIDQSIAAVDAVLDDLGKIDIFFSNAGIQHR-EPLLSFPQQEFERIISGNLTAQWAL 121

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R     +     GR I   S  A + +P   AY+A+KAA+  + R W+ E   +++ V 
Sbjct: 122 GRHIAAGMAGQGYGRIIFTGSITAIRGKPQITAYTAAKAALHGMVRQWAAELSESSITVN 181

Query: 195 NIDPGPTRTSMRAKAMPAEDPNT-----VPH-----PQKVAKIISFLCATQ-KIETGKLF 243
            I PG   T +       E  N      VP      P  +A  + F+ A + +  TG++ 
Sbjct: 182 AIAPGYVATELTRNLWGDEAFNAWLQERVPQKKWGEPDDIASAVVFMAARESRFVTGQVL 241

Query: 244 SV 245
           +V
Sbjct: 242 AV 243


>gi|307325281|ref|ZP_07604484.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
 gi|306889085|gb|EFN20068.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
          Length = 250

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 117/225 (52%), Gaps = 9/225 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L   +ALVTG++ GIG  TA +LA  GA+V+  GR  ++ E +  A++    + D  A D
Sbjct: 6   LAGSVALVTGATSGIGAATAAKLAERGAHVLVAGRDRARGEAVVGAVRGRGGRADFVAAD 65

Query: 76  LRDSNAL-ELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           LRD+ ++ +L +       G++D+L+ NAGI     P  Q  +     V ++NV A + +
Sbjct: 66  LRDAESVRKLAREARELGGGRVDVLVNNAGIF-PFGPTDQTPQSDVDTVYALNVKAPFYL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +    P + +   G  I +S+  A    P    Y +SKAA+  L ++W+ E     +R  
Sbjct: 125 VAELAPAMAERGYGAVINVSTMVAEYGAPGMALYGSSKAALNLLTKSWAAEYGPRGVRFN 184

Query: 195 NIDPGPTRTSMRAK------AMPAEDPNTVP-HPQKVAKIISFLC 232
            ++PGPTRT   A       A+ A+ P   P  P+++A+ I+FL 
Sbjct: 185 AVEPGPTRTEGTAGMGEDLTALAAQAPTGRPAAPEEIAEAITFLA 229


>gi|289623726|ref|ZP_06456680.1| short chain dehydrogenase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648168|ref|ZP_06479511.1| short chain dehydrogenase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330866093|gb|EGH00802.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. aesculi str. 0893_23]
          Length = 246

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 117/222 (52%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  R+ LVTG++RGIG   A   A  GA V+  GR+ + L ++ + +Q     +  +  F
Sbjct: 11  LKGRIILVTGAARGIGAAAAKTYAAHGATVLLLGRTEASLAQVHDEIQAAGHLLPLVIPF 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  ++  +     T I ++ G+LD L+ NA I+G  + +  +  + F  V+ VNV A +
Sbjct: 71  DLESADPAQYHDLATMIERKVGRLDGLLHNASIIGPRTSVEHLPGEDFMQVMHVNVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + ++  P L++S        SS    K R  WGAY  SK A E L +T + E    T++
Sbjct: 131 MLTQALLPLLRRSTDASMAFTSSSVGRKGRAQWGAYGVSKFATEGLMQTLADELEGVTSV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA+A P E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTGMRAQAYPDENPQNNPAPEDIMPVYLYLMG 232


>gi|28868946|ref|NP_791565.1| short chain dehydrogenase/reductase family oxidoreductase
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213968726|ref|ZP_03396868.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Pseudomonas syringae pv. tomato T1]
 gi|301381341|ref|ZP_07229759.1| short chain dehydrogenase [Pseudomonas syringae pv. tomato Max13]
 gi|302060233|ref|ZP_07251774.1| short chain dehydrogenase [Pseudomonas syringae pv. tomato K40]
 gi|302130022|ref|ZP_07256012.1| short chain dehydrogenase [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|28852186|gb|AAO55260.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213926659|gb|EEB60212.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Pseudomonas syringae pv. tomato T1]
          Length = 246

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 63/193 (32%), Positives = 104/193 (53%), Gaps = 4/193 (2%)

Query: 45  VIACGRSISQLEKLKNALQKINK-KIDIFAFDLRDSNALELTK--TYIAKRWGKLDILIA 101
           V+  GR+ + L ++ + ++   + +  I A +L ++ A +  +    +   +G+LD L+ 
Sbjct: 40  VVLLGRTEASLAEVSDQIKSAGQPQPLIIALNLENATAQQYRELAARVEHEFGRLDGLLH 99

Query: 102 NAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC 161
           NA I+G  +P+ Q+ ++ F  V+ VNV A + + R+  P LK+S        SS    K 
Sbjct: 100 NASIIGPRTPLEQLPDEDFMQVMHVNVNATFMLTRALLPLLKRSEDASIAFTSSSVGRKG 159

Query: 162 RPLWGAYSASKAAIEALARTWSKETVN-TALRVINIDPGPTRTSMRAKAMPAEDPNTVPH 220
           R  WGAY  SK A E L +T + E    TA+R  +I+PG TRT MRA+A P E+P   P 
Sbjct: 160 RANWGAYGVSKFATEGLMQTLADELEGVTAVRANSINPGATRTGMRAQAYPDENPLNNPA 219

Query: 221 PQKVAKIISFLCA 233
           P+ +  +  +L  
Sbjct: 220 PEDIMPVYLYLMG 232


>gi|242239358|ref|YP_002987539.1| short chain dehydrogenase [Dickeya dadantii Ech703]
 gi|242131415|gb|ACS85717.1| short-chain dehydrogenase/reductase SDR [Dickeya dadantii Ech703]
          Length = 253

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 124/238 (52%), Gaps = 4/238 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKL-KNALQKINKKIDIFAF 74
           L  R+ LVTG+  GIG   AL  AR GA ++  GR+ S+L  + +  L++      I   
Sbjct: 10  LKQRIILVTGAGDGIGREAALTYARYGARLLLLGRTESKLHDVGRQILREQGVHSTIIPC 69

Query: 75  DLRDSNALELTKT--YIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           D+  ++  +  +    I +    LD ++ NAG+LG ++P+ +    S+  V+ VNV A +
Sbjct: 70  DMLTASHEDFMQIARQIEQDEPYLDGVLHNAGLLGEVAPMPEQSVDSWHQVMQVNVNATF 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + ++  P L K+     +  SS    + R  WGAY+ SK A E + +  ++E  ++ LR
Sbjct: 130 MLTQALLPLLLKAASPSLVFTSSSVGREGRANWGAYAVSKFATEGMMQVLAEEYRHSHLR 189

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           V  I+PG TRT+MRA A PAEDP+ +  P  +  +  +L     + +TG  F     R
Sbjct: 190 VNCINPGGTRTAMRATAFPAEDPDKLKTPADIMPLYLYLMGDDSRRKTGISFDAQPGR 247


>gi|312172529|emb|CBX80785.1| putaitve short chain dehydrogenase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 255

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 121/241 (50%), Gaps = 8/241 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS---ISQLEKLKNALQKINKKIDIF 72
           L+NR+ LVTG+S GIG   AL  AR GA V+   R+   + Q+ K   A  +  +    F
Sbjct: 10  LNNRIILVTGASDGIGREAALTYARYGAQVVLLARNAEKLLQVSKEVAACSQSQRAALWF 69

Query: 73  AFDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           A DL  +   N  +L ++ +A +   LD ++ NAG+LG + P+ Q     +  V+ VN+ 
Sbjct: 70  ALDLETATPENCQQLARS-LAGKIPHLDGVLHNAGLLGEVLPMQQQDPAIWQQVMRVNID 128

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L KS     +  SS    + R  WGAYS SK A E + +  ++E    
Sbjct: 129 GTFFLTQALLPLLLKSPAASLVFTSSSVGRQGRAGWGAYSVSKFATEGMMQVLAQEYDPR 188

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P ED   +  P ++  +  +L     I +TG  F     
Sbjct: 189 QLRVNCINPGGTRTKMRASAFPDEDAAKLKTPAEIMTLYLWLMGDDSIGKTGISFDAQPG 248

Query: 249 R 249
           R
Sbjct: 249 R 249


>gi|152988030|ref|YP_001347337.1| short chain dehydrogenase [Pseudomonas aeruginosa PA7]
 gi|150963188|gb|ABR85213.1| probable short-chain dehydrogenase [Pseudomonas aeruginosa PA7]
          Length = 246

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 120/222 (54%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L +R+ LVTG+ RGIG   A   A  GA V+  G++   L ++ +A++   + +  +  F
Sbjct: 11  LKDRVILVTGAGRGIGAAAAKTFAAHGATVLLLGKTEEYLNEVYDAIEAAGHPQPAVIPF 70

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  E     + K +G++D L+ NA ILG  SP+ QI  ++F  V+ VNV A +
Sbjct: 71  NLETAQPHQFEELAATLEKEFGRIDGLLHNASILGPRSPMQQISGENFMRVMQVNVNAMF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-AL 191
            +  +  P +K S     I  SS    K R  WGAYS SK A E L +T + E   T A+
Sbjct: 131 MLTTAMLPLMKLSSDASIIFTSSSVGRKGRAYWGAYSVSKFATEGLMQTLADELDGTSAI 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +++PG TRTSMRA A P E+P   P  +++  +  +L  
Sbjct: 191 RANSVNPGATRTSMRALAYPGENPLNNPTGEEIMPVYLYLMG 232


>gi|310767746|gb|ADP12696.1| short chain dehydrogenase [Erwinia sp. Ejp617]
          Length = 255

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 124/241 (51%), Gaps = 8/241 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS---ISQLEKLKNALQKINKKIDIF 72
           L+NR+ LVTG+S GIG   AL  AR GA V+   R+   + Q+ K   A  +  +    F
Sbjct: 10  LNNRVILVTGASDGIGREAALTYARYGAQVVILARNAEKLLQVSKEVAACSQSQRPALWF 69

Query: 73  AFDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           A DL  +   N  +L ++ +A++  +LD ++ NAG+LG + P+ Q     +  V+ VN+ 
Sbjct: 70  ALDLETATPENCQQLARS-LAEKIPRLDGVLHNAGLLGEVLPVAQQNPAIWQQVMRVNID 128

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L KS     +  SS    + R  WGAYS SK A E + +  ++E    
Sbjct: 129 GTFFLTQALLPLLLKSPAASLVFTSSSVGRQGRAGWGAYSVSKFATEGMMQVLAQEYDPR 188

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P E+ + +  P ++  +  +L     K +TG  F     
Sbjct: 189 QLRVNCINPGGTRTKMRASAFPDENADKLKTPAEIMTLYLWLMGDDSKGKTGVSFDAQPG 248

Query: 249 R 249
           R
Sbjct: 249 R 249


>gi|52425476|ref|YP_088613.1| FabG protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307528|gb|AAU38028.1| FabG protein [Mannheimia succiniciproducens MBEL55E]
          Length = 247

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 126/245 (51%), Gaps = 21/245 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L N++ALVTG   GIG   A ++A +GA VI  GR  +QL++  +A Q  N  I     D
Sbjct: 3   LQNKVALVTGGGTGIGRAIAKQMAEAGATVIIIGRREAQLQE--SARQHAN--IHYIVAD 58

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + +S+ +  T   I +R+GKLD+++ NAGI   ++PI  +    F    ++NV A  ++ 
Sbjct: 59  VLNSDDITRTLNEIQQRFGKLDVVVNNAGI-APVTPIENVNLADFDRTFALNVRAVIDVT 117

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
               P+LK +  G  I ++SG      P+   Y+ASKAA+ ++ RTW+KE     +RV +
Sbjct: 118 SQAIPYLKSTQ-GNIINITSGLVNNPMPMNSIYTASKAAVLSMTRTWAKELAPYGIRVNS 176

Query: 196 IDPGPTRTSM---------RAKAMPAEDPNTVP-----HPQKVAKIISFLCATQ-KIETG 240
           +  G T+T +          AK   A   + VP      P ++A  + FL +   +  TG
Sbjct: 177 VAAGATKTPLYDGLGLSETEAKDYEATVEHIVPLGRFAEPDEIAPAVVFLASDDARYATG 236

Query: 241 KLFSV 245
             + V
Sbjct: 237 AHYGV 241


>gi|89054194|ref|YP_509645.1| short-chain dehydrogenase/reductase SDR [Jannaschia sp. CCS1]
 gi|88863743|gb|ABD54620.1| short-chain dehydrogenase/reductase SDR [Jannaschia sp. CCS1]
          Length = 243

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 109/217 (50%), Gaps = 3/217 (1%)

Query: 5   ESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK 64
           E+  +    ++L +++ALVTG+SRG+G  +AL LA  GA+V+A  R+I  LE L + ++ 
Sbjct: 16  EAATDMHSDIDLSSKIALVTGASRGLGAASALWLAERGAHVVAVARTIGGLEDLDDRIKA 75

Query: 65  INKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVI 124
              +  +   DL D  A+      +  RWG+ DI +  A  + +++P   ++ K    VI
Sbjct: 76  AGGQATLAPMDLTDDGAVAHLCRSLHDRWGRADIWVHTAIHVSALTPAPHVQAKDLDKVI 135

Query: 125 SVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSK 184
           + N+     ++ + +P +  S    A+        K     G Y+ SKAA  AL ++W  
Sbjct: 136 ATNIRGVSRLIANTEPLIAPSEAPTAVFFDDDWDAK---FAGPYAMSKAAQRALVQSWQA 192

Query: 185 ETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
           ET    + V  + P P  T++RA+  P ED   +  P
Sbjct: 193 ETAKAPMAVHLLRPKPMPTAVRARFYPGEDRTPLADP 229


>gi|162148062|ref|YP_001602523.1| short-chain dehydrogenase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786639|emb|CAP56222.1| putative short-chain dehydrogenase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 265

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 109/215 (50%), Gaps = 16/215 (7%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           N   R+ALVTG+ RGIG  TA +LAR G +V+  GR   Q + + + L+      +    
Sbjct: 19  NETRRIALVTGAVRGIGLETARQLARQGIHVLVAGRRQEQADGVADRLRGEGLSAEGVVL 78

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGIL------GSISPIWQIKEKSFADVISVNV 128
           D+ +   L   + YIA  +G+LDIL+ NAG+L      G+  P     +K+  D   +N+
Sbjct: 79  DIDNPAQLTALRDYIATTYGRLDILVNNAGVLLDRGADGAAPPPSATPDKTLRDTFEINL 138

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSS-----GA-AYKCRPLWG----AYSASKAAIEAL 178
            A   + ++  P + KS  GR + LSS     GA +    P++G    AY ASK A+ A 
Sbjct: 139 FATVQVTQTLLPLVLKSPAGRIVNLSSILASLGAHSDPASPIYGKLTFAYDASKTALNAF 198

Query: 179 ARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE 213
               + E  +TA++V +  PG  RT M  +  P +
Sbjct: 199 TVHLAHELKDTAVKVNSAHPGWVRTDMGGQDAPLD 233


>gi|307824207|ref|ZP_07654433.1| short-chain dehydrogenase/reductase SDR [Methylobacter
           tundripaludum SV96]
 gi|307734587|gb|EFO05438.1| short-chain dehydrogenase/reductase SDR [Methylobacter
           tundripaludum SV96]
          Length = 242

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 120/226 (53%), Gaps = 4/226 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L N++ L+TG+  G+G   AL LA+ GA++I   ++I++LE + +A+  I   +  I+ F
Sbjct: 3   LTNQVILITGAGGGLGSTAALALAKHGAHIILLDKNIAKLEAVYDAILTIKAPEPVIYPF 62

Query: 75  DLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +N  E  +    I +++G L  ++ +A    + SPI   K K +   ++VN+ A +
Sbjct: 63  DLAGANENEYQELADKIGEKYGSLQGILHSAVEFSAFSPIATYKTKDWGHTLNVNLNAPF 122

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE-TVNTAL 191
            + R   P L+KS     +  S  +A K     GAY  SK A+E LA   + E      +
Sbjct: 123 LLCRVLLPVLQKSEHASIVFTSDSSARKAPAYAGAYGVSKIAMEGLANILADEHEAFGKI 182

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI 237
           RV  + PGP  + +R +A PAED + +P  + +A I  +L  ++ I
Sbjct: 183 RVNTLIPGPIDSPLRKRAYPAEDKSKLPSMKSLAPIYLYLFGSESI 228


>gi|70731669|ref|YP_261411.1| short chain dehydrogenase [Pseudomonas fluorescens Pf-5]
 gi|68345968|gb|AAY93574.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Pseudomonas fluorescens Pf-5]
          Length = 245

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 106/200 (53%), Gaps = 4/200 (2%)

Query: 38  LARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAFDLRDS--NALELTKTYIAKRWG 94
            A  GA V+  G++ + L ++ +A++   + +  +  F+L  +  +  +     I   +G
Sbjct: 32  FAAHGATVLLLGKTEANLTEVYDAIEAAGHPQPAVIPFNLETALPHQYDELAAMIETEFG 91

Query: 95  KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILS 154
            LD L+ NA I+G  +P+ Q+  ++F  V+ VNV A + +  +  P LK S     +  S
Sbjct: 92  HLDGLLHNASIIGPRTPLEQLSGENFMRVMQVNVNAMFMLTSTLLPLLKLSQDASVVFTS 151

Query: 155 SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRVINIDPGPTRTSMRAKAMPAE 213
           S    K R  WGAY  SK A E L +T + E    A +R  +I+PG TRTSMRA+A P E
Sbjct: 152 SSVGRKGRAYWGAYGVSKFATEGLMQTLADELDTVAPVRANSINPGATRTSMRAQAYPGE 211

Query: 214 DPNTVPHPQKVAKIISFLCA 233
           +P+  P P+++  +  +L  
Sbjct: 212 NPSNNPTPEEIMPVYLYLMG 231


>gi|329766225|ref|ZP_08257783.1| short-chain dehydrogenase/reductase SDR [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329137284|gb|EGG41562.1| short-chain dehydrogenase/reductase SDR [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 277

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 127/252 (50%), Gaps = 18/252 (7%)

Query: 7   KNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN 66
           +N S+  + L  ++A+VTG SRGIG+ TA   A +GA V+   +   +LE   NA+ +I 
Sbjct: 24  RNLSKKILKLSGKVAIVTGGSRGIGFATAKIFAENGANVVITAKDSKRLE---NAVNEIP 80

Query: 67  KKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISV 126
             + I A D+R+ N ++       K++GKLDILI NAGI   I  + +I+E  + +V+ V
Sbjct: 81  NSVGITA-DIRNENDVKKVVEQTVKKFGKLDILINNAGIFPKIKQLHEIEEFEWNEVLDV 139

Query: 127 NVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG--AYSASKAAIEALARTWSK 184
           N+   +   +   P+LKK+  G  I +SS A  K    +   AYSASKA +  L + W+ 
Sbjct: 140 NLTGQYRFTKVAIPYLKKTS-GSIINISSDAGLKAYQGFNADAYSASKAGMIILTKCWAL 198

Query: 185 ETVNTALRVINIDPGPTRTSMRAKAMPAEDPNT----------VPHPQKVAK-IISFLCA 233
           E     +RV  I PG   T M    +  E              +  P +VAK I+ F+  
Sbjct: 199 EYAKEKIRVNCICPGVVDTDMTKPFLKTEKDRDFMNNEHPLGRIGQPDEVAKAILYFVSD 258

Query: 234 TQKIETGKLFSV 245
                TG + +V
Sbjct: 259 DAAWTTGAILTV 270


>gi|312959693|ref|ZP_07774210.1| short chain dehydrogenase [Pseudomonas fluorescens WH6]
 gi|311286410|gb|EFQ64974.1| short chain dehydrogenase [Pseudomonas fluorescens WH6]
          Length = 245

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 120/225 (53%), Gaps = 4/225 (1%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDI 71
           H  L  R+ LVTG+ RGIG   A   A  GA V+  G++ + L ++ + ++   + +  +
Sbjct: 7   HDLLKGRVILVTGAGRGIGAAAAKTYAAHGATVLLLGKTEANLAQVYDEIEAAGHPQPVV 66

Query: 72  FAFDLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
             F+L  +  +  +     I K +G LD L+ NA I+G  +PI Q+  ++F  V+ +NV 
Sbjct: 67  IPFNLETALPHQYDELAAMIEKAFGHLDGLLHNASIIGPRTPIEQLSGENFMRVMHINVN 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A + +  +  P LK S     +  SS    K R  WGAY  SK A E L +T + E  + 
Sbjct: 127 AMFMLTSTLLPLLKLSQDASVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADELEDV 186

Query: 190 -ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            A+R  +I+PG TRTSMRA+A P E+P   P P+++  +  +L  
Sbjct: 187 AAVRANSINPGGTRTSMRAQAYPGENPMERPAPEEIMPVYLYLMG 231


>gi|198284437|ref|YP_002220758.1| short-chain dehydrogenase/reductase SDR [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218667418|ref|YP_002427104.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248958|gb|ACH84551.1| short-chain dehydrogenase/reductase SDR [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519631|gb|ACK80217.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 269

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 117/241 (48%), Gaps = 6/241 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           LD +  LVTG+  GIG   A+E A  GA V+  G++   LE + + +      +  I   
Sbjct: 15  LDGKTILVTGAGDGIGRAVAIEYAHQGATVVLLGKTKRNLEGVYDEITDYGYAEPAILVV 74

Query: 75  DLRD--SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL D  S+A +     I+  + +L+ ++ NA  LG ++P+   +   +  V  VNV +  
Sbjct: 75  DLADPASDAFKTIGAAISSEFTQLNGIVHNAAELGMLTPLENYEGALWDHVFQVNVKSPL 134

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + +   P LK++     I  +  +  K +  WGAY  SKAAI  +AR W+ E  NT +R
Sbjct: 135 LVTQQCLPLLKEAPYASIIFTTDESGVKPKGYWGAYGVSKAAILHMARMWAIEYANTPIR 194

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKI-ETGKLFSVPQNRFV 251
           V  +DPGP RT +R    P         P+ +  I + L     +   G+LF   QN F+
Sbjct: 195 VNIVDPGPCRTGLRLLTHPGMPMKRYTPPEAITSIYTQLMDCDVLGHNGELFYA-QN-FI 252

Query: 252 N 252
           N
Sbjct: 253 N 253


>gi|86604738|ref|YP_473501.1| short chain dehydrogenase/reductase family oxidoreductase
           [Synechococcus sp. JA-3-3Ab]
 gi|86553280|gb|ABC98238.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Synechococcus sp. JA-3-3Ab]
          Length = 291

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/191 (31%), Positives = 101/191 (52%), Gaps = 1/191 (0%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L N++ L+TG+S GIG   ALE A+ GA ++   R    L+ +K+ ++K   +  +  
Sbjct: 2   LSLANQVVLITGASAGIGKAVALEAAKRGARLVLAARREELLQNVKDLVEKQGTEALVVP 61

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ D+  +E        R+G++DIL+ NAG  G + P+ ++   +      VNV     
Sbjct: 62  TDMADTAQVEALAQKALDRFGRVDILVNNAG-YGQMGPVEEVDVAAMRRQFEVNVFGLHA 120

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + R+  P +++   GR + LSS A     P  G YSA+K A+EAL+     E     ++V
Sbjct: 121 LTRALLPQMRERGSGRILNLSSVAGQMSMPFSGVYSATKFAVEALSDALRVEVAPFGIKV 180

Query: 194 INIDPGPTRTS 204
           I I+PGP  T 
Sbjct: 181 IVIEPGPVATE 191


>gi|259908331|ref|YP_002648687.1| short chain dehydrogenase [Erwinia pyrifoliae Ep1/96]
 gi|224963953|emb|CAX55458.1| Putative short chain dehydrogenase [Erwinia pyrifoliae Ep1/96]
 gi|283478270|emb|CAY74186.1| putative oxidoreductase [Erwinia pyrifoliae DSM 12163]
          Length = 255

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 124/241 (51%), Gaps = 8/241 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS---ISQLEKLKNALQKINKKIDIF 72
           L+NR+ LVTG+S GIG   AL  AR G+ V+   R+   + Q+ K   A  +  +    F
Sbjct: 10  LNNRVILVTGASDGIGREAALTYARYGSQVVLLARNAEKLLQVSKEVAACSQSQRPALWF 69

Query: 73  AFDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           A DL  +   N  +L ++ +A++  +LD ++ NAG+LG + P+ Q     +  V+ VN+ 
Sbjct: 70  ALDLETATPENCQQLARS-LAEKIPRLDGVLHNAGLLGEVLPVAQQNPAIWQQVMRVNID 128

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L KS     +  SS    + R  WGAYS SK A E + +  ++E    
Sbjct: 129 GTFFLTQALLPLLLKSPAASLVFTSSSVGRQGRAGWGAYSVSKFATEGMMQVLAQEYDPR 188

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P E+ + +  P ++  +  +L     K +TG  F     
Sbjct: 189 QLRVNCINPGGTRTKMRASAFPDENADKLKTPAEIMTLYLWLMGDDSKGKTGVSFDAQPG 248

Query: 249 R 249
           R
Sbjct: 249 R 249


>gi|292488386|ref|YP_003531268.1| putative short chain dehydrogenase [Erwinia amylovora CFBP1430]
 gi|291553815|emb|CBA20860.1| putaitve short chain dehydrogenase [Erwinia amylovora CFBP1430]
          Length = 255

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 121/241 (50%), Gaps = 8/241 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS---ISQLEKLKNALQKINKKIDIF 72
           L+NR+ LVTG+S GIG   AL  AR GA V+   R+   + Q+ K   A  +  +    F
Sbjct: 10  LNNRIILVTGASDGIGREAALTYARYGAQVVLLARNAEKLLQVSKEVAACSQSQRAALWF 69

Query: 73  AFDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           A DL  +   N  +L ++ +A +   LD ++ NAG+LG + P+ Q     +  V+ VN+ 
Sbjct: 70  ALDLETATPENCQQLARS-LAGKIPHLDGVLHNAGLLGEVLPMQQQDPAIWQQVMRVNID 128

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L KS     +  SS    + R  WGAYS SK A E + +  ++E    
Sbjct: 129 GTFFLTQALLPLLLKSPAASLVFTSSSVGRQGRAGWGAYSVSKFATEGMMQVLAQEYDPR 188

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P ED   +  P ++  +  +L     K +TG  F     
Sbjct: 189 QLRVNCINPGGTRTKMRASAFPDEDAAKLKTPAEIMTLYLWLMGDDSKGKTGISFDAQPG 248

Query: 249 R 249
           R
Sbjct: 249 R 249


>gi|256392747|ref|YP_003114311.1| short-chain dehydrogenase/reductase SDR [Catenulispora acidiphila
           DSM 44928]
 gi|256358973|gb|ACU72470.1| short-chain dehydrogenase/reductase SDR [Catenulispora acidiphila
           DSM 44928]
          Length = 244

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 113/228 (49%), Gaps = 14/228 (6%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           + L  +LAL+TGS+ GIG  TA  +A SGA V+  GR   + E+    +          A
Sbjct: 1   MELTGKLALITGSTAGIGRETAALMAASGATVVVTGRHQERGEQTVKEITANGGAARFVA 60

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DL D ++L     ++A+  G +DIL+ NA I      + Q  E SF   +S N+ A + 
Sbjct: 61  ADLSDLDSLR----HLAEEVGAVDILVNNAAIFPGAPTVDQDLE-SFEATLSANIRAPFF 115

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           +  +  P +     G  + +S+ AA    P    YSASKAA+E+L RTW+ E     +RV
Sbjct: 116 LTAALAPAMLARGTGAIVNVSTMAARIGMPGLAVYSASKAALESLTRTWAAEFSPAGIRV 175

Query: 194 INIDPGPTRTSMRAKAMPAEDPNT---------VPHPQKVAKIISFLC 232
             + PGPTRT      M  +  +          V  P+++A++I+FL 
Sbjct: 176 NAVAPGPTRTDTVLSVMGEQGADQIGATTLLGRVAAPREIAEVITFLA 223


>gi|292899582|ref|YP_003538951.1| short chain dehydrogenase [Erwinia amylovora ATCC 49946]
 gi|291199430|emb|CBJ46547.1| short chain dehydrogenase [Erwinia amylovora ATCC 49946]
          Length = 255

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 121/241 (50%), Gaps = 8/241 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS---ISQLEKLKNALQKINKKIDIF 72
           L+NR+ LVTG+S GIG   AL  AR GA V+   R+   + Q+ K   A  +  +    F
Sbjct: 10  LNNRIILVTGASDGIGREAALTYARYGAQVVLLARNAEKLLQVSKEVAACSQSQRAALWF 69

Query: 73  AFDLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           A DL  +   N  +L ++ +A +   LD ++ NAG+LG + P+ Q     +  V+ VN+ 
Sbjct: 70  ALDLETATPENCQQLARS-LAGKIPHLDWVLHNAGLLGEVLPMQQQDPAIWQQVMRVNID 128

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             + + ++  P L KS     +  SS    + R  WGAYS SK A E + +  ++E    
Sbjct: 129 GTFFLTQALLPLLLKSPAASLVFTSSSVGRQGRAGWGAYSVSKFATEGMMQVLAQEYDPR 188

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQN 248
            LRV  I+PG TRT MRA A P ED   +  P ++  +  +L     K +TG  F     
Sbjct: 189 QLRVNCINPGGTRTKMRASAFPDEDAAKLKTPAEIMTLYLWLMGDDSKGKTGISFDAQPG 248

Query: 249 R 249
           R
Sbjct: 249 R 249


>gi|298488010|ref|ZP_07006047.1| short-chain dehydrogenase/reductase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157289|gb|EFH98372.1| short-chain dehydrogenase/reductase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 246

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 117/222 (52%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-IFAF 74
           L  R+ LVTG++RGIG   A   A  GA V+  GR+ + L ++ + +Q     +  +  F
Sbjct: 11  LKGRIILVTGAARGIGAAAAKTYAAHGATVLLLGRTEASLAQVHDEIQAAGHLLPLVIPF 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  ++  +     T I ++ G+LD L+ NA I+G  + +  +  + F  V+ VNV A +
Sbjct: 71  NLESTDPAQYHDLATMIERKVGRLDGLLHNASIIGPRTSVEHLPGEDFMQVMHVNVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + ++  P L++S        SS    K R  WGAY  SK A E L +T + E    T++
Sbjct: 131 MLTQALLPLLRRSTDASVAFTSSSVGRKGRAQWGAYGVSKFATEGLMQTLADELEGVTSV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA+A P E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTGMRAQAYPDENPQNNPAPEDIMPVYLYLMG 232


>gi|307323806|ref|ZP_07603015.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
 gi|306890255|gb|EFN21232.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
          Length = 250

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 113/236 (47%), Gaps = 21/236 (8%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            LDN+ ALVTG+S GIG   A   A  GA V   GR  + L+    A+ +I  +      
Sbjct: 3   QLDNKTALVTGASTGIGLAIAHRFAAEGATVYLTGRRKADLDA---AVAQIGSRGTGIQG 59

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+   + L+     I +R G+LDI++ANAG LG   P+ +I E+ +    SVN+      
Sbjct: 60  DVSHLDDLDRLFAEIKERSGRLDIVVANAG-LGDYGPLGKITEEEYERTTSVNLKGTIFT 118

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           ++   P L         +LSS AA +  P  G Y+ASKAAI +LARTW+ E  +  +RV 
Sbjct: 119 VQKALPLLPAGAS--VTLLSSSAALRAAPGLGVYAASKAAIRSLARTWAAELADRRIRVN 176

Query: 195 NIDPGPTRT----SMRAKAMPAEDPN-TVP----------HPQKVAKIISFLCATQ 235
            + PGP  T     +RA     + P  T P           P +VA    +L   Q
Sbjct: 177 ALTPGPVETPGGDELRATFPQGDQPKATEPAAPTPLGRAGRPDEVAATALYLAGDQ 232


>gi|254516395|ref|ZP_05128454.1| oxidoreductase, short chain dehydrogenase/reductase family [gamma
           proteobacterium NOR5-3]
 gi|219674818|gb|EED31185.1| oxidoreductase, short chain dehydrogenase/reductase family [gamma
           proteobacterium NOR5-3]
          Length = 251

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 118/236 (50%), Gaps = 24/236 (10%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  + A+VTG + GIGY TA +L+ SGA V+  GR    LEK  N L      +  F  
Sbjct: 3   DLTGKTAIVTGGNSGIGYATAKKLSESGAKVLITGRREDALEKASNEL-----GVSAFVA 57

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D  D  A +   +Y     G +DIL  NAG+  S +PI Q+ E  F  ++ +N    +  
Sbjct: 58  DQSDLAATDRLASYARTELGPIDILFINAGVF-SAAPIEQLSETQFDAIMDINFKGAFFT 116

Query: 135 MRSFDPWLKKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++   P L+    G ++I LSS  AY   P    Y ASKAA+ +L RT + E     +RV
Sbjct: 117 LQKLLPVLRD---GASVINLSSINAYTGMPNTAVYGASKAALNSLTRTAASELAPRGIRV 173

Query: 194 INIDPGPTRTSMRAKA-MPAED--------PNTVP-----HPQKVAKIISFLCATQ 235
             ++PGP +T +  K+ +P E            +P     + ++VA +++FL + +
Sbjct: 174 NAVNPGPVQTEIFGKSGLPPEAIQEFASALQQRIPLKRFGNAEEVASLVAFLASDE 229


>gi|107102703|ref|ZP_01366621.1| hypothetical protein PaerPA_01003769 [Pseudomonas aeruginosa PACS2]
 gi|116051162|ref|YP_790007.1| short chain dehydrogenase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218890635|ref|YP_002439499.1| short chain dehydrogenase [Pseudomonas aeruginosa LESB58]
 gi|254236135|ref|ZP_04929458.1| hypothetical protein PACG_02099 [Pseudomonas aeruginosa C3719]
 gi|254241861|ref|ZP_04935183.1| hypothetical protein PA2G_02581 [Pseudomonas aeruginosa 2192]
 gi|296388343|ref|ZP_06877818.1| short chain dehydrogenase [Pseudomonas aeruginosa PAb1]
 gi|313108485|ref|ZP_07794489.1| putative oxidoreductase, short-chain dehydrogenase/reductase family
           [Pseudomonas aeruginosa 39016]
 gi|115586383|gb|ABJ12398.1| putative oxidoreductase, short-chain dehydrogenase/reductase family
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168066|gb|EAZ53577.1| hypothetical protein PACG_02099 [Pseudomonas aeruginosa C3719]
 gi|126195239|gb|EAZ59302.1| hypothetical protein PA2G_02581 [Pseudomonas aeruginosa 2192]
 gi|218770858|emb|CAW26623.1| probable short-chain dehydrogenase [Pseudomonas aeruginosa LESB58]
 gi|310880991|gb|EFQ39585.1| putative oxidoreductase, short-chain dehydrogenase/reductase family
           [Pseudomonas aeruginosa 39016]
          Length = 246

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 119/222 (53%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L +R+ LVTG+ RGIG   A   A  GA V+  G++   L ++ +A++   + +  +  F
Sbjct: 11  LKDRVILVTGAGRGIGAAAAKTFAAHGATVLLLGKTEEYLNEVYDAIEAAGHPQAAVIPF 70

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  E     +   +G++D L+ NA ILG  SP+ QI  ++F  V+ VNV A +
Sbjct: 71  NLETAQPHQFEELAATLENEFGRIDGLLHNASILGPRSPMQQISGENFMRVMQVNVNAMF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-AL 191
            +  +  P +K S     I  SS    K R  WGAYS SK A E L +T + E   T A+
Sbjct: 131 MLTTAMLPLMKLSSDASIIFTSSSVGRKGRAYWGAYSVSKFATEGLMQTLADELDGTSAI 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +++PG TRTSMRA A P E+P   P  +++  +  +L  
Sbjct: 191 RANSVNPGATRTSMRALAYPGENPLNNPTGEEIMPVYLYLMG 232


>gi|222150555|ref|YP_002559708.1| hypothetical protein MCCL_0305 [Macrococcus caseolyticus JCSC5402]
 gi|222119677|dbj|BAH17012.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 238

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 108/214 (50%), Gaps = 3/214 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L N+ AL+TG SRGIG   A  LA  G ++   GR+I  LE   ++L + +  +     
Sbjct: 3   SLKNKTALITGGSRGIGLQIAKTLAHEGVHIAITGRNIDHLESAVDSLSQFDIDVTAIVC 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D  + + ++    +  + + ++DILI NAGI+ + S      E+ F  +++VNV   ++ 
Sbjct: 63  DSANKDDIKAAVAHTLETFERIDILINNAGIMHN-SSFLTTTEEEFYKMMAVNVYGPFHF 121

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           M+   P +     G  + +SS +A    P   AYSASK A+  L+    +E     +R  
Sbjct: 122 MQEVLPHMINQQSGDIVNMSSMSAVNAGPTSSAYSASKFALSGLSDGVMREMRQHNIRTF 181

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKII 228
            I P    T +  +   + DP ++ HP+ +A+II
Sbjct: 182 LIHPSAVLTDLIGEV--SLDPESMTHPEDIAEII 213


>gi|91218424|ref|ZP_01255366.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Psychroflexus torquis ATCC 700755]
 gi|91183415|gb|EAS69816.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Psychroflexus torquis ATCC 700755]
          Length = 269

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 120/233 (51%), Gaps = 24/233 (10%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++A+VTG + GIGY +A E    GA V+  GR     EK+  A Q++  K  I A D
Sbjct: 22  LNGKIAVVTGGNSGIGYASAKEFKSQGATVVITGR---DSEKVAKASQELGVK-GIVA-D 76

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           ++  +A++     +   +GK+D+L  NAGI    +P+ QI E+ F   +S+N    +   
Sbjct: 77  VKSLSAIDDLVAQVKSDFGKVDVLFVNAGIF-QPAPVGQISEEMFDHQMSINFKGAFFTT 135

Query: 136 RSFDPWLKKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
             F P L   + G ++I LSS  AY   P    Y+ASKAA+ A  RT + E     +R+ 
Sbjct: 136 EKFLPIL---NDGASVINLSSVNAYTGMPNTAVYAASKAALNAYTRTAATELAPRKIRIN 192

Query: 195 NIDPGPTRTSMRAKAMPAED---------PNTVP-----HPQKVAKIISFLCA 233
           +++PGP  T +  K    E+          N +P      P+ +AK++SFL +
Sbjct: 193 SVNPGPVSTPIYGKTGMEEEQLNGFAEAMQNRIPLKRFGQPEDIAKLVSFLAS 245


>gi|331016836|gb|EGH96892.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 246

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 103/193 (53%), Gaps = 4/193 (2%)

Query: 45  VIACGRSISQLEKLKNALQKINK-KIDIFAFDLRDSNALELTK--TYIAKRWGKLDILIA 101
           V+  GR+ + L ++ + ++   + +  I A +L ++ A +  +    +   +G+LD L+ 
Sbjct: 40  VVLLGRTEASLAEVSDQIKSAGQPQPLIIALNLENATARQYRELAARVEHEFGRLDGLLH 99

Query: 102 NAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC 161
           NA I+G  +P+ Q+ ++ F  V+ VNV A + + R+  P LK+S        SS      
Sbjct: 100 NASIIGPRTPLEQLPDEDFMQVMHVNVNATFMLTRALLPLLKRSEDASIAFTSSSVGRNG 159

Query: 162 RPLWGAYSASKAAIEALARTWSKETVN-TALRVINIDPGPTRTSMRAKAMPAEDPNTVPH 220
           R  WGAY  SK A E L +T + E    TA+R  +I+PG TRT MRA+A P E+P   P 
Sbjct: 160 RANWGAYGVSKFATEGLMQTLADELEGVTAVRANSINPGATRTGMRAQAYPDENPLNNPA 219

Query: 221 PQKVAKIISFLCA 233
           P+ +  +  +L  
Sbjct: 220 PEDIMPVYLYLMG 232


>gi|89098837|ref|ZP_01171718.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Bacillus sp. NRRL
           B-14911]
 gi|89086513|gb|EAR65633.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Bacillus sp. NRRL
           B-14911]
          Length = 238

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 115/224 (51%), Gaps = 5/224 (2%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  + AL+TG+ RGIG   A+  A+ G  V   GR++S LEK    L++ + K+   A 
Sbjct: 3   SLKGKTALITGAGRGIGRAAAIAFAKEGISVGLLGRTLSNLEKAAEELKEYDVKVSYAAA 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D++DS+++      I    G++DILI NAGI        ++  + + D+I VN+M  +++
Sbjct: 63  DVQDSDSVNKAVEKITSELGQIDILINNAGI-AKFGGFLELSPQEWEDIIQVNLMGVYHV 121

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R+  P + +   G  I +SS A  K  P+  AYSASK A+  L  +   E     +RV 
Sbjct: 122 TRAVLPGMIERKSGDIINISSTAGQKGAPVTSAYSASKFAVLGLTESLMLEVRKHNIRVS 181

Query: 195 NIDPGPTRTSMRAKA-MPAEDPNTVPHPQKVAKIISFLCATQKI 237
            + P    T +  +  +   +P  V  P+ +A+   ++ A  K+
Sbjct: 182 ALTPSTVATDLAIETNLTDGNPEKVMQPEDLAE---YMVAQLKL 222


>gi|15598369|ref|NP_251863.1| short chain dehydrogenase [Pseudomonas aeruginosa PAO1]
 gi|9949290|gb|AAG06561.1|AE004741_6 probable short-chain dehydrogenase [Pseudomonas aeruginosa PAO1]
          Length = 246

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 118/222 (53%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L +R+ LVTG+ RGIG   A   A  GA V+  G++   L ++ +A++   + +  +  F
Sbjct: 11  LKDRVILVTGAGRGIGAAAAKTFAAHGATVLLLGKTEEYLNEVYDAIEAAGHPQAAVIPF 70

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  E     +   +G +D L+ NA ILG  SP+ QI  ++F  V+ VNV A +
Sbjct: 71  NLETAQPHQFEELAATLENEFGHIDGLLHNASILGPRSPMQQISGENFMRVMQVNVNAMF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-AL 191
            +  +  P +K S     I  SS    K R  WGAYS SK A E L +T + E   T A+
Sbjct: 131 MLTTAMLPLMKLSSDASIIFTSSSVGRKGRAYWGAYSVSKFATEGLMQTLADELDGTSAI 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +++PG TRTSMRA A P E+P   P  +++  +  +L  
Sbjct: 191 RANSVNPGATRTSMRALAYPGENPLNNPTGEEIMPVYLYLMG 232


>gi|254221140|pdb|3I1J|A Chain A, Structure Of A Putative Short Chain Dehydrogenase From
           Pseudomonas Syringae
 gi|254221141|pdb|3I1J|B Chain B, Structure Of A Putative Short Chain Dehydrogenase From
           Pseudomonas Syringae
          Length = 247

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 101/191 (52%), Gaps = 4/191 (2%)

Query: 45  VIACGRSISQLEKLKNALQKINKKID-IFAFDLRDSNALELTK--TYIAKRWGKLDILIA 101
           V+  GR+ + L ++ + ++   +    I A +L ++ A +  +    +   +G+LD L+ 
Sbjct: 41  VVLLGRTEASLAEVSDQIKSAGQPQPLIIALNLENATAQQYRELAARVEHEFGRLDGLLH 100

Query: 102 NAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC 161
           NA I+G  +P+ Q+ ++ F  V  VNV A + + R+  P LK+S        SS    K 
Sbjct: 101 NASIIGPRTPLEQLPDEDFXQVXHVNVNATFXLTRALLPLLKRSEDASIAFTSSSVGRKG 160

Query: 162 RPLWGAYSASKAAIEALARTWSKETVN-TALRVINIDPGPTRTSMRAKAMPAEDPNTVPH 220
           R  WGAY  SK A E L +T + E    TA+R  +I+PG TRT  RA+A P E+P   P 
Sbjct: 161 RANWGAYGVSKFATEGLXQTLADELEGVTAVRANSINPGATRTGXRAQAYPDENPLNNPA 220

Query: 221 PQKVAKIISFL 231
           P+ +  +  +L
Sbjct: 221 PEDIXPVYLYL 231


>gi|238757072|ref|ZP_04618260.1| Uncharacterized oxidoreductase yciK [Yersinia aldovae ATCC 35236]
 gi|238704902|gb|EEP97431.1| Uncharacterized oxidoreductase yciK [Yersinia aldovae ATCC 35236]
          Length = 253

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 120/242 (49%), Gaps = 6/242 (2%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI- 71
           H  LD R+ LVTG+  GIG   A+  AR GA +I  GR+ S+L  ++  +        I 
Sbjct: 7   HDLLDQRIILVTGAGDGIGREAAVTYARFGARLILVGRTESKLIAVQQQISDAGGPAAIV 66

Query: 72  FAFDLRDSNAL---ELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
              DL  + +L   +L  T  A+    LD ++ NAG+LG I P+ +     +  V+ VNV
Sbjct: 67  LPLDLSHATSLSCQQLADTLNAQ-VPCLDGVLHNAGLLGYIVPMAEQNIAVWQQVMQVNV 125

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A + + ++  P L KSH    +  SS    + R  WGAY+ SK A E + +  ++E   
Sbjct: 126 NATFMLTQALLPLLLKSHDASLVFTSSSVGRQGRSGWGAYAVSKFATEGMMQVLAEEYKQ 185

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQ 247
           + LRV  I+PG TRT MRA A P E  + +  P  +  +  +L     + +TG  F    
Sbjct: 186 SNLRVNCINPGGTRTQMRASAFPNEASDKLKTPADIMPLYLYLMGDDSRRKTGISFDAQP 245

Query: 248 NR 249
            R
Sbjct: 246 GR 247


>gi|209542679|ref|YP_002274908.1| short-chain dehydrogenase/reductase SDR [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530356|gb|ACI50293.1| short-chain dehydrogenase/reductase SDR [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 250

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 108/215 (50%), Gaps = 16/215 (7%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           N   R+ALVTG+ RGIG  TA +LAR G +V+  GR   Q + + + L+      +    
Sbjct: 4   NETRRVALVTGAVRGIGLETARQLARQGIHVLVAGRRQEQADGVADRLRGEGLSAEGVVL 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGIL------GSISPIWQIKEKSFADVISVNV 128
           D+ +       + YIA  +G+LDIL+ NAG+L      G+  P     +K+  D   +N+
Sbjct: 64  DIDNPAQQTALRDYIATTYGRLDILVNNAGVLLDRGADGAAPPPSATPDKTLRDTFEINL 123

Query: 129 MANWNIMRSFDPWLKKSHCGRAI----ILSSGAAYK--CRPLWG----AYSASKAAIEAL 178
            A   + ++  P + KS  GR +    IL+S  A+     P++G    AY ASK A+ A 
Sbjct: 124 FATVQVTQTLLPLVLKSPAGRIVNLSSILASLGAHSDPASPIYGKLTFAYDASKTALNAF 183

Query: 179 ARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAE 213
               + E  +TA++V +  PG  RT M  +  P +
Sbjct: 184 TVHLAHELKDTAVKVNSAHPGWVRTDMGGQDAPLD 218


>gi|326331351|ref|ZP_08197641.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Nocardioidaceae bacterium Broad-1]
 gi|325950607|gb|EGD42657.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Nocardioidaceae bacterium Broad-1]
          Length = 232

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 116/219 (52%), Gaps = 10/219 (4%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           N +A++TG S G+G   A  L  SG  V+   R     ++L  AL   + ++   A D+R
Sbjct: 6   NHVAVITGGSAGLGLALATALLESGWSVVTDAR---HADRLHAALPD-SARVTTLAGDVR 61

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D +  +     +A R G+LD+L+ NA  LG + P+ ++ E  F+ V+  N++A   + + 
Sbjct: 62  DRDHQDAIAAAVA-RHGRLDLLVHNASELGPMLPLAEVPESLFSQVLETNLLAPLALTQR 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P+L  S  G  + +SS AA +  P WG Y+ASKAA++ L  T  +E     +R   +D
Sbjct: 121 LLPYLIASR-GTLVGISSDAAVEHYPTWGTYAASKAALDHLVLTLGEE---NGVRAYAVD 176

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVA-KIISFLCATQ 235
           PG  RT+M   A P ED +  P P+ V   +++ L  TQ
Sbjct: 177 PGDMRTAMHQAAFPGEDISDRPLPESVVPHLLALLTGTQ 215


>gi|32475156|ref|NP_868150.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Rhodopirellula baltica
           SH 1]
 gi|32445697|emb|CAD78428.1| putative short chain dehydrogenase [Rhodopirellula baltica SH 1]
          Length = 245

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 117/230 (50%), Gaps = 13/230 (5%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSG-AYVIACGRSISQLEKLKNALQKINKKIDIF 72
           +N +NR+A+VTG SRGIG   A  LA  G + VI    S    ++L   + +       F
Sbjct: 1   MNNNNRVAIVTGGSRGIGAAIAERLASDGFSVVINYANSSKAADELTQRITEAGGSAQSF 60

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+ DS+A+E    +  + +G +D+L+ NAG+L  + P+ +  ++ FA ++ VN+   +
Sbjct: 61  QADVSDSDAVEKLFDFATESFGGVDVLVNNAGVL-KMQPLAETSDEDFARLVDVNLKGCF 119

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           + MR     L+    GR I LSS       P +G YSA+KAA+EA++   + E     + 
Sbjct: 120 HTMREAACRLRDG--GRVINLSSSVIGLRMPNYGVYSATKAAVEAMSSVLANELRGRQIT 177

Query: 193 VINIDPGPTRTSM----RAKAMPAEDPNTVP-----HPQKVAKIISFLCA 233
           V ++ PGPT T +    ++  +     N  P      P  +A ++SFL  
Sbjct: 178 VNSVAPGPTATKLFLDDKSDELIDRLTNMSPLERLGQPDDIASVVSFLAG 227


>gi|254443755|ref|ZP_05057231.1| KR domain superfamily [Verrucomicrobiae bacterium DG1235]
 gi|198258063|gb|EDY82371.1| KR domain superfamily [Verrucomicrobiae bacterium DG1235]
          Length = 247

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 116/228 (50%), Gaps = 17/228 (7%)

Query: 18  NRLALVTGSSRGIGYYTALELARSG-AYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           N++A+VTG+SRGIG   AL LAR G A  +   RS  + E + + ++    +   FA   
Sbjct: 7   NKVAIVTGASRGIGRAIALRLARDGMAVAVNYARSAEEAESVVDEIKAAGGRA--FAIQA 64

Query: 77  RDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
             +   E+T+ +     R+GK+D+L+ NAGIL +  P+  + E+ F  + +VNV   +  
Sbjct: 65  DVARVSEVTRLFDETIARYGKVDVLVNNAGILFN-KPVAAVTEEEFDRIFAVNVKGTFFA 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            +     L+ S  GR I LSS       P +GAY A+K A+E L RT SKE  +  + V 
Sbjct: 124 CQ--QAALRLSDGGRIINLSSTTTAVMLPTYGAYVATKGAVEQLTRTLSKELGSRGITVN 181

Query: 195 NIDPGPTRT---------SMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            + PGPT T          M  +       N +  P+++A+ I+FL  
Sbjct: 182 AVSPGPTDTELFKLGKSPEMIQRLANGAAFNRLGTPEEIAEAIAFLAG 229


>gi|330960551|gb|EGH60811.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 246

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 116/222 (52%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L +R+ LVTG+ RGIG   A   A  GA V+  G++ + L ++++ +     ++  +  F
Sbjct: 11  LADRIILVTGAGRGIGAAAARNYAALGATVLLLGKTEANLARVRDQIVAAGQRQPKVIPF 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +      +  T I   +G+LD L+ NA I+G  +P+ Q+  + F  V+ +NV A +
Sbjct: 71  DLESAGPARYDELATLIDSEFGRLDGLLHNASIIGPRTPLEQLSGEDFMQVMHINVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            +  +  P LK+S        SS    K R  WGAY  SK A E L +T + E  + T +
Sbjct: 131 ILTHALLPLLKRSADASIAFTSSSVGRKGRAQWGAYGVSKFATEGLMQTLADELQDVTTV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA A P E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTDMRALAYPNENPLNNPTPEDIMPVYLYLMG 232


>gi|15644471|ref|NP_229523.1| 3-oxoacyl-(acyl carrier protein) reductase [Thermotoga maritima
           MSB8]
 gi|6919838|sp|Q9X248|FABG_THEMA RecName: Full=3-oxoacyl-[acyl-carrier-protein] reductase; AltName:
           Full=3-ketoacyl-acyl carrier protein reductase
 gi|4982301|gb|AAD36790.1|AE001811_10 3-oxoacyl-(acyl carrier protein) reductase [Thermotoga maritima
           MSB8]
          Length = 246

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 122/229 (53%), Gaps = 11/229 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++ L+TG++ GIG  T L  A+ GA VIA   S   L+ L    + +  K+D +  +
Sbjct: 3   LEGKVCLITGAASGIGKATTLLFAQEGATVIAGDISKENLDSLVKEAEGLPGKVDPYVLN 62

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D + ++     + +++G++D+L+ NAGI    + + ++KE+ +  VI+VN+   +N+ 
Sbjct: 63  VTDRDQIKEVVEKVVQKYGRIDVLVNNAGITRD-ALLVRMKEEDWDAVINVNLKGVFNVT 121

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P++ K   G  + +SS       P    Y+ASKA +  + +TW+KE     +RV  
Sbjct: 122 QMVVPYMIKQRNGSIVNVSSVVGIYGNPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNA 181

Query: 196 IDPGPTRTSMRAKAMPAEDPNT----VP-----HPQKVAKIISFLCATQ 235
           + PG   T M  K +P +   T    +P      P++VA++I FL + +
Sbjct: 182 VAPGFIETPMTEK-LPEKARETALSRIPLGRFGKPEEVAQVILFLASDE 229


>gi|331695035|ref|YP_004331274.1| short-chain dehydrogenase/reductase SDR [Pseudonocardia
           dioxanivorans CB1190]
 gi|326949724|gb|AEA23421.1| short-chain dehydrogenase/reductase SDR [Pseudonocardia
           dioxanivorans CB1190]
          Length = 233

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 108/225 (48%), Gaps = 11/225 (4%)

Query: 21  ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSN 80
           ALVTG++RG G      L   G  V+  GR  + L      L      + +   DL D  
Sbjct: 5   ALVTGAARGFGLALTAALVARGDTVVVDGRDAAALAAATADLPGPGTVVAVPG-DLTD-- 61

Query: 81  ALELTKTYIA-KRWGKLDILIANAGILGSISPIWQIKE---KSFADVISVNVMANWNIMR 136
           A      ++A +R G LD+L+ NAG LG  SP+ ++ E    +FAD+   NV A   + R
Sbjct: 62  AAHRGALHVAVRRAGGLDLLVHNAGTLGP-SPLPRLAELAPHAFADLWETNVAAPLALTR 120

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
              P+L+    G  + LSS AA +  P WG Y A+KAA++ LA     E     LRV   
Sbjct: 121 LLLPFLRTGPAGTVVTLSSDAAVEAYPGWGGYGATKAALDQLAAVLGAE--EPGLRVYAF 178

Query: 197 DPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGK 241
           DPG  RT M  +A P ED +  P P  V   +  L   Q+  +G+
Sbjct: 179 DPGDMRTDMHQRAFPGEDISDRPEPATVVPALLGLL-RQRPPSGR 222


>gi|99082477|ref|YP_614631.1| short-chain dehydrogenase/reductase SDR [Ruegeria sp. TM1040]
 gi|99038757|gb|ABF65369.1| short-chain dehydrogenase/reductase SDR [Ruegeria sp. TM1040]
          Length = 249

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 97/189 (51%), Gaps = 3/189 (1%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           N+  +++G+SRGIG   A E A  GA V+   RS   LE L    Q+I +K    A D+ 
Sbjct: 5   NKTIVISGASRGIGASAAKEFAAEGANVVLLARSADALEALA---QEIGEKALALACDVA 61

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D  A+E T       +G LD+LI NAG++  I+ + +     +A +I+VN+   +N+MR+
Sbjct: 62  DYAAVEATFARARDHFGSLDVLICNAGMIDPIARLEEADPAGWAQLINVNITGVFNMMRA 121

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P LK +  G  + + SGA+ +    W AY  SKA    L      E     +RV+ + 
Sbjct: 122 GLPHLKAAGGGAVLTIGSGASQRPLEGWSAYCTSKAGAAMLTEALHLEEGENGIRVMGLS 181

Query: 198 PGPTRTSMR 206
           PG   T M+
Sbjct: 182 PGTVATQMQ 190


>gi|254491278|ref|ZP_05104459.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Methylophaga thiooxidans DMS010]
 gi|224463791|gb|EEF80059.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Methylophaga thiooxydans DMS010]
          Length = 237

 Score =  104 bits (260), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 120/229 (52%), Gaps = 7/229 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L++R+ L+TG++RGIG   A   A +GA VI   + I  LE + + +++  N    I+  
Sbjct: 10  LNDRIILITGAARGIGASVARSCAANGATVILLDKQIKLLETVYDQIEQAGNPTPAIYPL 69

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL+ ++  +  +  T I   +G+LD ++  A  LG ++P+     K++ + + +N+ A  
Sbjct: 70  DLKGASEPDYQQLATTITDNFGRLDAVVHCAATLGQLAPVEHQDTKTWLETLHINLTAAV 129

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE-TVNTAL 191
            + ++  P LK+    + I  +   ++     WGAY  SKAAIEA A     E      +
Sbjct: 130 LLSKACLPLLKQQQSSQLIFTTDTHSHTA--YWGAYGISKAAIEAFAAQLRDELEAQGRV 187

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVA-KIISFLCATQKIET 239
            V  ++PG  +T + A+A PA DP+ +P    +A + ++ LC +   +T
Sbjct: 188 AVHCVNPGTVKTELFARAFPATDPSALPEADDIAPQYLALLCESDHRQT 236


>gi|119505053|ref|ZP_01627129.1| ATPase FliI/YscN [marine gamma proteobacterium HTCC2080]
 gi|119459035|gb|EAW40134.1| ATPase FliI/YscN [marine gamma proteobacterium HTCC2080]
          Length = 251

 Score =  104 bits (260), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 106/213 (49%), Gaps = 4/213 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI-DIFAF 74
           L  +  LVTG+  GIG   AL  AR GA V+  GR+ ++LE + + +      +  I   
Sbjct: 15  LAGKTILVTGAGDGIGKAAALTFARHGAEVLLLGRTEAKLEAVYDTIVTEGGALPGIIPT 74

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +   +L      +A    KLD L+ NA +LG   P+ Q     +  V+ VNV + +
Sbjct: 75  DLAKAGHDDLVALAAELATSIPKLDGLLHNASLLGDRKPLAQTSAALWHQVMQVNVNSAF 134

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + ++  P L+ +     +  SSG   K R  WG Y+ SK A E L +  + E    + +
Sbjct: 135 MLTQALLPMLELAPLASVVFTSSGVGRKGRAFWGGYAVSKFATEGLMQVLADELGGISNI 194

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKV 224
           RV +++PG   T+MR  A PAE PNT P P  +
Sbjct: 195 RVNSLNPGAVNTAMRRTAYPAEPPNTNPDPDAL 227


>gi|307326993|ref|ZP_07606183.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
 gi|306887291|gb|EFN18287.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
          Length = 254

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 102/197 (51%), Gaps = 10/197 (5%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  R+ +VTG+  GIG  TA   A++GA V+  GR I  LE+        +  I   + 
Sbjct: 8   DLAERVVIVTGAGSGIGRATARAFAQAGARVLGVGRRIDALEETAAG----HPAIVAHSA 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL    A E        RWG++D+L+ NAG    I P+    +++  D+  +NV+A   +
Sbjct: 64  DLSGPGAPEEVVNAAVDRWGQVDVLVNNAGAT-KIMPLADTTDRAITDLFGLNVVAPSLL 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA--YSASKAAIEALARTWSKETVNTALR 192
            R   P L++S   R  I++  + Y  RPL G   Y+ASKAA+E L R+W+ E     +R
Sbjct: 123 AREALPHLRRS---RGSIVNISSTYGHRPLPGGAHYAASKAALEQLTRSWAVELAADGIR 179

Query: 193 VINIDPGPTRTSMRAKA 209
           V  + PGPT +   A A
Sbjct: 180 VNALAPGPTESQALAAA 196


>gi|84515505|ref|ZP_01002867.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Loktanella vestfoldensis SKA53]
 gi|84510788|gb|EAQ07243.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Loktanella vestfoldensis SKA53]
          Length = 214

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 105/204 (51%), Gaps = 5/204 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            ++ L+TG+SRG+G   A +LA +  ++IA  +++  LE+L +A+Q       +   D+ 
Sbjct: 2   TQIVLITGASRGLGAALARQLAPT-HHIIAVAKTVGALEELDDAVQAAGGAATLAPMDIT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
              A++     I  RWGKLD+ +  A     ++P   I  K     ++ NV A   ++  
Sbjct: 61  VDAAMQQLCRGIFDRWGKLDMWLHTAVHAAPLAPAGHIGPKDLTKSMTFNVEATARLIAY 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L ++  G+A+          +  +GAY A+KAA  ALAR+W  ETV T  RV  + 
Sbjct: 121 VSPLLGQT--GKAVFFDD--PRGGQQFFGAYGATKAAQIALARSWQAETVKTGPRVQILT 176

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHP 221
           P P  T+ RA+  P ED +T+  P
Sbjct: 177 PAPMPTATRARFYPGEDRSTLTEP 200


>gi|311029214|ref|ZP_07707304.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Bacillus sp. m3-13]
          Length = 239

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 110/216 (50%), Gaps = 2/216 (0%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L+ + A+VTG+ RGIG  TA+ LA+ G ++   G ++S LEK+   LQ+ + K+    
Sbjct: 2   ISLNGKTAIVTGAGRGIGRATAIALAKEGVHLGLIGLNMSNLEKVAAELQQFDVKVSAAT 61

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ D  ++     +I    G +DILI NAG+         +  + +  +I VN+M  +N
Sbjct: 62  ADVTDLESVTHAVEHIKSDLGPIDILINNAGV-AKFGGFLDLTPEEWEKIIQVNLMGVYN 120

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + R+  P + +   G  I +SS A  K  P+  AYSASK A+  L  +   E     +RV
Sbjct: 121 VTRAVLPGMIERKSGDIINISSSAGQKGAPVTSAYSASKFAVLGLTESLMLEVRKHNVRV 180

Query: 194 INIDPGPTRTSMRAKA-MPAEDPNTVPHPQKVAKII 228
             + P    T +     +   +   V HP+ +A+++
Sbjct: 181 TALTPSTVVTDLAIDTNLVKGNEENVMHPEDLAELV 216


>gi|325276962|ref|ZP_08142643.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas sp.
           TJI-51]
 gi|324097904|gb|EGB96069.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas sp.
           TJI-51]
          Length = 246

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 3/166 (1%)

Query: 71  IFAFDLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           +  F+L  + A E       I +++G+LD L+ NA I+G  +P+ Q+    F  V+ +NV
Sbjct: 67  VVPFNLETAQAHEYDDLAVMIEEQFGRLDGLLNNASIIGPRTPLEQLSGDHFMRVMHINV 126

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A + +  +  P LK S     +  SS    K R  WGAY  SK A E L +T + E   
Sbjct: 127 NATFMLTSTLLPLLKLSEDASVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADELEG 186

Query: 189 TA-LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            A +R  +I+PG TRT+MRA+A P E+P   P P+++  +  +L  
Sbjct: 187 VAPVRANSINPGATRTAMRAQAYPGENPQNNPLPEEIMPVYLYLMG 232


>gi|256424495|ref|YP_003125148.1| short-chain dehydrogenase/reductase SDR [Chitinophaga pinensis DSM
           2588]
 gi|256039403|gb|ACU62947.1| short-chain dehydrogenase/reductase SDR [Chitinophaga pinensis DSM
           2588]
          Length = 260

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 116/237 (48%), Gaps = 1/237 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++ALV+G + GIG+ TA     +GA V+  GR   Q E     L++I+  I     D
Sbjct: 6   LKGKVALVSGGATGIGFATAKLYLENGAKVVIAGRRQEQGETALATLRQISPDITFIQAD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW-NI 134
           +  +  ++   +   +  G LDI   NAGI G+ +PI  + E+ F  +I +N+   W + 
Sbjct: 66  VSKAADVKRLISETVRIHGSLDIAFNNAGIEGNFAPIDDMSEEDFDAIIDINLKGIWLSC 125

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
               + + K+   G  +  SS  +    P  GAYSASKAA++AL R  + ET +  +RV 
Sbjct: 126 KHEIEQFRKQGSGGVIVNTSSWLSVGAFPGSGAYSASKAALDALTRVLAVETASANIRVN 185

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFV 251
           N+ PG  +T M  +  PA D       +K A I  F  + +  E     S P + F+
Sbjct: 186 NVRPGYIQTPMFDRFFPAGDEAKKEPVKKQAPIGRFAASAEIGELVLWLSSPASSFI 242


>gi|114320066|ref|YP_741749.1| short-chain dehydrogenase/reductase SDR [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226460|gb|ABI56259.1| short-chain dehydrogenase/reductase SDR [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 252

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 115/218 (52%), Gaps = 4/218 (1%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAFDL 76
           +R+ LVTG+  GIG     +LA +GA V+A  + +  LE+L + L Q+   +  ++  +L
Sbjct: 18  DRIILVTGACGGIGGAVCRQLAEAGATVVALDKDMKSLERLYDDLAQRGPAEPALYPMNL 77

Query: 77  RDSNALEL--TKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
             ++  +    +  + + +G+LD L+  A +LG  +P+     +++   + +N+ A + +
Sbjct: 78  EGASTADYDDMRVRLEENFGRLDGLLHCAAMLGRPAPVEIYDMEAWFRTVHLNLHAPFLV 137

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRV 193
            R+  P L++S     +  S+    +  P  GAY  S A +E L R  + E  +T  +RV
Sbjct: 138 TRACLPLLRQSPAASIVFTSAREGREQMPYAGAYGVSAAGVEGLMRILAAELADTTPVRV 197

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
            ++DPG  RT MR +A P ED   +P P +VA    +L
Sbjct: 198 NSLDPGAVRTRMRYQAYPGEDQEKLPTPDQVAGAFVWL 235


>gi|329894509|ref|ZP_08270323.1| ATPase FliI/YscN [gamma proteobacterium IMCC3088]
 gi|328923034|gb|EGG30359.1| ATPase FliI/YscN [gamma proteobacterium IMCC3088]
          Length = 250

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 116/234 (49%), Gaps = 11/234 (4%)

Query: 8   NNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL----- 62
           NN++  V+L +++ L+TG+  GIG   AL  AR+GA V+  GR    L  + + +     
Sbjct: 9   NNAD--VSLRDKVILITGAGAGIGEQLALGAARAGAIVLLLGRREDALNAVYDQIMSEGL 66

Query: 63  -QKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFA 121
            + +   +D+   D + +N L      I   +G+LD L+ NA +LG + PI       ++
Sbjct: 67  AEPVVIPMDLGTLDEQQANQL---SHMIGDAFGRLDGLVHNASLLGKLGPIATANLSEWS 123

Query: 122 DVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALART 181
            V++VN  A   + ++  P L +S     I  SSG   + R  WGAYSASK A EA++  
Sbjct: 124 QVMTVNAFAPVVLTKALLPLLSESQSASIIFTSSGVGRQARAFWGAYSASKFATEAISGI 183

Query: 182 WSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
            + E     +RV  ++PG T T MR  A P E P ++     +     FL +  
Sbjct: 184 LAAELETDGIRVNCVNPGATNTKMRRAAFPGESPESIASAASLVPAYVFLLSEH 237


>gi|146306874|ref|YP_001187339.1| short chain dehydrogenase [Pseudomonas mendocina ymp]
 gi|145575075|gb|ABP84607.1| short-chain dehydrogenase/reductase SDR [Pseudomonas mendocina ymp]
          Length = 259

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 119/222 (53%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L +R+ L+TG+ RGIG   A   A  GA V+  G++ + L ++ + ++   + +  +  F
Sbjct: 24  LKDRVILITGAGRGIGAAAAKSFAAHGATVLLLGKTEANLSQVYDEIEAAGHPQPVVIPF 83

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  +     I   +G+LD L+ NA ILG  +P+ Q+   +F  V+ VNV A +
Sbjct: 84  NLETALPHQYDELAVMIENEFGRLDGLLHNASILGPRTPLEQLSGDNFMRVMHVNVNAMF 143

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            +  +  P LK S     +  SS    K R  WGAY+ SK A E L +  + E    + +
Sbjct: 144 MLSSTLLPLLKLSQDASVVFTSSSVGRKGRAYWGAYAVSKFATEGLMQVMADELDGISNV 203

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +++PG TRT+MRA+A P E+P T P P+++  +  +L  
Sbjct: 204 RANSVNPGATRTAMRAQAYPGENPATRPAPEEIMPVYLYLMG 245


>gi|153954150|ref|YP_001394915.1| nonribosomal peptide synthetase [Clostridium kluyveri DSM 555]
 gi|146347031|gb|EDK33567.1| Predicted nonribosomal peptide synthetase [Clostridium kluyveri DSM
            555]
          Length = 1895

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 110/220 (50%), Gaps = 5/220 (2%)

Query: 16   LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
            L N+  +VTG  RGIG   A+E+A+ GA +    R+  +LE+    ++ I  K+     D
Sbjct: 1646 LSNKSVIVTGGGRGIGKTIAIEMAKEGAEIAIISRTAGELEETAAEIKGIGSKVMTITTD 1705

Query: 76   LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
            +   N +      I   +GK+D+L+ NAGI   ++P   IKE+ +  ++ VN+   +N+ 
Sbjct: 1706 ISSYNDICDAVKKIVSEFGKIDVLVNNAGIT-KMAPFTDIKEEEWKRIVEVNLFGTYNLC 1764

Query: 136  RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
                P   K   G+ I L S +++   PL  AYSASK  I  L ++ ++E   + ++V  
Sbjct: 1765 YLTIPHFVKQKSGKIINLGSDSSFIGYPLMSAYSASKHGIIGLTKSLAEEFKASNIQVNA 1824

Query: 196  IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
            I P    T+M     P         P+KVA ++ FL + +
Sbjct: 1825 ICPAMVDTNM----APGAFKKNAMSPKKVADLVLFLSSNK 1860


>gi|219854760|ref|YP_002471882.1| hypothetical protein CKR_1417 [Clostridium kluyveri NBRC 12016]
 gi|219568484|dbj|BAH06468.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 1901

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 110/220 (50%), Gaps = 5/220 (2%)

Query: 16   LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
            L N+  +VTG  RGIG   A+E+A+ GA +    R+  +LE+    ++ I  K+     D
Sbjct: 1652 LSNKSVIVTGGGRGIGKTIAIEMAKEGAEIAIISRTAGELEETAAEIKGIGSKVMTITTD 1711

Query: 76   LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
            +   N +      I   +GK+D+L+ NAGI   ++P   IKE+ +  ++ VN+   +N+ 
Sbjct: 1712 ISSYNDICDAVKKIVSEFGKIDVLVNNAGIT-KMAPFTDIKEEEWKRIVEVNLFGTYNLC 1770

Query: 136  RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
                P   K   G+ I L S +++   PL  AYSASK  I  L ++ ++E   + ++V  
Sbjct: 1771 YLTIPHFVKQKSGKIINLGSDSSFIGYPLMSAYSASKHGIIGLTKSLAEEFKASNIQVNA 1830

Query: 196  IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
            I P    T+M     P         P+KVA ++ FL + +
Sbjct: 1831 ICPAMVDTNM----APGAFKKNAMSPKKVADLVLFLSSNK 1866


>gi|269968049|ref|ZP_06182086.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269827295|gb|EEZ81592.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 251

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 116/231 (50%), Gaps = 14/231 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           +  ++A ++G++ GIG+  A  L + G  VI  G    +  +  + L     + + + FD
Sbjct: 1   MSTKIAFISGATGGIGFQVAKRLGQDGYTVILNGIEDEKGSECISKLHNAGIEAEYYGFD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D +A++     I +++GK+D+++ NAG LG  SPI  ++   F  V+++N+ + + + 
Sbjct: 61  VTDEHAVDENINAIGEKYGKIDVVVNNAGGLGGRSPIEGMETDFFRKVMALNLDSAFFVS 120

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKC-RPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           R+  P+L+KS     I  +S AA+    P  G Y  SKAA+  L R  +KE     +RV 
Sbjct: 121 RAAIPFLRKSDNASIINFTSNAAWNAGGPGAGIYGTSKAAVHTLTRALAKELAPAGIRVN 180

Query: 195 NIDPGPTRTSMRAKAMPAEDPNT------------VPHPQKVAKIISFLCA 233
            + PG   T   A+ + A  P              +  P++VA  ISFL +
Sbjct: 181 AVSPGTIDTPFHAQ-IKATKPEVFASWADSIMLGRLGKPEEVASAISFLVS 230


>gi|126724371|ref|ZP_01740214.1| 20-beta-hydroxysteroid dehydrogenase, putative [Rhodobacterales
           bacterium HTCC2150]
 gi|126705535|gb|EBA04625.1| 20-beta-hydroxysteroid dehydrogenase, putative [Rhodobacterales
           bacterium HTCC2150]
          Length = 257

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 108/227 (47%), Gaps = 12/227 (5%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           N+  ++  +TG+SRGIG  +A E  + GA V+   RS S++  + N L      I +   
Sbjct: 10  NMQGKVVFITGASRGIGAASAREFVKEGAKVVLAARSASEITAIANELGDAALAIPL--- 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ D +A           +G LD+LI NAG +  IS +       +   I +NV   +N 
Sbjct: 67  DVADYSAFAAAFEQTVAHFGALDVLINNAGTIEPISLMASSDPDDWGRAIDINVKGVYNG 126

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           MR+  P ++ +  G  + + SGAA+     W  Y ASKAA+  L +   KE     +R I
Sbjct: 127 MRAAMPIMQGNGGGSILTIGSGAAHNALEGWSHYCASKAAVFMLNQCAHKEGAGKGIRAI 186

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPH--------PQKVAKIISFLCA 233
           N+ PG   T M+ + + A   N V          P+ VA+ + ++C 
Sbjct: 187 NLSPGTVATQMQVE-IKASGINPVSQMEMSDHIAPEWVARTLVWMCG 232


>gi|170288901|ref|YP_001739139.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Thermotoga sp. RQ2]
 gi|170176404|gb|ACB09456.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Thermotoga sp. RQ2]
          Length = 246

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 118/228 (51%), Gaps = 9/228 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++ L+TG++ GIG  T L  A+ GA VIA   S   L+ L    + +  K+D +  +
Sbjct: 3   LEGKVCLITGAASGIGKATTLLFAQEGATVIAGDISKENLDSLVKEAEGLPGKVDPYVLN 62

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D + ++     + +++G++D+L+ NAGI    + + ++KE+ +  VI+VN+   +N+ 
Sbjct: 63  VTDRDQIKEVVEKVVQKYGRIDVLVNNAGITRD-ALLVRMKEEDWDAVINVNLKGVFNVT 121

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P++ K   G  + +SS       P    Y+ASKA +  + +TW+KE     +RV  
Sbjct: 122 QMVVPYMIKQRNGSIVNVSSVVGIYGNPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNA 181

Query: 196 IDPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           + PG   T M        R  A+          P++VA++I FL + +
Sbjct: 182 VAPGFIETPMTEKLPEKAREAALSRIPLGRFGKPEEVAQVILFLASDE 229


>gi|75910976|ref|YP_325272.1| short-chain dehydrogenase/reductase SDR [Anabaena variabilis ATCC
           29413]
 gi|75704701|gb|ABA24377.1| Short-chain dehydrogenase/reductase SDR [Anabaena variabilis ATCC
           29413]
          Length = 227

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 105/228 (46%), Gaps = 4/228 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           +L L+TG SRG+GY       + G  +I C RS   +EKL +   K     +  A D+ D
Sbjct: 3   KLILITGVSRGLGYALTERFIQEGHTIIGCARSQVTVEKLSH---KFGSPHNFAAVDVAD 59

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
              ++     I K +   D+LI NA I    +P+W++    F+ +I +N+    +I+R F
Sbjct: 60  EAQVKAWAELILKEYEPPDLLINNAAIANQPAPLWEVPSTDFSQLIDINIKGVVHIIRHF 119

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P + +   G  I LSSG      PL   Y ASK AIE L R  ++E +   +  I ++P
Sbjct: 120 VPAMVQKRHGIIINLSSGWGRSTSPLVAPYCASKWAIEGLTRALAQE-LPAGMAAIPLNP 178

Query: 199 GPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
           G   T M       E  N     Q V K   F+   +  + G   +VP
Sbjct: 179 GIIHTDMLDICFGEEAVNYPLVSQWVLKAAPFILQLKPTDNGVPLTVP 226


>gi|304391204|ref|ZP_07373148.1| short-chain dehydrogenase/reductase SDR [Ahrensia sp. R2A130]
 gi|303296560|gb|EFL90916.1| short-chain dehydrogenase/reductase SDR [Ahrensia sp. R2A130]
          Length = 255

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 123/245 (50%), Gaps = 13/245 (5%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIF 72
           H++L  R  LVTG+SRGIG  +A  L  +GA V+   R+ S ++++  AL    ++    
Sbjct: 5   HIDLTGRTVLVTGASRGIGEASARRLHAAGANVVLLARTTSDIDRIAEAL---GERALAI 61

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+ + +A+E       +R+G +D LI NAG++  I+ I       ++ V+ VN+   +
Sbjct: 62  PCDVANWSAVEHAIEKTVERFGSIDTLINNAGLIEPIARIEDADPLEWSKVVDVNLKGAF 121

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            ++R+  P +K++  G  + +SSGAA      W  Y A+KAA+  L R   KE   + +R
Sbjct: 122 QMVRACLPVMKRAGGGTVLNISSGAATSALEGWSHYCATKAALLMLTRCLHKEEAGSGIR 181

Query: 193 VINIDPGP----TRTSMRAKAMP-----AEDPNTVPHPQKVAKIISFLCATQKIETGKLF 243
            + + PG      +T++RA  +      A D + +P       +I  L    ++  G  F
Sbjct: 182 AVGLSPGTVATHVQTAIRASGINPVSKLAADAH-IPAEWAAEAVIWLLSDEARVHDGGDF 240

Query: 244 SVPQN 248
           S+  +
Sbjct: 241 SIKND 245


>gi|104780663|ref|YP_607161.1| short chain dehydrogenase [Pseudomonas entomophila L48]
 gi|95109650|emb|CAK14351.1| putative oxidoreductase, short chain dehydrogenase/reductase family
           [Pseudomonas entomophila L48]
          Length = 246

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 83/146 (56%), Gaps = 1/146 (0%)

Query: 89  IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG 148
           I +++G+LD L+ NA I+G  +P+ Q+   +F  V+ +NV A + +  +  P LK S   
Sbjct: 87  IEEQFGRLDGLLNNASIIGPRTPLEQLSGDNFMRVMHINVNATFMLTSTLLPLLKLSEDA 146

Query: 149 RAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRVINIDPGPTRTSMRA 207
             +  SS    K R  WGAY  SK A E L +T + E    A +R  +I+PG TRT+MRA
Sbjct: 147 SVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADELEGVAPVRANSINPGATRTAMRA 206

Query: 208 KAMPAEDPNTVPHPQKVAKIISFLCA 233
           +A P+E+P   P P+++  +  +L  
Sbjct: 207 QAYPSENPQNNPLPEEIMPVYLYLMG 232


>gi|226943691|ref|YP_002798764.1| short chain dehydrogenase [Azotobacter vinelandii DJ]
 gi|226718618|gb|ACO77789.1| Short-chain dehydrogenase/reductase SDR [Azotobacter vinelandii DJ]
          Length = 252

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 121/238 (50%), Gaps = 7/238 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L +R+ LVTG+ RGIG   A   A  GA V+  G++   L ++ + ++   + +  +   
Sbjct: 11  LKDRIILVTGAGRGIGAAAARTFAAHGATVLLLGKTEEHLNRVYDEIESAGHPQPVVIPL 70

Query: 75  DLRDS---NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           DL  +      EL  T I   +G+LD L+ NA ILG  +P+ Q+    F  V+ VNV A 
Sbjct: 71  DLEAALPHQYDELAAT-IENEFGRLDGLLHNASILGPRTPLEQLSGDHFMRVMQVNVNAM 129

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-A 190
           + +  +  P LK S     +  SS    K R  WGAY+ SK A E L +  + E   T A
Sbjct: 130 FMLTSTLLPLLKLSEDASVVFTSSSVGRKGRAYWGAYAVSKFATEGLMQVLADEVDGTCA 189

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQ 247
           +R  +++PG TRT MRA+A P E+P + P  +++  +  +L     K   G+ F   Q
Sbjct: 190 VRANSVNPGGTRTDMRAQAYPGENPLSRPGAEEIMPVYLYLMGPDSKGVNGQAFDAQQ 247


>gi|149913827|ref|ZP_01902359.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Roseobacter sp. AzwK-3b]
 gi|149812111|gb|EDM71942.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Roseobacter sp. AzwK-3b]
          Length = 214

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%), Gaps = 5/199 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           +  ++AL+TG+SRG+G+  A  LA S  +++A GR+   LE+L + +Q       +   D
Sbjct: 1   MTEQIALITGASRGLGFAMAEALADS-YHIVAVGRTTGALEELDDRIQAKGGSATLAPMD 59

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +  ++A+      I  RWG L + +  A     + P   + EK +A  + VNV A   ++
Sbjct: 60  ITKTDAMRQLCRSIHDRWGSLALWVHTAVYASPMMPAAHLDEKDWAKSVDVNVTAMGQLI 119

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
               P L  +  G+A+      A   +  +G Y A+KAA  ALAR+W+ ETV T   V  
Sbjct: 120 PFIAPLLGTT--GQAVFFEDDRA--GQKFFGPYGATKAAQIALARSWAAETVRTGPLVHV 175

Query: 196 IDPGPTRTSMRAKAMPAED 214
           + P P  T++RA+  P ED
Sbjct: 176 LQPAPMSTAVRARFFPGED 194


>gi|26988494|ref|NP_743919.1| short chain dehydrogenase [Pseudomonas putida KT2440]
 gi|24983258|gb|AAN67383.1|AE016364_8 oxidoreductase, short chain dehydrogenase/reductase family
           [Pseudomonas putida KT2440]
          Length = 246

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 81/146 (55%), Gaps = 1/146 (0%)

Query: 89  IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG 148
           I  ++G+LD L+ NA I+G  +P+ Q+   +F  V+ +NV A + +  +  P LK S   
Sbjct: 87  IEGQFGRLDGLLNNASIIGPRTPLEQLSGDNFMRVMHINVNATFMLTSTLLPLLKLSEDA 146

Query: 149 RAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRVINIDPGPTRTSMRA 207
             +  SS    K R  WGAY  SK A E L +T + E    A +R  +I+PG TRT+MRA
Sbjct: 147 SVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADELEGVAPVRANSINPGATRTAMRA 206

Query: 208 KAMPAEDPNTVPHPQKVAKIISFLCA 233
           +A P E+P   P P+++  +  +L  
Sbjct: 207 QAYPGENPQNNPLPEEIMPVYLYLMG 232


>gi|148549157|ref|YP_001269259.1| short chain dehydrogenase [Pseudomonas putida F1]
 gi|148513215|gb|ABQ80075.1| short-chain dehydrogenase/reductase SDR [Pseudomonas putida F1]
          Length = 246

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 81/146 (55%), Gaps = 1/146 (0%)

Query: 89  IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG 148
           I  ++G+LD L+ NA I+G  +P+ Q+   +F  V+ +NV A + +  +  P LK S   
Sbjct: 87  IEGQFGRLDGLLNNASIIGPRTPLEQLSGDNFMRVMHINVNATFMLTSTLLPLLKLSEDA 146

Query: 149 RAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRVINIDPGPTRTSMRA 207
             +  SS    K R  WGAY  SK A E L +T + E    A +R  +I+PG TRT+MRA
Sbjct: 147 SVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADELEGVAPVRANSINPGATRTAMRA 206

Query: 208 KAMPAEDPNTVPHPQKVAKIISFLCA 233
           +A P E+P   P P+++  +  +L  
Sbjct: 207 QAYPGENPQNNPLPEEIMPVYLYLMG 232


>gi|330808282|ref|YP_004352744.1| short chain dehydrogenase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376390|gb|AEA67740.1| putative short chain dehydrogenase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 246

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 121/223 (54%), Gaps = 6/223 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L+ R+ LVTG+ RGIG   A   A  GA V+  G++ + L ++ + ++   + +  +  F
Sbjct: 11  LNGRMILVTGAGRGIGAAAAKAYAAHGATVLLLGKTEANLTQVYDEIEAAGHPQPAVIPF 70

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  +     I   +G LD L+ NA I+G  +P+ Q+  ++F  V+ VNV A +
Sbjct: 71  NLETALPHQYDELAAMIETEFGHLDGLLHNASIIGPRTPLEQLSGENFMRVMHVNVNAMF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT--A 190
            +  +  P LK S     +  SS    K R  WGAY  SK A E L +T + E V+T  A
Sbjct: 131 MLTSTLLPLLKLSKDASVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADE-VDTVAA 189

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           +R  +I+PG TRTSMRA+A P E+P   P P+++  +  +L  
Sbjct: 190 VRANSINPGATRTSMRAQAYPGENPLNNPTPEEIMPVYLYLMG 232


>gi|186682721|ref|YP_001865917.1| short-chain dehydrogenase/reductase SDR [Nostoc punctiforme PCC
           73102]
 gi|186465173|gb|ACC80974.1| short-chain dehydrogenase/reductase SDR [Nostoc punctiforme PCC
           73102]
          Length = 259

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 102/192 (53%), Gaps = 1/192 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFA 73
           +L N++ L+TG+S GIG   A   A +GA +I   R + +L++LK+AL ++   +I +  
Sbjct: 3   SLQNQIILITGASSGIGTACARIFAGAGAKLILAARRLERLQQLKDALIKEFGIEIHLLQ 62

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+RD NA+E   + +   W  +DILI NAG+   +  + +   + + D+I  NV     
Sbjct: 63  LDVRDRNAVESAISTLPPAWSNIDILINNAGLSRGLDKLHEGSFQDWEDMIDTNVKGLLY 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + R   P +     G  + L S A ++  P    Y A+KAA+ A++    ++ + T +RV
Sbjct: 123 VSRYVVPGMVSRDRGHVVNLGSIAGHQTYPGGNVYCATKAAVRAISEGLKQDLLGTRVRV 182

Query: 194 INIDPGPTRTSM 205
            ++DPG   T  
Sbjct: 183 TSVDPGMVETEF 194


>gi|313500071|gb|ADR61437.1| Short chain dehydrogenase [Pseudomonas putida BIRD-1]
          Length = 246

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 81/146 (55%), Gaps = 1/146 (0%)

Query: 89  IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG 148
           I  ++G+LD L+ NA I+G  +P+ Q+   +F  V+ +NV A + +  +  P LK S   
Sbjct: 87  IEGQFGRLDGLLNNASIIGPRTPLEQLSGDNFMRVMHINVNATFMLTSTLLPLLKLSEDA 146

Query: 149 RAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRVINIDPGPTRTSMRA 207
             +  SS    K R  WGAY  SK A E L +T + E    A +R  +I+PG TRT+MRA
Sbjct: 147 SVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADELEGVAPVRANSINPGATRTAMRA 206

Query: 208 KAMPAEDPNTVPHPQKVAKIISFLCA 233
           +A P E+P   P P+++  +  +L  
Sbjct: 207 QAYPGENPQNNPLPEEIMPVYLYLMG 232


>gi|89070876|ref|ZP_01158115.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Oceanicola granulosus HTCC2516]
 gi|89043564|gb|EAR49774.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Oceanicola granulosus HTCC2516]
          Length = 213

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 114/208 (54%), Gaps = 5/208 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            ++AL+TG+SRG+G   A+ LA S  +V+AC R+   LE++ + ++    +  +   D+ 
Sbjct: 2   TKIALITGASRGLGAALAVALAPSH-HVVACARTTGALEEVDDRVRAAGGEASLAPMDVT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
              A++     I  RW +LD+ I +A  +  ++P   I EK FA  ++VNV A   ++  
Sbjct: 61  TDAAMQQLCRSIFDRWRRLDLWIHSAIHVPPLAPADHIAEKDFARAVAVNVSATARLIPY 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L +S  G A+ L    A +  P +GAY A+K A  ALAR+W+ E+V T  RV  + 
Sbjct: 121 VAPLLGES--GHAVFLDDPRAGE--PFFGAYGATKGAQIALARSWAAESVRTGPRVSILA 176

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVA 225
           P P  T+ RA+  P ED + + +P   A
Sbjct: 177 PRPMATATRARFFPGEDRDALAYPDSEA 204


>gi|321315132|ref|YP_004207419.1| putative oxidoreductase [Bacillus subtilis BSn5]
 gi|320021406|gb|ADV96392.1| putative oxidoreductase [Bacillus subtilis BSn5]
          Length = 248

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 111/233 (47%), Gaps = 19/233 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
            + ++ALVTG + GIG  TA +    GAYV   GR  ++L+K   A+ +I K +     D
Sbjct: 4   FEGKIALVTGGTSGIGLATAQKFVNEGAYVYITGRRQNELDK---AVNQIGKNVSGVQGD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN-WNI 134
           +     L+     I +  GKLDIL ANAGI G+  P+ +I E+       +NV    + +
Sbjct: 61  ISKLEDLDKLYDIIKQEKGKLDILFANAGI-GNFLPLGEITEEQVDRTFDINVKGTIFTV 119

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            ++   +  K   G  I+  S A     P +  Y ASKAA+ AL R W  +   T +RV 
Sbjct: 120 QKALSLFPDK--VGSIIVTGSTAGSIGNPAFSVYGASKAALRALVRNWILDLKGTEIRVN 177

Query: 195 NIDPG----PTRTSMRAKAMP---AEDPNTVP-----HPQKVAKIISFLCATQ 235
            + PG    P    +   A+        NTVP      P++VA  +SFL + +
Sbjct: 178 VVSPGGILTPAYDELFGDALEEVMENSRNTVPAGKVGTPEEVANAVSFLASDE 230


>gi|262197946|ref|YP_003269155.1| short-chain dehydrogenase/reductase SDR [Haliangium ochraceum DSM
           14365]
 gi|262081293|gb|ACY17262.1| short-chain dehydrogenase/reductase SDR [Haliangium ochraceum DSM
           14365]
          Length = 239

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 72/233 (30%), Positives = 111/233 (47%), Gaps = 17/233 (7%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R  L+TG+SRG+G   A +L   GA V+   R     + L+ AL+ +       A DL  
Sbjct: 13  RRVLITGASRGLGLALATQLRARGAIVVGIARDA---QALRAALEPLGALP--LAADLGS 67

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISP-------IWQIKEKSFADVISVNVMAN 131
           ++A  L     +   G  D+ I  A  LG +         +  +   + A V +VN +  
Sbjct: 68  ADADALATRASSLAGGPFDLFIHAASTLGPLGEGDDPMPRLTALDAAAMAQVFAVNALGP 127

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             ++R+    ++    G   ++SS AA    P WGAY ASK A++ L RTW+ E     L
Sbjct: 128 AALVRALHRSMRTG-SGTIAVVSSDAAEHFYPGWGAYGASKTALDHLVRTWAVE--EQQL 184

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFS 244
           R +++DPG   T M A AMP  D N++  P  VA  I  L   +++ +G  F+
Sbjct: 185 RFVSVDPGEMDTRMHADAMPGADRNSLAAPADVASAI--LAQLERVPSGSRFA 235


>gi|161527538|ref|YP_001581364.1| short-chain dehydrogenase/reductase SDR [Nitrosopumilus maritimus
           SCM1]
 gi|160338839|gb|ABX11926.1| short-chain dehydrogenase/reductase SDR [Nitrosopumilus maritimus
           SCM1]
          Length = 269

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 123/232 (53%), Gaps = 17/232 (7%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L  ++ALVTG SRGIG+ TA  L+ +GA V   G+   +LEK+ +   +I+    I A
Sbjct: 23  LSLSGKVALVTGGSRGIGFATAKVLSENGANVAITGKVQERLEKVSS---EISNSFAIVA 79

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+R +  ++     I +++G+LDIL+ NAG+   I  + +I ++ + +V+ VN+   + 
Sbjct: 80  -DVRKTEDVKNAIKKIVEKFGRLDILVNNAGVFPKIKKLHEIDDEEWNEVLDVNLTGQFR 138

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG--AYSASKAAIEALARTWSKETVNTAL 191
           + +   P L+K+  G  I +SS A  K    +   AYSA+KAA+  L + W+ E     +
Sbjct: 139 VTKEAIPHLQKT-SGSIINISSDAGLKAYQGFNADAYSATKAALIVLTKCWALEYSKDKI 197

Query: 192 RVINIDPGPTRTSMRA---------KAMPAEDP-NTVPHPQKVAKIISFLCA 233
           RV  I PG   T M             M AE P   +  P++VAK + +  +
Sbjct: 198 RVNCICPGVVDTDMTKPFVKTQKDRDFMNAEHPLGRIGEPEEVAKAVLYFAS 249


>gi|170720556|ref|YP_001748244.1| short chain dehydrogenase [Pseudomonas putida W619]
 gi|169758559|gb|ACA71875.1| short-chain dehydrogenase/reductase SDR [Pseudomonas putida W619]
          Length = 246

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 83/146 (56%), Gaps = 1/146 (0%)

Query: 89  IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG 148
           + +++G+LD L+ NA I+G  +P+ Q+   +F  V+ +NV A + +  +  P LK S   
Sbjct: 87  VEEQFGRLDGLLNNASIIGPRTPLEQLSGDNFMRVMHINVDATFMLTSTLLPLLKLSEDA 146

Query: 149 RAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRVINIDPGPTRTSMRA 207
             +  SS    K R  WGAY  SK A E L +T + E    A +R  +I+PG TRT+MRA
Sbjct: 147 SVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADELEGVAPVRSNSINPGATRTAMRA 206

Query: 208 KAMPAEDPNTVPHPQKVAKIISFLCA 233
           +A P+E+P   P P+++  +  +L  
Sbjct: 207 QAYPSENPQNNPLPEEIMPVYLYLMG 232


>gi|167032366|ref|YP_001667597.1| short chain dehydrogenase [Pseudomonas putida GB-1]
 gi|166858854|gb|ABY97261.1| short-chain dehydrogenase/reductase SDR [Pseudomonas putida GB-1]
          Length = 246

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 82/146 (56%), Gaps = 1/146 (0%)

Query: 89  IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG 148
           I  ++G+LD L+ NA I+G  +P+ Q+   +F  V+ +NV A + +  +  P LK S   
Sbjct: 87  IEDQFGRLDGLLNNASIIGPRTPLEQLSGDNFMRVMHINVDATFMLTSTLLPLLKLSEDA 146

Query: 149 RAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-LRVINIDPGPTRTSMRA 207
             +  SS    K R  WGAY  SK A E L +T + E    A +R  +I+PG TRT+MRA
Sbjct: 147 SVVFTSSSVGRKGRAYWGAYGVSKFATEGLMQTLADELEGVAPVRSNSINPGATRTAMRA 206

Query: 208 KAMPAEDPNTVPHPQKVAKIISFLCA 233
           +A P+E+P   P P+++  +  +L  
Sbjct: 207 QAYPSENPQNNPLPEEIMPVYLYLMG 232


>gi|92114491|ref|YP_574419.1| short-chain dehydrogenase/reductase SDR [Chromohalobacter
           salexigens DSM 3043]
 gi|91797581|gb|ABE59720.1| short-chain dehydrogenase/reductase SDR [Chromohalobacter
           salexigens DSM 3043]
          Length = 244

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 112/227 (49%), Gaps = 15/227 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++AL+TG + GIG  +A  L   GA+V   GR   + + L NA + +         D
Sbjct: 4   LHGKIALITGGASGIGLASAQRLIDEGAFVFITGR---RQDVLDNAAEALGSNARAVQAD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +     L+     I K  G+LD+L+ANAG+ G  + + QI E+ +  +  +NV      +
Sbjct: 61  VTKPEDLDRVFDTIQKAKGRLDVLVANAGV-GEFASLGQITEEHYDYIFDINVKGTLFTV 119

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P +  ++ G  I+  S       P    YSASKAA+  L R+W+ +   T +RV  
Sbjct: 120 QKALPLM--TNGGSIILTGSTVGSMGTPAMSIYSASKAAVRNLVRSWAHDLRGTGIRVNV 177

Query: 196 IDPGPTRTSMRAKAMPAEDPN----TVP-----HPQKVAKIISFLCA 233
           + PGPT+T    + +P+E  +    TVP      P++ A  ++FL +
Sbjct: 178 MSPGPTKTDKLMELLPSEALSEMNRTVPLERLGDPKETAGAVAFLAS 224


>gi|119512990|ref|ZP_01632050.1| hypothetical protein N9414_06414 [Nodularia spumigena CCY9414]
 gi|119462364|gb|EAW43341.1| hypothetical protein N9414_06414 [Nodularia spumigena CCY9414]
          Length = 227

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 107/227 (47%), Gaps = 4/227 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           +L L+TG S+G+GY       + G   I C RS + +EKL    QK     D    D++ 
Sbjct: 3   KLILITGISKGLGYAMTERFIQEGHTFIGCARSSAAIEKLS---QKFTAPNDFTVVDVKK 59

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
              +E     +  ++   DI+I NA I    +P+WQ+    F+++I +N+   +NI+  F
Sbjct: 60  EPQVEKWAKDVLSKYESPDIVINNAAITNYPAPLWQVPADEFSELIDINIKGVFNIIHHF 119

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P + K+  G  +  SSG      P    Y ASK AIE L R+ ++E +   +  + ++P
Sbjct: 120 VPAMVKNKRGIIVNFSSGWGRSTSPEVAPYCASKWAIEGLTRSLAQE-LPAGMAAVPLNP 178

Query: 199 GPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSV 245
           G   T M + +   E  N  P    V K + ++   +  + G   +V
Sbjct: 179 GIIHTDMLSISFGEEAVNYTPVSDWVLKAVPYILNLKPTDNGMPLTV 225


>gi|182415712|ref|YP_001820778.1| short-chain dehydrogenase/reductase SDR [Opitutus terrae PB90-1]
 gi|177842926|gb|ACB77178.1| short-chain dehydrogenase/reductase SDR [Opitutus terrae PB90-1]
          Length = 228

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 110/225 (48%), Gaps = 6/225 (2%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           ++TG++RG+G   A E  R G  VI CGR    +  L+ A Q  +   D  A D+     
Sbjct: 4   VITGATRGLGRALAEEFIRGGHAVIGCGRGGEAIFDLRMAHQAPH---DFSAVDVAQDTK 60

Query: 82  LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW 141
           + +    + +     D+LI NAG++  ++P+W+I+++ FA V+ VNV    N++R F P 
Sbjct: 61  VAIWAAKVLENEAAPDLLINNAGVMNRLAPLWEIEDREFAKVLDVNVRGVANMIRHFVPA 120

Query: 142 LKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT 201
           +     G  +  SSG      P    Y ASK AIE L +  ++E +   +  + ++PG  
Sbjct: 121 MVARKQGVIVNFSSGWGRSTSPQVAPYCASKFAIEGLTKALAQE-LPKGMAAVALNPGVI 179

Query: 202 RTSMRAKAMPAEDPNTVPHPQKVAKIIS-FLCATQKIETGKLFSV 245
            T M   A   ED  T P  +  AK+ + FL      + G+  +V
Sbjct: 180 DTDMLRSAW-GEDAGTYPKAEAWAKVAAPFLLQLGAKDNGQSLTV 223


>gi|16078441|ref|NP_389260.1| oxidoreductase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221309241|ref|ZP_03591088.1| hypothetical protein Bsubs1_07621 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313569|ref|ZP_03595374.1| hypothetical protein BsubsN3_07562 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318491|ref|ZP_03599785.1| hypothetical protein BsubsJ_07496 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322764|ref|ZP_03604058.1| hypothetical protein BsubsS_07602 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|81815531|sp|O31680|YKVO_BACSU RecName: Full=Uncharacterized oxidoreductase ykvO
 gi|2633748|emb|CAB13250.1| putative oxidoreductase [Bacillus subtilis subsp. subtilis str.
           168]
          Length = 248

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 111/233 (47%), Gaps = 19/233 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
            + ++ALVTG + GIG  TA +    GAYV   GR  ++L+K   A+ +I K +     D
Sbjct: 4   FEGKIALVTGGTSGIGLATAQKFVNEGAYVYITGRRQNELDK---AVNQIGKNVTGVQGD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN-WNI 134
           +     L+     I +  GKLDIL ANAGI G+  P+ +I E+       +NV    + +
Sbjct: 61  ISKLEDLDKLYDIIKQEKGKLDILFANAGI-GNFLPLGEITEEQVDRTFDINVKGTIFTV 119

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            ++   +  K   G  I+  S A     P +  Y ASKAA+ AL R W  +   T +RV 
Sbjct: 120 QKALSLFPDK--VGSIIVTGSTAGSIGNPAFSVYGASKAALRALVRNWILDLKGTEIRVN 177

Query: 195 NIDPG----PTRTSMRAKAMP---AEDPNTVP-----HPQKVAKIISFLCATQ 235
            + PG    P    +   A+        NTVP      P++VA  +SFL + +
Sbjct: 178 VVSPGGILTPAYDELFGDALEEVLENSRNTVPAGKVGTPEEVANAVSFLASDE 230


>gi|259417772|ref|ZP_05741691.1| short-chain dehydrogenase/reductase SDR [Silicibacter sp.
           TrichCH4B]
 gi|259346678|gb|EEW58492.1| short-chain dehydrogenase/reductase SDR [Silicibacter sp.
           TrichCH4B]
          Length = 249

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 97/189 (51%), Gaps = 3/189 (1%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           N+  +++G+SRGIG   A E A  GA V+   RS    E LK    +I +K    A D+ 
Sbjct: 5   NKTIVISGASRGIGASAAREFASQGANVVLLARSA---EALKTLADEIGEKALALACDVA 61

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D  A+E      +  +G LD+LI NAG++  I+ +   +   +A +I+VN+   +N+MR+
Sbjct: 62  DYAAVEAAFQRASTHFGSLDVLICNAGMIEPIARLEHAEPADWAQLINVNITGVFNMMRA 121

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P LK +  G  + + SGA+ +    W AY  SKA    L +    E     +RV+ + 
Sbjct: 122 GLPHLKAAGGGAVLTIGSGASQRPLEGWSAYCTSKAGAAMLTQALHLEEGENGIRVMGLS 181

Query: 198 PGPTRTSMR 206
           PG   T M+
Sbjct: 182 PGTVATQMQ 190


>gi|18391139|ref|NP_563866.1| short-chain dehydrogenase/reductase (SDR) family protein
           [Arabidopsis thaliana]
 gi|4914333|gb|AAD32881.1|AC005489_19 F14N23.19 [Arabidopsis thaliana]
 gi|51971537|dbj|BAD44433.1| unknown protein [Arabidopsis thaliana]
 gi|107738340|gb|ABF83679.1| At1g10310 [Arabidopsis thaliana]
 gi|332190443|gb|AEE28564.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis
           thaliana]
          Length = 242

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 99/187 (52%), Gaps = 2/187 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R  L+TG S+G+G   ALELA+ G  VI C RS  +L  L++ L      + +   D++ 
Sbjct: 18  RTVLITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALQSELSSSTNHL-LLTADVKS 76

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           ++++E     I ++ G  DI++ NAG +   S IW++  + F +V+  NV    N++R F
Sbjct: 77  NSSVEEMAHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVKGVANVLRHF 136

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P +     G  + +SSG       L   Y ASK AIE L+R  +KE V   + V+ ++P
Sbjct: 137 IPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRAVAKEVVE-GMAVVALNP 195

Query: 199 GPTRTSM 205
           G   T +
Sbjct: 196 GVINTEL 202


>gi|21593553|gb|AAM65520.1| unknown [Arabidopsis thaliana]
          Length = 240

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 99/187 (52%), Gaps = 2/187 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R  L+TG S+G+G   ALELA+ G  VI C RS  +L  L++ L      + +   D++ 
Sbjct: 16  RTVLITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALQSELSSSTNHL-LLTADVKS 74

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           ++++E     I ++ G  DI++ NAG +   S IW++  + F +V+  NV    N++R F
Sbjct: 75  NSSVEEMAHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVKGVANVLRHF 134

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P +     G  + +SSG       L   Y ASK AIE L+R  +KE V   + V+ ++P
Sbjct: 135 IPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRAVAKEVVE-GMAVVALNP 193

Query: 199 GPTRTSM 205
           G   T +
Sbjct: 194 GVINTEL 200


>gi|330502863|ref|YP_004379732.1| short chain dehydrogenase [Pseudomonas mendocina NK-01]
 gi|328917149|gb|AEB57980.1| short chain dehydrogenase [Pseudomonas mendocina NK-01]
          Length = 246

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 118/222 (53%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           L +R+ L+TG+ RGIG   A   A  GA V+  G++ + L ++ + ++   + +  +  F
Sbjct: 11  LKDRVILITGAGRGIGAAAAKSFAAHGATVLLLGKTEANLSQVYDEIEAAGHPQPVVIPF 70

Query: 75  DLRDS--NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  +  +  +     I   +G+LD L+ NA ILG  +P+ Q+   +F  V+ VNV A +
Sbjct: 71  NLETALPHQYDELAVMIENEFGRLDGLLHNASILGPRTPLEQLSGDNFMRVMHVNVNAMF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            +  +  P LK S        SS    K R  WGAY+ SK A E L +  + E    A +
Sbjct: 131 MLSSTLLPLLKLSQDASVAFTSSSVGRKGRAYWGAYAVSKFATEGLMQVMADELDGIANV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT+MRA+A P E+P + P P+++  +  +L  
Sbjct: 191 RANSINPGATRTAMRAQAYPGENPASRPLPEEIMPLYLYLIG 232


>gi|330953522|gb|EGH53782.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae Cit 7]
          Length = 246

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 114/222 (51%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L+ R+ LVTG++RGIG   A   A  GA V+  GR+ + L ++ + ++     +  +  F
Sbjct: 11  LEGRVILVTGAARGIGAAAAKTYAAHGATVLLLGRTEASLAQVHDEIKAAGHLQPLVIPF 70

Query: 75  DLRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  ++        T I +  G LD L+ NA I+G  + +  +  + F  V+ VNV A +
Sbjct: 71  DLESADPARYHDLATMIERTVGHLDGLLHNASIIGPRTSVEHLPGEDFMQVMHVNVNATF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TAL 191
            + ++  P L++S        SS    K R  WGAY  SK A E L +T + E    + +
Sbjct: 131 MLTQALLPLLQRSTDASIAFTSSSVGRKGRAQWGAYGVSKFATEGLMQTLADELEGVSTV 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R  +I+PG TRT MRA+A P E+P   P P+ +  +  +L  
Sbjct: 191 RANSINPGATRTGMRAQAYPDENPQNNPTPEAIMPVYLYLMG 232


>gi|206900168|ref|YP_002250191.1| 3-oxoacyl-[acyl-carrier protein] reductase [Dictyoglomus
           thermophilum H-6-12]
 gi|206739271|gb|ACI18329.1| 3-oxoacyl-[acyl-carrier protein] reductase [Dictyoglomus
           thermophilum H-6-12]
          Length = 241

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 114/219 (52%), Gaps = 1/219 (0%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L+N++ L+TG+SRGIG      L++  A +    R   +L++LK  L+K N  +    
Sbjct: 2   ISLENKIILITGASRGIGEEIVRRLSKERANLALIARDAKRLKELKEELEKENTNVFTLP 61

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DLR+ NA  +    + K +GKLDILI NAG   S  P+ +  E+ + +++++N    + 
Sbjct: 62  IDLREKNAPRIVVGEVIKYFGKLDILINNAGTALS-KPLIETSEEEWDEIMTINAKVPYF 120

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + +   P+LK S     I +SS   YK      AY+ASK A+    +  ++E     +RV
Sbjct: 121 LCKYAIPYLKNSEIPTIINISSVVGYKGYVNQSAYTASKHALHGFTKVLAQEVYEYGIRV 180

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
             I PG   T +  K  P     ++  P ++A+II FL 
Sbjct: 181 HLISPGGVATDLVNKVRPDLQKASLIQPFEIAEIIVFLL 219


>gi|300784028|ref|YP_003764319.1| short-chain dehydrogenase [Amycolatopsis mediterranei U32]
 gi|299793542|gb|ADJ43917.1| short-chain dehydrogenase [Amycolatopsis mediterranei U32]
          Length = 251

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 102/192 (53%), Gaps = 10/192 (5%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           VNL+N+ A+VTG S GIG   A   A  GA+V   GR   + E L +A+ +I   +    
Sbjct: 5   VNLENKTAVVTGGSTGIGLAIAQRFAAEGAHVFITGR---RKEALDDAVAEIGSGVTAVR 61

Query: 74  FDLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            D   +N  +L + Y  +A+R   LD+++AN+G  GS +P+ +I E+ F      NV   
Sbjct: 62  AD--SANLADLDELYRAVAERGRGLDVVVANSG-GGSFAPLGEITEEQFDATFGTNVKGV 118

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
              ++   P L ++     I+  S A+ +  P +G Y A+KAA+   AR+W+ +   T  
Sbjct: 119 VFAVQKALPLLNENAS--IIVTGSTASMRPGPAFGVYGATKAAVRNFARSWALDLKGTGT 176

Query: 192 RVINIDPGPTRT 203
           RV  + PGPTRT
Sbjct: 177 RVNVLSPGPTRT 188


>gi|86133926|ref|ZP_01052508.1| short chain dehydrogenase [Polaribacter sp. MED152]
 gi|85820789|gb|EAQ41936.1| short chain dehydrogenase [Polaribacter sp. MED152]
          Length = 257

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 110/200 (55%), Gaps = 2/200 (1%)

Query: 7   KNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN 66
           KNN  I +NL +++A++TG+S GIG  TAL+LA+ GA V+   RS  +L++L   ++  N
Sbjct: 5   KNNKNIIMNLKDKVAIITGASSGIGEATALKLAKEGAKVVLTARSEDKLKELAQKIENEN 64

Query: 67  KKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISV 126
               +   D+  S+  +         +G ++IL+ NAG++  +S I + K + +  ++ V
Sbjct: 65  GTALVVTADVTKSDEFKNVVEKAKSEFGTVNILVNNAGLM-PLSYIEKFKTEEWNTMVDV 123

Query: 127 NVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE- 185
           N+    N +++  P L  +  G  I +SS AAYK  P    Y A+KAA++  +    KE 
Sbjct: 124 NIKGVLNGVQAVLPTLIDNKGGHIINISSTAAYKYFPGGAVYCATKAAVQMFSEGLRKEI 183

Query: 186 TVNTALRVINIDPGPTRTSM 205
           +    + V +I+PG   T++
Sbjct: 184 SAKHGINVTSIEPGAVDTAL 203


>gi|198427784|ref|XP_002131419.1| PREDICTED: similar to MGC81922 protein [Ciona intestinalis]
          Length = 249

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 112/227 (49%), Gaps = 7/227 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD ++ALVT SS+GIG+  A +LA+ GA+V+ C R    +++    L+     +      
Sbjct: 4   LDGKVALVTASSQGIGFAIARKLAQDGAHVVICSRKKKNVDEAVQVLKSEGLSVSGSVCH 63

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +  S+  +     +   +G LDIL++NA +      I    E ++  +  VNV A + ++
Sbjct: 64  VGKSDDRKSLINQLENDFGGLDILVSNAAVNPYFGSILATPESAYDKIFEVNVKATFQLV 123

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P ++K   G  +I+SS AAY    + G YS SK A+ AL +    E  +  +RV  
Sbjct: 124 QDAVPLMQKRGGGSVVIVSSMAAYVPNEMLGIYSVSKTALVALTKALMPELSSMNIRVNC 183

Query: 196 IDPGPTRTSMRAKAMPAEDP--NTVP-----HPQKVAKIISFLCATQ 235
           I PG  RT      +  E+     VP     +P+  A +++FL + +
Sbjct: 184 IAPGIIRTKFSKSLLQHEEAVRQQVPLGRIGNPEDCAGMVAFLSSDE 230


>gi|319950413|ref|ZP_08024329.1| short chain dehydrogenase [Dietzia cinnamea P4]
 gi|319435929|gb|EFV91133.1| short chain dehydrogenase [Dietzia cinnamea P4]
          Length = 264

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 104/193 (53%), Gaps = 1/193 (0%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIF 72
           H     R ALVTG+S GIG  +A  LA  G  V+   R   +L+ L  ++++   +    
Sbjct: 8   HPEAAGRPALVTGASSGIGRASAEALAALGHPVVVGARRADRLDDLVRSIREAGGEATAV 67

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           A D+ D++++    +     +G  ++L+++AG L  ++ +W++  + FA  + ++++A  
Sbjct: 68  AVDVTDADSVAGFVSAATDAYGDPEVLVSSAGTL-KMARVWELSPEDFAAQMDLHLLAVH 126

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            ++ +  P + +   G  +++ S  AY  RP  GAY A+KA +E +A+   +E   T +R
Sbjct: 127 RLLHAVLPGMIERRRGDVVLIGSDVAYTARPRSGAYVAAKAGLETMAKQARRELEGTGVR 186

Query: 193 VINIDPGPTRTSM 205
           +  + PGPT T M
Sbjct: 187 LGVVRPGPTMTEM 199


>gi|289677143|ref|ZP_06498033.1| short chain dehydrogenase [Pseudomonas syringae pv. syringae FF5]
          Length = 220

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 99/193 (51%), Gaps = 4/193 (2%)

Query: 45  VIACGRSISQLEKLKNALQKINKKID-IFAFDLR--DSNALELTKTYIAKRWGKLDILIA 101
           V+  GR+ + L ++ + ++   +    +  FDL+  D        T I +  G+LD L+ 
Sbjct: 14  VLLLGRTEASLAQVHHEIKAAGQPQPLVIPFDLQSADPAQYHALATMIERTVGRLDGLLH 73

Query: 102 NAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC 161
           NA I+G  + +  +  + F +V+ VNV A + + ++  P L++S        SS    K 
Sbjct: 74  NASIIGPRTSVEHLPGEDFMEVMHVNVNATFMLTQALLPLLQRSEDASIAFTSSSVGRKG 133

Query: 162 RPLWGAYSASKAAIEALARTWSKETVN-TALRVINIDPGPTRTSMRAKAMPAEDPNTVPH 220
           R  WGAY  SK A E L +T + E    + +R  +I+PG TRT MRA+A P E+P   P 
Sbjct: 134 RAQWGAYGVSKFATEGLMQTLADELEGVSTVRANSINPGATRTGMRAQAYPDENPQNNPA 193

Query: 221 PQKVAKIISFLCA 233
           P+++  +  +L  
Sbjct: 194 PEEIMPVYLYLMG 206


>gi|56965522|ref|YP_177255.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Bacillus clausii
           KSM-K16]
 gi|56911767|dbj|BAD66294.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Bacillus clausii
           KSM-K16]
          Length = 238

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 114/226 (50%), Gaps = 7/226 (3%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           ++  ++AL+TG+ RGIG  TA   A+ G +V   GR++  L+K +N L + + K  +   
Sbjct: 3   SIKGKVALITGAGRGIGRATAEAFAKEGVHVGLVGRTLENLQKAQNDLAQYDVKTALATA 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ + +++      I +  G +DIL+ NAGI         +  + + D+I VNV   +  
Sbjct: 63  DVANLSSISAAVAAIREELGAIDILVNNAGI-SKFGGFMDLTPEEWTDIIDVNVKGVYYT 121

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R+  P + + + G  I +SS A  K  P+  AY+ASKAA+  L+ +   E     +RV 
Sbjct: 122 TRAVLPEMIERNSGDIINISSTAGQKGAPVTSAYTASKAAVIGLSESLMMEVRKKNIRVT 181

Query: 195 NIDPGPTRTSMRAKAMPAED--PNTVPHPQKVAKIISFLCATQKIE 238
            + P    T M AK +   D  P+ V  P+ +A    F+ A  K+ 
Sbjct: 182 TLTPSTVATDM-AKDLNLTDGNPDKVMQPEDLA---DFMVAQLKLH 223


>gi|260550964|ref|ZP_05825169.1| dehydrogenase [Acinetobacter sp. RUH2624]
 gi|260405912|gb|EEW99399.1| dehydrogenase [Acinetobacter sp. RUH2624]
          Length = 244

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 119/225 (52%), Gaps = 12/225 (5%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           + ++ALVTG+SRGIG   A +L + G +V+    S S  +KL ++  +    +   A D+
Sbjct: 4   ERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLTDSFGEQGTGL---ALDV 60

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
           R+ N +E   ++I + +G + +L+ NAGI    + + ++ E  + D++++++ A + + +
Sbjct: 61  RNLNEIEAVVSHIEQNYGPVLVLVNNAGITKD-NLLLRMSEDDWDDILNIHLKAVYRLSK 119

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
                + K+  GR I +SS  A+   P    YSA+KA IEA +R+ +KE  +  + V ++
Sbjct: 120 RVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSV 179

Query: 197 DPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            PG   T M        R K       N +  PQ +A  +SFL +
Sbjct: 180 APGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLAS 224


>gi|158335458|ref|YP_001516630.1| short chain dehydrogenase/reductase family oxidoreductase
           [Acaryochloris marina MBIC11017]
 gi|158305699|gb|ABW27316.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Acaryochloris marina MBIC11017]
          Length = 257

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 120/247 (48%), Gaps = 18/247 (7%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIF 72
           V++ N++ L+TG+S GIG   A   A  G  ++   R +S+L+ L   L+ +       F
Sbjct: 2   VSIQNQVVLITGASSGIGAACAQAFAPLGVKLLLAARRLSRLQTLATQLEAEFGVHTHTF 61

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+RD   +E     +   W  +DIL+ NAG+   +  +++   + + ++I  N+    
Sbjct: 62  QLDVRDRTQVESQLQALPPEWSAIDILVNNAGLSRGLDKLYEGSIQDWEEMIDTNIKGLL 121

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + R+  P + +   G  I + S A ++  P    Y  SKAA+ A++    ++ + T +R
Sbjct: 122 YVTRTIVPGMVQRQQGHVINIGSIAGHQTYPKGNVYCGSKAAVRAISEGLKQDLLGTPVR 181

Query: 193 VINIDPGPTRTSM----------RAKAMPAEDPNTVP-HPQKVAKIISFLCATQ--KIET 239
           V  +DPG   T            RAKA+ A   +TVP  P+ +A ++ F CAT+   +  
Sbjct: 182 VSAVDPGLVETEFSDVRFHGDTERAKAVYA---DTVPLTPEDIADVVVF-CATRPPHVNI 237

Query: 240 GKLFSVP 246
            +L  +P
Sbjct: 238 SELLVLP 244


>gi|327540284|gb|EGF26870.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Rhodopirellula baltica
           WH47]
          Length = 245

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 116/232 (50%), Gaps = 13/232 (5%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSG-AYVIACGRSISQLEKLKNALQKINKKIDIF 72
           +N +NR A+VTG SRGIG   A  LA  G + V+    S    ++L   + +       F
Sbjct: 1   MNNNNRGAIVTGGSRGIGAAIAERLASDGFSVVVNYANSSKAADELTQRITETGGLAQSF 60

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+ DS+A+E    +  + +G +D+L+ NAG+L  + P+ +  ++ FA ++ +N+   +
Sbjct: 61  QADVSDSDAVEKLFDFATESFGGVDVLVNNAGVL-KMQPLAETSDEDFARLVDINLKGCF 119

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           + MR     L+    GR I LSS       P +G Y A+KAA+EA++   + E     + 
Sbjct: 120 HTMREAARRLRDG--GRVINLSSSVIGLRMPNYGVYCATKAAVEAMSSVLANELRGRQIT 177

Query: 193 VINIDPGPTRTSM----RAKAMPAEDPNTVP-----HPQKVAKIISFLCATQ 235
           V ++ PGPT T +    ++  +     N  P      P  +A ++SFL  + 
Sbjct: 178 VNSVAPGPTATKLFLDDKSDELIDRLTNMSPLERLGQPDDIASVVSFLAGSD 229


>gi|148270154|ref|YP_001244614.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Thermotoga petrophila
           RKU-1]
 gi|281412504|ref|YP_003346583.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Thermotoga naphthophila
           RKU-10]
 gi|147735698|gb|ABQ47038.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Thermotoga petrophila
           RKU-1]
 gi|281373607|gb|ADA67169.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Thermotoga naphthophila
           RKU-10]
          Length = 246

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 117/228 (51%), Gaps = 9/228 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++ L+TG++ GIG  T L   + GA VIA   S   L+ L    + +  K+D +  +
Sbjct: 3   LEGKVCLITGAASGIGKATTLLFMQEGATVIAGDISKENLDSLVKEAEGLPGKVDPYILN 62

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D + ++     + +++G++D+L+ NAGI    + + ++KE+ +  VI+VN+   +N+ 
Sbjct: 63  VTDRDQIKEVVEKVVQKYGRIDVLVNNAGITRD-ALLVRMKEEDWDAVINVNLKGVFNVT 121

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P++ K   G  + +SS       P    Y+ASKA +  + +TW+KE     +RV  
Sbjct: 122 QMVVPYMIKQRNGSIVNVSSVVGIYGNPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNA 181

Query: 196 IDPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           + PG   T M        R  A+          P++VA++I FL + +
Sbjct: 182 VAPGFIETPMTEKLPEKAREAALSRIPLGRFGKPEEVAQVILFLASDE 229


>gi|258621802|ref|ZP_05716833.1| short chain dehydrogenase [Vibrio mimicus VM573]
 gi|258586033|gb|EEW10751.1| short chain dehydrogenase [Vibrio mimicus VM573]
          Length = 166

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 86/150 (57%)

Query: 89  IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG 148
           I +++G+LD ++ NA +LG +SP  QI E SF +V+ VNV A + + ++  P L KS   
Sbjct: 5   IEEQFGRLDGVLHNASLLGVLSPFDQIGEDSFDEVMQVNVKAQFLLTQALLPLLHKSADA 64

Query: 149 RAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK 208
           R +  SS   +  R  W  Y+ SK A E + +  + E  ++ +RV  I+PG TRT MRAK
Sbjct: 65  RIVFTSSTVGHIGRAFWATYAISKFATEGMMQILADELSDSTIRVNAINPGGTRTGMRAK 124

Query: 209 AMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           A PAED + +  P  +  +  +L A +  E
Sbjct: 125 AYPAEDADKLKTPLDIMPLYLYLMAPEGRE 154


>gi|119508941|ref|ZP_01628093.1| short chain dehydrogenase [Nodularia spumigena CCY9414]
 gi|119466470|gb|EAW47355.1| short chain dehydrogenase [Nodularia spumigena CCY9414]
          Length = 240

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 120/242 (49%), Gaps = 10/242 (4%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++LD R AL+TG+S GIG  TAL  A++G  V    RS+ +LE +  A +        +A
Sbjct: 1   MSLDKRRALITGASSGIGKATALAFAKAGIDVALVSRSLDKLETVAQAARHTGVVAKAYA 60

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DL +   ++     IA  +G +DIL+ NAGI    + + +   + +  VI++N+ + + 
Sbjct: 61  VDLANITQVKAEIEAIALDFGGIDILVNNAGI-AYTANLSETPLEDWQKVINLNLTSVFQ 119

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
            +    P ++  H G  I ++S AA +  P WG YS SKA + AL++T ++E     +RV
Sbjct: 120 CLMGILPGMRSRHTGTIINVASIAAKQPFPGWGVYSVSKAGVMALSQTLAQEERAHGIRV 179

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNY 253
             I PG   T +        D  TV      +K+++     Q I    L   PQ   ++ 
Sbjct: 180 TAICPGAVNTELW-------DTETVQSDFDRSKMLTPEVVAQSILYTALL--PQQAVIDE 230

Query: 254 LT 255
           LT
Sbjct: 231 LT 232


>gi|296102274|ref|YP_003612420.1| short-chain dehydrogenase/reductase SDR [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295056733|gb|ADF61471.1| short-chain dehydrogenase/reductase SDR [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 268

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 116/237 (48%), Gaps = 21/237 (8%)

Query: 11  EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID 70
           +++  L  ++ALVTG S GIG  TA ELA  GA V   GR  ++L+    A+ +I+ +  
Sbjct: 19  DMNTTLFEKIALVTGGSTGIGLATAQELAAQGAKVYITGRRQAELDA---AVAQIDSRAV 75

Query: 71  IFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
               D+     L+     IAK  G+LDIL ANAG  G + P+  I E+ F  +   NV  
Sbjct: 76  GIRADVSQLADLDRVYAQIAKEEGRLDILFANAG-GGDMLPLGAITEEQFDRIFGTNVRG 134

Query: 131 NWNIMRSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
               ++   P L     G +IIL+ S  + K    +  YSASKAA+   AR+W+ +    
Sbjct: 135 VLFTVQKALPLL---SAGSSIILTGSTVSIKGTANFSVYSASKAAVRNFARSWALDLQGR 191

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPN--------TVP-----HPQKVAKIISFLCA 233
            +R+  + PGP +T    + +P E            VP      P +V K+++FL +
Sbjct: 192 GIRINVVSPGPVKTPGLGELVPEEHRQGLYDALAAQVPLGRLGAPGEVGKVVAFLAS 248


>gi|126728725|ref|ZP_01744540.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Sagittula stellata E-37]
 gi|126710655|gb|EBA09706.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Sagittula stellata E-37]
          Length = 212

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 106/209 (50%), Gaps = 5/209 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            ++AL+TG+SRG+GY  A  LA    +++A  R++  LE+L +A++       +   D+ 
Sbjct: 2   TQIALITGASRGLGYALAEALAPE-YHIVAVARTVGGLEELDDAIKAKGGAATLAPMDVT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D NA+      +  RWG + +    A   G ++P WQ+  K +   ++ N  A  +++  
Sbjct: 61  DRNAMAQLCRSVHDRWGGVALWAHTAVHTGPLTPTWQLDMKDWDRSMATNAHAMGHLIPY 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L     G A+        K    +G Y ASKAA  A+A++W+ ETV T  +V  + 
Sbjct: 121 IAPLLGTD--GTALFFDDPKGGK--KFYGHYGASKAAQIAVAQSWAAETVKTGPKVRVLT 176

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVAK 226
           P P  T++RA+  P ED + +  P   A+
Sbjct: 177 PAPMATAVRARFHPGEDRDALATPADEAR 205


>gi|297849354|ref|XP_002892558.1| hypothetical protein ARALYDRAFT_471142 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297338400|gb|EFH68817.1| hypothetical protein ARALYDRAFT_471142 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 240

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 98/187 (52%), Gaps = 2/187 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R  L+TG S+G+G   ALELA+ G  VI C R+  +L  L++ L      + + A    +
Sbjct: 16  RTVLITGVSKGLGRALALELAKRGHTVIGCARTQEKLTALQSELSSPTNHLLLTADVKSN 75

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           S+  EL  T + K+ G  DI++ NAG +   S IW++  + F +V+  NV    N++R F
Sbjct: 76  SSVEELAHTIVEKK-GVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVKGVANVLRHF 134

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P +     G  + +SSG       L   Y ASK AIE L+R  +KE V   + V+ ++P
Sbjct: 135 IPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRAVAKEVVE-GMAVVALNP 193

Query: 199 GPTRTSM 205
           G   T +
Sbjct: 194 GVINTEL 200


>gi|226492367|ref|NP_001144211.1| hypothetical protein LOC100277072 [Zea mays]
 gi|195638466|gb|ACG38701.1| hypothetical protein [Zea mays]
          Length = 246

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 91/184 (49%), Gaps = 2/184 (1%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           L+TG SRG+G   ALELAR G  V+ CGRS   L  L+  +   ++     A    DS+ 
Sbjct: 25  LITGVSRGLGRALALELARRGHSVVGCGRSAEHLRSLEEEITSPSRHFFTVADVRSDSSV 84

Query: 82  LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW 141
            EL KT + K+    DI++ NAG +   +  W +  + F  V+  N+    N++R F P 
Sbjct: 85  AELAKTVVEKKQVP-DIIVNNAGTINKNNKTWNVPAEDFDMVVDTNIKGTANVLRHFVPL 143

Query: 142 LKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT 201
           + +   G  I LSSG           Y ASK AIE L R+ +KE +   L  I + PG  
Sbjct: 144 MIEKRHGIIINLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE-LPPGLAAIALSPGVV 202

Query: 202 RTSM 205
            T M
Sbjct: 203 NTDM 206


>gi|330980267|gb|EGH78408.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 246

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 98/193 (50%), Gaps = 4/193 (2%)

Query: 45  VIACGRSISQLEKLKNALQKINKKID-IFAFDLR--DSNALELTKTYIAKRWGKLDILIA 101
           V+  GR+ + L ++ + +    +    +  FDL+  D        T I +  G+LD L+ 
Sbjct: 40  VLLLGRTEASLAQVHDEINAAGQPQPLVIPFDLQSADPAQYHALATMIERTVGRLDGLLH 99

Query: 102 NAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC 161
           NA I+G  + +  +  + F +V+ VNV A + + ++  P L++S        SS    K 
Sbjct: 100 NASIIGPRTSVEHLPGEDFMEVMHVNVNATFMLTQALLPLLQRSEDASIAFTSSSVGRKG 159

Query: 162 RPLWGAYSASKAAIEALARTWSKETVN-TALRVINIDPGPTRTSMRAKAMPAEDPNTVPH 220
           R  WGAY  SK A E L +T + E    + +R  +I+PG TRT MRA+A P E+P   P 
Sbjct: 160 RAQWGAYGVSKFATEGLMQTLADELEGVSTVRANSINPGATRTGMRAQAYPDENPQNNPA 219

Query: 221 PQKVAKIISFLCA 233
           P+++  +  +L  
Sbjct: 220 PEEIMPVYLYLMG 232


>gi|268315731|ref|YP_003289450.1| short-chain dehydrogenase/reductase SDR [Rhodothermus marinus DSM
           4252]
 gi|262333265|gb|ACY47062.1| short-chain dehydrogenase/reductase SDR [Rhodothermus marinus DSM
           4252]
          Length = 261

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 99/187 (52%), Gaps = 1/187 (0%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIF 72
           ++L +R+  +TG+S GIG   A   AR GA ++ C R + +LE+L   L++  N  + IF
Sbjct: 1   MDLRDRIVFITGASSGIGAACAEAFARIGARLLLCARRLDRLEQLAEHLRRTYNADVHIF 60

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           A D+RD+ A++     + + W  +++L+ NAG+  ++ P++  K +    ++  NV    
Sbjct: 61  ALDVRDAAAVQQAIDNLPENWQAIEVLVNNAGLSRALDPVYANKIEDIDLMVDTNVKGLL 120

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + R+  P +     G  I + S A ++  P    Y A+K A+ A+ R    +   T +R
Sbjct: 121 YVTRAVVPGMLARGRGHVINIGSIAGHEVYPGGTVYCATKHAVGAITRGLKLDLHGTPIR 180

Query: 193 VINIDPG 199
           V  +DPG
Sbjct: 181 VSTVDPG 187


>gi|296170293|ref|ZP_06851884.1| short-chain dehydrogenase/reductase family oxidoreductase
           [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295895016|gb|EFG74735.1| short-chain dehydrogenase/reductase family oxidoreductase
           [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 273

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 106/211 (50%), Gaps = 15/211 (7%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIA---CGR----------SISQLEKLKNAL 62
           L  R+A +TG++RG G   A+ LA+ GA +IA    G+          +   L +    +
Sbjct: 5   LAGRVAFITGAARGQGRAHAVRLAQEGADIIAVDIAGKLPSCVPYDPATPDDLSETVRLV 64

Query: 63  QKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFAD 122
           ++ N++I     D RD   L           G+LDI++ANAG+  +  P  +I  ++F D
Sbjct: 65  EQTNRRIIASIVDTRDFEGLRKAVDDGVAALGRLDIIVANAGV-AAPQPWNEITPENFRD 123

Query: 123 VISVNVMANWN-IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALART 181
           V+ +NV   WN +M   D  ++    G  I++SS A  K +P    Y+ASK A+  +AR 
Sbjct: 124 VMDINVTGTWNTVMAGADKIIEGGRGGSIILISSAAGMKMQPFMIHYTASKHAVAGMARA 183

Query: 182 WSKETVNTALRVINIDPGPTRTSMRAKAMPA 212
           ++ E    ++RV ++ PGP  T M    M A
Sbjct: 184 FAAELGKHSIRVNSVHPGPVNTPMGTGDMVA 214


>gi|86607508|ref|YP_476270.1| short chain dehydrogenase/reductase family oxidoreductase
           [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556050|gb|ABD01007.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 291

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 97/189 (51%), Gaps = 1/189 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L N++ L+TG+S GIG   ALE A+ GA ++   R    L  +K+ ++    +  +   
Sbjct: 3   SLANQVVLITGASAGIGEAVALEAAKRGARLVLAARREGLLRNVKDLVESRGAEALVVPT 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ D+  +E         +G++DIL+ NAG  G + P+ ++   +      VNV     +
Sbjct: 63  DMADTAQVEALAQKALDHFGRVDILVNNAG-YGQMGPVEEVDVAAMRRQFEVNVFGLHAL 121

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R+  P +++   GR + LSS A     P  G Y+A+K A+EAL+     E     ++VI
Sbjct: 122 TRALLPQMRERGSGRILNLSSVAGQMSMPFSGVYNATKFAVEALSDALRVEVAPFGIKVI 181

Query: 195 NIDPGPTRT 203
            I+PGP  T
Sbjct: 182 LIEPGPVAT 190


>gi|297739460|emb|CBI29642.3| unnamed protein product [Vitis vinifera]
          Length = 307

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 103/200 (51%), Gaps = 13/200 (6%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI------------ 65
           NR  L+TG  +G+G   ALE+A+ G  V+ C RS  +L  L++ L  +            
Sbjct: 69  NRTVLITGVGKGLGRALALEIAKRGHTVVGCSRSQDRLTSLQSELSSVASSPQSDSAVSS 128

Query: 66  NKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVIS 125
           + +      D+R ++++E     + ++ G  DI++ NAG +   + IW++ E+ F  VI 
Sbjct: 129 SDRHFFMTVDVRSNSSVEELARAVMEKKGVPDIIVNNAGTINRNNRIWEVPEEEFDTVID 188

Query: 126 VNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE 185
            NV    N+MR F P + ++  G  + +SSG           Y ASK A+E L+R+ +KE
Sbjct: 189 TNVKGTANVMRQFIPLMIENKQGIIVNMSSGWGRSAAAQVAPYCASKWAVEGLSRSVAKE 248

Query: 186 TVNTALRVINIDPGPTRTSM 205
            + + L ++ ++PG   T M
Sbjct: 249 -LPSGLAIVALNPGVINTDM 267


>gi|307325823|ref|ZP_07605023.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
 gi|306888611|gb|EFN19597.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
          Length = 250

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 115/240 (47%), Gaps = 17/240 (7%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L    ALVTG++ GIG   A  LA  GA V+  GR  ++ E L   + +        A D
Sbjct: 7   LQGSTALVTGATSGIGRAVAQRLAGQGAEVVLHGRDRARGEALVKEIAESGGSARFIAAD 66

Query: 76  LRDS-NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           L  + + L+L     A   G++DIL+ NAG+  + +P  Q     F   I+VN  A + +
Sbjct: 67  LTSAEDTLQL-----ASDAGEVDILVNNAGLY-AFAPTAQTDAAGFDRHIAVNTRAPFLL 120

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           + +  P +     G  I + S AA    P+  AY ASKA +E L R W+ E   + +RV 
Sbjct: 121 VGALAPAMAGRGHGAVITIGSSAARTPAPIGAAYGASKAGVEILTRYWATEFGGSGVRVN 180

Query: 195 NIDPGPTRT----SMRAKAMPAEDP----NTVPHPQKVAKIISFLC--ATQKIETGKLFS 244
            + PGP +T    ++    + A D       V  P ++A+I++FL   A+  I    LF+
Sbjct: 181 TVSPGPVKTDGTSAIFGDQIAALDQVNARGRVGEPHEIAEIVAFLASPASSYINGAILFA 240


>gi|317053439|ref|YP_004119206.1| short-chain dehydrogenase/reductase SDR [Pantoea sp. At-9b]
 gi|316953178|gb|ADU72650.1| short-chain dehydrogenase/reductase SDR [Pantoea sp. At-9b]
          Length = 249

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 113/232 (48%), Gaps = 21/232 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L +++ALVTG S GIG  +A ELA  GA V   GR   +L+     +    + I   A  
Sbjct: 5   LSDKIALVTGGSSGIGLASAQELAEQGATVYITGRRQEELDAAVALIGPSARGIRADASV 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D   L+   + IA   GKLDIL ANAG  G + P+  I E+ F  +   NV      +
Sbjct: 65  LSD---LDTVFSTIASASGKLDILFANAG-GGDMMPLGSITEEHFDRIFGTNVRGVLFTV 120

Query: 136 RSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P L     G ++IL+ S AA K    +  YSASKAA+  LAR+W+ +  +  +R+ 
Sbjct: 121 QKALPLLTN---GASVILTGSTAATKGTANFSVYSASKAAVRNLARSWALDLKDRGIRIN 177

Query: 195 NIDPGPTRTSMRAKAMPAEDPN--------TVP-----HPQKVAKIISFLCA 233
            + PGP RT      +P E            VP      P+++ K ++FL +
Sbjct: 178 VVSPGPIRTPGLGGLVPEEHRQGLFDMLAAGVPLGRLGEPEEIGKTVAFLAS 229


>gi|75909098|ref|YP_323394.1| short-chain dehydrogenase/reductase SDR [Anabaena variabilis ATCC
           29413]
 gi|75702823|gb|ABA22499.1| Short-chain dehydrogenase/reductase SDR [Anabaena variabilis ATCC
           29413]
          Length = 257

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 117/234 (50%), Gaps = 16/234 (6%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIF 72
           ++L N++ L+TG+S GIG   A   A +GA +I   R + +L++L + L Q    +  + 
Sbjct: 2   ISLKNQIVLITGASSGIGNACARIFAGAGAKLILAARRLERLQQLADELNQDFGVETHLL 61

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+RD + +E   T +   W  +DILI NAG+   +  +++   + + ++I  N+    
Sbjct: 62  QLDVRDRSHVESAITSLPPAWSAIDILINNAGLSRGLDKLYEGDFQDWEEMIDTNIKGLL 121

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + R   P +     G  I L S A ++  P    Y  +KAA++A++    ++ + T +R
Sbjct: 122 YLTRYVVPGMVNRGRGHVINLGSIAGHQTYPGGNVYCGTKAAVKAISEGLKQDLLGTPVR 181

Query: 193 VINIDPGPTRTSM----------RAKAM-PAEDPNTVPHPQKVAKIISFLCATQ 235
           V ++DPG   T            RAK +    +P T   P+ VA +I F CAT+
Sbjct: 182 VTSVDPGMVETEFSEVRFHGDTERAKKVYQGVNPLT---PEDVADVI-FFCATR 231


>gi|145224950|ref|YP_001135628.1| short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum
           PYR-GCK]
 gi|315445281|ref|YP_004078160.1| hypothetical protein Mspyr1_37200 [Mycobacterium sp. Spyr1]
 gi|145217436|gb|ABP46840.1| short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum
           PYR-GCK]
 gi|315263584|gb|ADU00326.1| dehydrogenase of unknown specificity, short-chain alcohol
           dehydrogenase like protein [Mycobacterium sp. Spyr1]
          Length = 271

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 102/212 (48%), Gaps = 17/212 (8%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACG-------------RSISQLEKLKN 60
           + L+ R+A +TG++RG G   A+ +A+ GA +IA                +   L +   
Sbjct: 1   MRLEGRVAFITGAARGQGRAHAVRMAKEGADIIAVDIAGPLPPCVPYDHATADDLAETVE 60

Query: 61  ALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQ-IKEKS 119
            ++   ++I   A D RD +AL           G+LDI++ANAG+  +    W  I  + 
Sbjct: 61  LVKATGRRIIASAVDTRDGDALTAAVDSGVAELGRLDIIVANAGV--TAPQAWDDISAED 118

Query: 120 FADVISVNVMANWN-IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEAL 178
           F DVI VNV   WN +M      +     G  I++SS A  K +P    Y+ASK A+  +
Sbjct: 119 FRDVIDVNVTGTWNTVMAGAHKIVDGGRGGSIILISSAAGIKLQPFMIHYTASKHAVTGM 178

Query: 179 ARTWSKETVNTALRVINIDPGPTRTSMRAKAM 210
           AR ++ E    ++RV ++ PGP  T M    M
Sbjct: 179 ARAFAAELGKHSIRVNSVHPGPVVTDMGTGDM 210


>gi|114775427|ref|ZP_01450995.1| short chain dehydrogenase [Mariprofundus ferrooxydans PV-1]
 gi|114553538|gb|EAU55919.1| short chain dehydrogenase [Mariprofundus ferrooxydans PV-1]
          Length = 242

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 106/226 (46%), Gaps = 1/226 (0%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           D  + +VTG+S G+G    + L + GA VIA  R +  L K ++ +++   +     FDL
Sbjct: 7   DKSIVMVTGASAGLGRAVCVSLGKMGANVIALARDVDALAKTQDLVEQAGGRCLCVPFDL 66

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
            + +A       +  +   LD LI  AG L   +P+  +K   F  ++ +++ A   + +
Sbjct: 67  LEFDAYGKLFLRLKDQIPHLDGLIHCAGSLQYCTPMQYVKTDDFRAMLDIHLTAPNMLTQ 126

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
           S  P ++++     +  S        P W AY  +K A+   A  W  E  + A R + I
Sbjct: 127 SMLPLIRRAEEATVVFTSCEMLDNDLPNWHAYGLAKRALGYAAAMWHAEHADKAYRFVTI 186

Query: 197 DPGPTRTSMRAKAMPAEDPNTVPHPQKVAK-IISFLCATQKIETGK 241
           DPG  RT++  +A    DP  VP P++ A+  +  L AT     GK
Sbjct: 187 DPGRMRTALFRRAFMGMDPMEVPGPEQAAEGFLRMLAATADAVNGK 232


>gi|254819182|ref|ZP_05224183.1| carveol dehydrogenase [Mycobacterium intracellulare ATCC 13950]
          Length = 273

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 105/210 (50%), Gaps = 17/210 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIA---CGR----------SISQLEKLKNAL 62
           L  ++AL+TG++RG G   A+ +A  GA +IA    G+          S   L +    +
Sbjct: 5   LAGKVALITGAARGQGRAHAVRMASEGADIIAVDIAGKLPSCVPYDPASPDDLSETVRLV 64

Query: 63  QKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQ-IKEKSFA 121
           ++ N++I     D RD + L           G+LDI++ANAG+    +  W  I  + F 
Sbjct: 65  EETNRRIIASVVDTRDFDGLRRVVADGVAALGRLDIIVANAGVAAPQA--WDDITPEDFR 122

Query: 122 DVISVNVMANWN-IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
           DV+ +NV   WN +M   D  ++    G  I++SS A  K +P    Y+ASK A+  LAR
Sbjct: 123 DVMDINVTGTWNTVMAGADKIIEGGRGGSIILISSAAGMKMQPFMIHYTASKHAVTGLAR 182

Query: 181 TWSKETVNTALRVINIDPGPTRTSMRAKAM 210
            ++ E    ++RV ++ PGP  T M +  M
Sbjct: 183 AFAAELGKHSIRVNSVHPGPVNTPMGSGDM 212


>gi|225465259|ref|XP_002268804.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 264

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 103/200 (51%), Gaps = 13/200 (6%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI------------ 65
           NR  L+TG  +G+G   ALE+A+ G  V+ C RS  +L  L++ L  +            
Sbjct: 26  NRTVLITGVGKGLGRALALEIAKRGHTVVGCSRSQDRLTSLQSELSSVASSPQSDSAVSS 85

Query: 66  NKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVIS 125
           + +      D+R ++++E     + ++ G  DI++ NAG +   + IW++ E+ F  VI 
Sbjct: 86  SDRHFFMTVDVRSNSSVEELARAVMEKKGVPDIIVNNAGTINRNNRIWEVPEEEFDTVID 145

Query: 126 VNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE 185
            NV    N+MR F P + ++  G  + +SSG           Y ASK A+E L+R+ +KE
Sbjct: 146 TNVKGTANVMRQFIPLMIENKQGIIVNMSSGWGRSAAAQVAPYCASKWAVEGLSRSVAKE 205

Query: 186 TVNTALRVINIDPGPTRTSM 205
            + + L ++ ++PG   T M
Sbjct: 206 -LPSGLAIVALNPGVINTDM 224


>gi|118471716|ref|YP_891027.1| short-chain dehydrogenase/reductase SDR [Mycobacterium smegmatis
           str. MC2 155]
 gi|118173003|gb|ABK73899.1| short-chain dehydrogenase/reductase SDR [Mycobacterium smegmatis
           str. MC2 155]
          Length = 244

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 116/234 (49%), Gaps = 23/234 (9%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            LD + ALVTG + GIG+  A  L + GAYV   GR  ++ EK   ++     + D+   
Sbjct: 3   QLDGKTALVTGGTSGIGHAAAKRLVQEGAYVFITGRDRTRAEKAAASIGAHGVQSDVSNP 62

Query: 75  DLRDSNALELTKTYIAKRWGK-LDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           D  D+ A E+ +      +GK LD++ ANAG  G  + + ++  + + D I  NV     
Sbjct: 63  DELDALAAEIAE------YGKGLDVVFANAG-GGDYATLAEVTPQHYRDNIDRNVGGTVF 115

Query: 134 IMRSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            ++   P L     G +IIL+ S A  K  P +G Y+ASKAAI +L RTW+ E V+  +R
Sbjct: 116 TVQKILPLLND---GASIILTGSTAPAKGTPAFGLYAASKAAIRSLGRTWAAELVDRNIR 172

Query: 193 VINIDPGPTRTSMRAKAMP----------AEDP-NTVPHPQKVAKIISFLCATQ 235
           V  + PGP RT       P          A+ P   +  P ++A  + FL + Q
Sbjct: 173 VNTVIPGPIRTPGLEGLAPDGQRELDGWAAQVPMKRLGDPDEIATAVLFLASNQ 226


>gi|329935865|ref|ZP_08285668.1| 3-oxoacyl-[acyl-carrier protein] reductase [Streptomyces
           griseoaurantiacus M045]
 gi|329304708|gb|EGG48583.1| 3-oxoacyl-[acyl-carrier protein] reductase [Streptomyces
           griseoaurantiacus M045]
          Length = 250

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 114/246 (46%), Gaps = 15/246 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R ALVTG++ GIG   A  LAR GA V+  GR  S+ E L   L            D
Sbjct: 7   LQGRTALVTGATSGIGKAIAQNLARQGAMVVLHGRDQSRGETLVKDLVTQGATARFITAD 66

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D+         +A   G +DIL+++AG+    +P       SF   I+VN  A + ++
Sbjct: 67  LSDAEG----PLRLAAEAGSVDILVSSAGLY-EFTPTAATDAASFDRHIAVNTRAPFLLV 121

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
            +  P + +   G  +++ S AA    P+  AY ASKA +E L R W+ E   + +RV  
Sbjct: 122 GALAPAMAERGQGSIVLVGSNAARLPAPIGAAYGASKAGVEILTRYWATEFGPSGVRVNT 181

Query: 196 IDPGPTRT----SMRAKAMPAEDPNT----VPHPQKVAKIISFLC--ATQKIETGKLFSV 245
           + PGP  T    ++  + +   D          P ++A+I+SFL   A+  +    LF+ 
Sbjct: 182 VSPGPVHTEGTQAIFGEHLAVLDSTNARGRAGDPAEIAEIVSFLAGPASSYVNGAVLFAD 241

Query: 246 PQNRFV 251
              R V
Sbjct: 242 GGERSV 247


>gi|298248775|ref|ZP_06972580.1| short-chain dehydrogenase/reductase SDR [Ktedonobacter racemifer
           DSM 44963]
 gi|297551434|gb|EFH85300.1| short-chain dehydrogenase/reductase SDR [Ktedonobacter racemifer
           DSM 44963]
          Length = 249

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 123/237 (51%), Gaps = 26/237 (10%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++A++TG + GIG  TA      GAYV   GR   +L+    A+Q+I + +     D
Sbjct: 4   LEGKVAVITGGNSGIGLATAKRFVAEGAYVYITGRRKPELDA---AVQQIGQNVTGMQGD 60

Query: 76  LRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           +  SN  +L + Y  + ++   +D++ ANAG LG+ +P+ +I E +F  V +VNV     
Sbjct: 61  V--SNLADLDRLYATVQQQHDHIDVVFANAG-LGNGAPLGEISEANFDKVFAVNVKGLLF 117

Query: 134 IMRSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            ++   P+L++   G +IIL+ S    K  P    Y+AS AAI + AR+W+ +     +R
Sbjct: 118 TVQKALPFLRE---GSSIILTASSTTRKVGPAMSVYAASNAAIRSFARSWTLDLKGRNIR 174

Query: 193 VINIDPGPT---------RTSMRAKAMPAEDPNTVP-----HPQKVAKIISFLCATQ 235
           V  + PGPT         +T  + + + A    TVP      P ++AK + FL + +
Sbjct: 175 VNAVSPGPTVTPGISRLAQTEEQRQQLFAAFAATVPLGRMADPDEIAKAVVFLASDE 231


>gi|284038606|ref|YP_003388536.1| short-chain dehydrogenase/reductase SDR [Spirosoma linguale DSM 74]
 gi|283817899|gb|ADB39737.1| short-chain dehydrogenase/reductase SDR [Spirosoma linguale DSM 74]
          Length = 250

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 120/235 (51%), Gaps = 16/235 (6%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKID 70
           + ++L  ++A+VTGSS+GIG   A ELA  GA VI    S +S  E + NA+++   +  
Sbjct: 1   MKIDLTQKVAIVTGSSKGIGAAIAKELAACGAIVIVTYHSAVSDAEGVANAIRETGGQAI 60

Query: 71  IFAFDL-RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
               D+ R ++ ++L K  + +R+GKLD+L+ NAGI     PI  + E  F +   VNV+
Sbjct: 61  ALQADMARHADIIDLLKQ-VKERFGKLDVLVNNAGI-ARFGPIEAVTEDDFLEQYRVNVL 118

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
                ++    +  K+  G  + +SS       P    Y++SKAA+ AL  + S+E VN 
Sbjct: 119 GPMLTIQESLKYFPKTG-GSIVNISSVGGQNPGPYTSIYTSSKAALNALTVSLSRELVNR 177

Query: 190 ALRVINIDPGPTRT----------SMRAKAMPAEDP-NTVPHPQKVAKIISFLCA 233
            +RV  + PGPT T          S   K M A  P      P ++A  ++FL +
Sbjct: 178 RIRVNTVAPGPTDTEGSKALGLAGSAIEKGMIAAIPMGRFGKPDEIAPAVAFLAS 232


>gi|159186238|ref|NP_356065.2| dehydrogenase [Agrobacterium tumefaciens str. C58]
 gi|159141372|gb|AAK88850.2| dehydrogenase [Agrobacterium tumefaciens str. C58]
          Length = 249

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/255 (27%), Positives = 126/255 (49%), Gaps = 30/255 (11%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVI----ACGRSISQLEKLKNALQKINKK 68
           H +LD R+A+VTG++ G G   +  L   GA VI            L  L +A       
Sbjct: 4   HYDLDGRVAVVTGATGGFGVAISQRLRDCGATVIHWDLPAAVKDGALGDLPHA------- 56

Query: 69  IDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
                 D+ D+ ++E     + +R+G+LDIL+ NAGI+G+++P+W+I  + F  +I +N+
Sbjct: 57  ----GVDISDAKSIETAAIDLKQRFGRLDILVNNAGIVGNVAPLWEIPIEEFRRIIDINL 112

Query: 129 MANWNIMRSFDPWL----KKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSK 184
             ++ + R+  P +    + S  GR + ++S  A +      AYSASKA + A+ ++  K
Sbjct: 113 FGSFLVCRALVPLMIETARTSRFGRIVNVASIQAKEGMHQAAAYSASKAGLVAMTKSLGK 172

Query: 185 ETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTV---------PHPQKVAKIISFLCATQ 235
           E     + V  I P  + T+M   A P E  + +           P +VA ++++L +++
Sbjct: 173 ELATADILVNAITPAASMTAMSIDA-PKERLDDILSRIPMRRFLEPAEVANMVAWLSSSE 231

Query: 236 -KIETGKLFSVPQNR 249
               TG +F +   R
Sbjct: 232 CSFSTGAVFDLSGGR 246


>gi|294677946|ref|YP_003578561.1| short-chain dehydrogenase/reductase family oxidoreductase
           [Rhodobacter capsulatus SB 1003]
 gi|294476766|gb|ADE86154.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Rhodobacter capsulatus SB 1003]
          Length = 218

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 3/197 (1%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            +LALVTG+SRG+G+  A ELA  G +++A  R++  LE L + +Q       +   D+ 
Sbjct: 7   KKLALVTGASRGLGFAIAEELAAEGWHIMAVARTVGGLEALDDVIQAKGGSATLAPLDIT 66

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
               +E     I  RWG L + I  A     +SP      K     ++ N+     ++  
Sbjct: 67  KPEEMETLANGILGRWGGLQLWIHTAVHAAPLSPAAHSDAKDMEKSVATNLTGTATLIPL 126

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
            DP L+    G A+      A   +P +G+Y A+KAA  ALAR+++ E      +V  + 
Sbjct: 127 IDPLLRAGD-GTAVFFEDDRA--GQPYFGSYGATKAAQIALARSYAVEAAKIGPKVKIVA 183

Query: 198 PGPTRTSMRAKAMPAED 214
           P P  T++RA+  P+ED
Sbjct: 184 PRPMATAVRARFFPSED 200


>gi|256423824|ref|YP_003124477.1| short-chain dehydrogenase/reductase SDR [Chitinophaga pinensis DSM
           2588]
 gi|256038732|gb|ACU62276.1| short-chain dehydrogenase/reductase SDR [Chitinophaga pinensis DSM
           2588]
          Length = 249

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 106/203 (52%), Gaps = 6/203 (2%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           +N   +LA+VTG   GIG+  A +  +   Y +  GR     +KL+NA +++    + + 
Sbjct: 1   MNTTKKLAIVTGGGSGIGFAIATQFVQHNIYTVIVGR---DEQKLRNACEQLGPGSECYT 57

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DL D NA+ +    I  R+G +DIL+ NAGI    S   ++ ++ F D++  NV A + 
Sbjct: 58  CDLSDLNAIPVMVDMIISRYGHIDILVNNAGINMKKS-FTEVTDEEFQDILQTNVTAVFA 116

Query: 134 IMRS-FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           + R      L+K   G  I +SS A+    P   AY+ASK+AIE + +  + E     +R
Sbjct: 117 LSREVVKHQLEKKISGCLINISSMASQYGIPKVIAYTASKSAIEGMTKAMATELSPYGIR 176

Query: 193 VINIDPGPTRTSMRAKAMPAEDP 215
           +  I PG   T M AKA+ + DP
Sbjct: 177 INCIAPGFIATDMSAKALES-DP 198


>gi|17227971|ref|NP_484519.1| hypothetical protein all0475 [Nostoc sp. PCC 7120]
 gi|17129820|dbj|BAB72433.1| all0475 [Nostoc sp. PCC 7120]
          Length = 257

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 16/234 (6%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIF 72
           ++L N++ L+TG+S GIG   A   A +GA +I   R +++L++L + L Q    +I + 
Sbjct: 2   ISLKNQIVLITGASSGIGNACARIFAGAGAKLILAARRLARLQQLADELNQDFGVEIHLL 61

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+RD  ++E     +   W  +DILI NAG+   +  + +   + + ++I  NV    
Sbjct: 62  QLDVRDRPSVESAIASLPPAWSAIDILINNAGLSRGLDKLHEGDLQDWEEMIDTNVKGLL 121

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + R   P +     G  I L S A ++  P    Y  +KAA++A++    ++ + T +R
Sbjct: 122 YLTRYVVPGMVNRGRGHVINLGSIAGHQTYPGGNVYCGTKAAVKAISEGLKQDLLGTPVR 181

Query: 193 VINIDPGPTRTSM----------RAKAM-PAEDPNTVPHPQKVAKIISFLCATQ 235
           V ++DPG   T            RAK +    +P T   P+ VA +I F CAT+
Sbjct: 182 VTSVDPGMVETEFSEVRFHGDTERAKKVYQGVNPLT---PEDVADVI-FFCATR 231


>gi|183981037|ref|YP_001849328.1| short-chain dehydrogenase/reductase [Mycobacterium marinum M]
 gi|183174363|gb|ACC39473.1| short-chain dehydrogenase/reductase [Mycobacterium marinum M]
          Length = 275

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 108/205 (52%), Gaps = 15/205 (7%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIA---CG----------RSISQLEKLKNA 61
           +LD R+A VTG++R  G   A+ LAR GA +IA   CG           + + L +   A
Sbjct: 7   SLDGRVAFVTGAARAQGRSHAVRLAREGADIIAMDICGPVSETITYAPATAADLSETIRA 66

Query: 62  LQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFA 121
           ++   +K+     D+RDS AL+       + +G+LD+++ANAG+LG    +W++ ++ + 
Sbjct: 67  VESEGRKVLARQADVRDSAALQQLVADGVEEFGRLDVVVANAGVLG-WGRLWELTDEQWD 125

Query: 122 DVISVNVMANWNIMRSFDP-WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
            VI VN+   W  +R+  P  ++  + G  I++SS A  K  P  G Y+ASK  + AL  
Sbjct: 126 TVIGVNLSGTWRTLRAAVPAMIEAGNGGSIIVVSSSAGLKATPGNGHYAASKHGLVALTN 185

Query: 181 TWSKETVNTALRVINIDPGPTRTSM 205
           T + E     +RV +I P    T M
Sbjct: 186 TLAIELGEYDIRVNSIHPYSVETPM 210


>gi|218245773|ref|YP_002371144.1| short chain dehydrogenase [Cyanothece sp. PCC 8801]
 gi|218166251|gb|ACK64988.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 8801]
          Length = 242

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 116/232 (50%), Gaps = 6/232 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            R A++TG+S GIG  TAL  A++G  +    RS  QLE +  A +++      +  DL 
Sbjct: 7   QRRAIITGASSGIGKATALAFAKAGIDLALVSRSADQLEAVAQAAREVGALAQTYVIDLS 66

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
               +      I + +G +DI++ NAG +G  + + +     +  V+ +NV + +  +R 
Sbjct: 67  QLAEIPTKIQAIIEDFGHIDIIVNNAG-MGYTNLLGETSLSDWQRVMDLNVTSIFQCVRG 125

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P ++    G  I +SS AA+   P WGAYS SKAA+ A ++  + E     +RVI I 
Sbjct: 126 ILPQMRDRGQGTIINVSSIAAFNTFPQWGAYSVSKAALAAFSKVLAAEERAHGIRVITIS 185

Query: 198 PGPTRTSM-RAKAMPAE-DPNTVPHPQKVAKII---SFLCATQKIETGKLFS 244
           PG   TS+   + + A+ D + +  P  VA+ I   + L A   IE   + S
Sbjct: 186 PGSVNTSIWDTETVQADFDRSAMLSPDTVAQTILHAALLPAEAVIEEMTILS 237


>gi|229590510|ref|YP_002872629.1| putative oxidoreductase [Pseudomonas fluorescens SBW25]
 gi|229362376|emb|CAY49278.1| putative oxidoreductase [Pseudomonas fluorescens SBW25]
          Length = 249

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 96/189 (50%), Gaps = 8/189 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++A+VTG + GIG  TA+  A  GA V+  GR   + E+L  AL  I         D
Sbjct: 4   LNGKIAVVTGGNSGIGLATAIRFAAEGAQVVIVGR---RQEELDKALHLIGADAIAIQGD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +   + LE   T +    G++D+L ANAG LG   PI  I E+SF     +NV      +
Sbjct: 61  ISRLDDLERIFTQVKADKGRVDVLFANAG-LGDFQPIGSITEESFDRTFGINVKGTLFTV 119

Query: 136 RSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           ++  P +   H G ++IL  S       P +  YSA+KAA+   AR+W+ +   T +RV 
Sbjct: 120 QAALPLM---HAGSSVILTGSTTGTMGTPAFSVYSATKAALRNFARSWALDLKGTGIRVN 176

Query: 195 NIDPGPTRT 203
            + PGP  T
Sbjct: 177 VLSPGPIST 185


>gi|17232778|ref|NP_489326.1| short chain dehydrogenase [Nostoc sp. PCC 7120]
 gi|17134425|dbj|BAB76985.1| alr5286 [Nostoc sp. PCC 7120]
          Length = 255

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 100/190 (52%), Gaps = 7/190 (3%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R AL+TG+S GIG  TAL  A++G  V    RS+ +L  +  A ++       +  DL D
Sbjct: 21  RRALITGASSGIGKATALAFAKAGIDVALVSRSLDKLTPVVEATKQTGVVAKAYTVDLAD 80

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFAD---VISVNVMANWNIM 135
            + +E     IA  +G +DIL+ NAG+  + +    + E   AD   VI++N+   +  +
Sbjct: 81  VSQVEAKIQAIAIDFGDIDILVNNAGVAYTAT----LSETPLADWQQVINLNLTGVFECI 136

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P ++  H G  I +SS AA +  P WG YS SKA + AL++T ++E     +RV  
Sbjct: 137 KGILPTMRDRHTGTIINVSSIAAKQSFPHWGVYSVSKAGLMALSQTLAQEERVHGIRVTA 196

Query: 196 IDPGPTRTSM 205
           I PG   T +
Sbjct: 197 ICPGAVNTGL 206


>gi|149180392|ref|ZP_01858897.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Bacillus sp. SG-1]
 gi|148852584|gb|EDL66729.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Bacillus sp. SG-1]
          Length = 237

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 108/216 (50%), Gaps = 2/216 (0%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L  + AL+TG+ RGIG  TA+ LA+ G  +   G ++  LEK+   L + + ++    
Sbjct: 1   MDLKGKSALITGAGRGIGRATAIALAKEGVNIGLVGLTMENLEKVAEELSQYDVQVSAAT 60

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ D  ++     +I    G +DILI NAGI G       +  + +  +I VN+M  +N
Sbjct: 61  ADVSDLESVNHATEHIKSDLGPIDILINNAGI-GKFGGFLDLDPQEWEKIIRVNLMGVYN 119

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
             R+  P + +   G  I +SS A  K  P+  AYSASK  +  L  +  +E     +RV
Sbjct: 120 ATRAVLPEMIERKTGDIINVSSTAGQKGAPVTSAYSASKFGVLGLTESLMQEVRKHNIRV 179

Query: 194 INIDPGPTRTSM-RAKAMPAEDPNTVPHPQKVAKII 228
             + P    T + +   + +++   V  P+ +A++I
Sbjct: 180 TALTPSTVVTDLAQENNLLSDNTENVMQPEDLAELI 215


>gi|293609074|ref|ZP_06691377.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829647|gb|EFF88009.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325121151|gb|ADY80674.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 244

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 119/225 (52%), Gaps = 12/225 (5%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           + ++ALVTG+SRGIG   A +L + G +V+    S S  +KL ++  +    +   A D+
Sbjct: 4   ERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLSDSFGEQGAGL---ALDV 60

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
           R+ + +E   ++I + +G + +L+ NAGI    + + ++ E  + D++++++ A + + +
Sbjct: 61  RNLDEIEAVVSHIEQNYGPVLVLVNNAGITKD-NLLLRMSEDDWDDILNIHLKAVYRLSK 119

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
                + K+  GR I +SS  A+   P    YSA+KA IEA +R+ +KE  +  + V ++
Sbjct: 120 RVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSV 179

Query: 197 DPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            PG   T M        R K       N +  PQ +A  +SFL +
Sbjct: 180 APGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLAS 224


>gi|119386422|ref|YP_917477.1| short-chain dehydrogenase/reductase SDR [Paracoccus denitrificans
           PD1222]
 gi|119377017|gb|ABL71781.1| short-chain dehydrogenase/reductase SDR [Paracoccus denitrificans
           PD1222]
          Length = 236

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 101/197 (51%), Gaps = 3/197 (1%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +++AL+TG+SRG+G   A  LA  G +++A  R+   LE+L + ++K      +   D+ 
Sbjct: 24  DKIALITGASRGLGAALAETLAARGWHILAVARTTGALEELDDRIRKAGGSATLAPMDVG 83

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
              A+      + +RWG LD+    A     +SP   I  K F   + +N++A   ++  
Sbjct: 84  QPEAMVQMARAVMERWGGLDLWAHTAIHAAPLSPAGHIDAKDFQKSVDLNIVATRGLINL 143

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
            +P L ++  G A+      A +    +G+Y A+KA   ALA++W  E  +   RV+  +
Sbjct: 144 IEPLL-RARKGTALFFDDKRAGQ--KFFGSYGATKAGQIALAQSWRAENASLGPRVVIAE 200

Query: 198 PGPTRTSMRAKAMPAED 214
           P P  T++RA+  P ED
Sbjct: 201 PAPMPTAVRARFFPGED 217


>gi|256423604|ref|YP_003124257.1| short-chain dehydrogenase/reductase SDR [Chitinophaga pinensis DSM
           2588]
 gi|256038512|gb|ACU62056.1| short-chain dehydrogenase/reductase SDR [Chitinophaga pinensis DSM
           2588]
          Length = 247

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 111/235 (47%), Gaps = 28/235 (11%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
             D ++ ++TG + GIGY TA      GA VI  G       K ++AL+K   ++D+   
Sbjct: 3   TFDGKVVVITGGNSGIGYATARAFKELGASVIITG-------KREDALKKAAAELDVTG- 54

Query: 75  DLRDSNALELTKTYIAKRW---GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            L D  +LE   T +A+     GK+D+L  NAG+    +PI    E+ F  +I VN   +
Sbjct: 55  KLTDQASLEDIDTLVAELQHTSGKVDVLFINAGV-AFFAPIEYTSEEQFDTMIDVNFKGS 113

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           +  ++ F P L        I L+SG           YSASK+A+  LAR  +KE     +
Sbjct: 114 FFTLQKFIPILNDGAA--VIFLTSGNTALVMENSAVYSASKSAVGHLARIAAKELAPRKI 171

Query: 192 RVINIDPGPTRTSMRAK---------AMPAEDPNTVP-----HPQKVAKIISFLC 232
           RV  ++PGPT T M+ K         AM  +    VP      P+ VA ++ +L 
Sbjct: 172 RVNTVNPGPTETEMQQKFGFDEATLAAMKGQILTQVPLAKMGRPEDVASMVVYLA 226


>gi|125582521|gb|EAZ23452.1| hypothetical protein OsJ_07145 [Oryza sativa Japonica Group]
          Length = 247

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 91/187 (48%), Gaps = 2/187 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R  L+TG SRG+G   ALELAR G  V+ CGRS   +  L+  +    ++    A    D
Sbjct: 23  RTVLITGVSRGLGRALALELARRGHAVVGCGRSADHVRSLEAEIATPARQFLTVADVRSD 82

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           SN  EL K  + K+    DI++ NAG +   +  W +  + F  V+  N+    N++R F
Sbjct: 83  SNMAELAKAVVEKKQVP-DIIVNNAGTINKNNKTWSVPAEEFDTVVDTNIKGTANVLRHF 141

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P + +   G  + LSSG           Y ASK AIE L R+ +KE +   L  I + P
Sbjct: 142 IPLMIEKKHGIIVNLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE-LPPGLAAIALSP 200

Query: 199 GPTRTSM 205
           G   T M
Sbjct: 201 GVVNTDM 207


>gi|74317717|ref|YP_315457.1| oxidoreductase [Thiobacillus denitrificans ATCC 25259]
 gi|74057212|gb|AAZ97652.1| probable oxidoreductase [Thiobacillus denitrificans ATCC 25259]
          Length = 247

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 112/227 (49%), Gaps = 4/227 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  R+ LVTG+S G+G   +L  AR GA V    R+ ++LE + + +      +  +F F
Sbjct: 11  LAGRVILVTGASAGLGRAASLAFARHGATVALLARNEAKLEAVYDEIVAAGGPEPAMFPF 70

Query: 75  DLR--DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL   D  +LE     +A   G+LD L+ +A    S++P+     + +  ++ VN++A +
Sbjct: 71  DLAVADDRSLENLAGTLAHHLGRLDGLLHSAHQFFSLTPLSLQTLEQWQTLMRVNLIAPF 130

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT-AL 191
            + R+  P L+++     +       +     WG Y+ +K+ +E L R WS E  ++ +L
Sbjct: 131 ALTRAVMPLLQQAPDASVVFTGETHGHSPSAYWGGYAVAKSGLETLTRIWSDELASSESL 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE 238
           R+  + PG   T++RA+  P     T+P P+ V     FL      E
Sbjct: 191 RINTLIPGQVATTLRARTYPGVAAETLPSPEAVMPWYLFLMGEDGRE 237


>gi|298492132|ref|YP_003722309.1| short-chain dehydrogenase/reductase SDR ['Nostoc azollae' 0708]
 gi|298234050|gb|ADI65186.1| short-chain dehydrogenase/reductase SDR ['Nostoc azollae' 0708]
          Length = 256

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 115/230 (50%), Gaps = 9/230 (3%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++++N++ L+TG+S GIG   A   A++GA +I   R   +L++    L   + KI +  
Sbjct: 2   ISVNNQIVLITGASSGIGASCAKVFAQAGAKLILAARRCDRLQEFTKTLNLPDDKIHLLQ 61

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ D  A+E   + +   W K+DILI NAG+   ++ +++   + + ++I  N+     
Sbjct: 62  LDVCDHTAVESAISNLPPDWSKIDILINNAGLSRGLNKLYEGDFQDWEEMIDTNIKGLLY 121

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + R   P + K + G  I + S A ++  P    Y  +KAA++A++    ++ + T +RV
Sbjct: 122 LTRYVVPSMVKRNRGHIINIGSIAGHQTYPGGNVYCGTKAAVKAISEGLKQDLLGTRVRV 181

Query: 194 INIDPGPTRTSMR--------AKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
            ++DPG   T            +A    +  T   P  VA ++ F C T+
Sbjct: 182 SSVDPGMVETEFSEVRFHGDTERAKKVYEGLTPLTPNDVADVV-FFCTTR 230


>gi|262280077|ref|ZP_06057862.1| dehydrogenase with different specificities [Acinetobacter
           calcoaceticus RUH2202]
 gi|262260428|gb|EEY79161.1| dehydrogenase with different specificities [Acinetobacter
           calcoaceticus RUH2202]
          Length = 244

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 118/225 (52%), Gaps = 12/225 (5%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           + ++ALVTG+SRGIG   A +L + G +V+    S S  +KL  +  +    +   A D+
Sbjct: 4   ERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLSESFGEQGAGL---ALDV 60

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
           R+ + +E   ++I + +G + IL+ NAGI    + + ++ E  + D++++++ A + + +
Sbjct: 61  RNLDEIEAVVSHIEQNYGPVLILVNNAGITKD-NLLLRMSEDDWDDILNIHLKAVYRLSK 119

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
                + K+  GR I +SS  A+   P    YSA+KA IEA +R+ +KE  +  + V ++
Sbjct: 120 RVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSV 179

Query: 197 DPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            PG   T M        R K       N +  PQ +A  +SFL +
Sbjct: 180 APGFIATEMTDALSEEIRKKMSDQVALNRLGEPQDIANAVSFLAS 224


>gi|257058819|ref|YP_003136707.1| short chain dehydrogenase [Cyanothece sp. PCC 8802]
 gi|256588985|gb|ACU99871.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 8802]
          Length = 242

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 116/232 (50%), Gaps = 6/232 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            R A++TG+S GIG  TAL  A++G  +    RS  QLE +  A +++      +  DL 
Sbjct: 7   QRRAIITGASSGIGKATALAFAKAGIDLALVSRSADQLEAVAQAAREVGVLAQTYVIDLS 66

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
               +      I + +G +DI++ NAG +G  + + +     +  V+ +NV + +  +R 
Sbjct: 67  QLAEIPTKIQAIIEDFGHIDIIVNNAG-MGYTNLLGETSLSDWQRVMDLNVTSIFQCVRG 125

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P ++    G  I +SS AA+   P WGAYS SKAA+ A ++  + E     +RVI I 
Sbjct: 126 ILPQMRDRGQGTIINVSSIAAFNTFPQWGAYSVSKAALAAFSKVLAAEERAHGIRVITIS 185

Query: 198 PGPTRTSM-RAKAMPAE-DPNTVPHPQKVAKII---SFLCATQKIETGKLFS 244
           PG   TS+   + + A+ D + +  P  VA+ I   + L A   IE   + S
Sbjct: 186 PGSVNTSIWDTETVQADFDRSAMLSPDTVAQTILHAALLPAEAVIEEMTILS 237


>gi|299771349|ref|YP_003733375.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter sp. DR1]
 gi|298701437|gb|ADI92002.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter sp. DR1]
          Length = 244

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 118/225 (52%), Gaps = 12/225 (5%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           + ++ALVTG+SRGIG   A +L + G +V+    S S  +KL  +  +    +   A D+
Sbjct: 4   ERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLSESFGEHGAGL---ALDV 60

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
           R+ + +E   ++I + +G + IL+ NAGI    + + ++ E  + D++++++ A + + +
Sbjct: 61  RNLDEIEAVVSHIEQNYGPVLILVNNAGITKD-NLLLRMSEDDWDDILNIHLKAVYRLSK 119

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
                + K+  GR I +SS  A+   P    YSA+KA IEA +R+ +KE  +  + V ++
Sbjct: 120 RVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSV 179

Query: 197 DPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            PG   T M        R K       N +  PQ +A  +SFL +
Sbjct: 180 APGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLAS 224


>gi|169634113|ref|YP_001707849.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           SDF]
 gi|169796991|ref|YP_001714784.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           AYE]
 gi|184157096|ref|YP_001845435.1| dehydrogenase [Acinetobacter baumannii ACICU]
 gi|213156603|ref|YP_002318264.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter baumannii
           AB0057]
 gi|215484453|ref|YP_002326686.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter baumannii
           AB307-0294]
 gi|239501223|ref|ZP_04660533.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter baumannii
           AB900]
 gi|260555717|ref|ZP_05827937.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           ATCC 19606]
 gi|301347354|ref|ZP_07228095.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter baumannii
           AB056]
 gi|301510852|ref|ZP_07236089.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter baumannii
           AB058]
 gi|301594330|ref|ZP_07239338.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter baumannii
           AB059]
 gi|332852079|ref|ZP_08433906.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           6013150]
 gi|332867477|ref|ZP_08437630.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           6013113]
 gi|332872672|ref|ZP_08440640.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           6014059]
 gi|169149918|emb|CAM87812.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           AYE]
 gi|169152905|emb|CAP01946.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter
           baumannii]
 gi|183208690|gb|ACC56088.1| Dehydrogenase with different specificities [Acinetobacter baumannii
           ACICU]
 gi|193076592|gb|ABO11256.2| hypothetical protein A1S_0818 [Acinetobacter baumannii ATCC 17978]
 gi|213055763|gb|ACJ40665.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter baumannii
           AB0057]
 gi|213986358|gb|ACJ56657.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter baumannii
           AB307-0294]
 gi|260410628|gb|EEX03926.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           ATCC 19606]
 gi|322506995|gb|ADX02449.1| fabG [Acinetobacter baumannii 1656-2]
 gi|323516862|gb|ADX91243.1| dehydrogenase [Acinetobacter baumannii TCDC-AB0715]
 gi|332729451|gb|EGJ60790.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           6013150]
 gi|332733894|gb|EGJ65039.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           6013113]
 gi|332739201|gb|EGJ70060.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter baumannii
           6014059]
          Length = 244

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 119/225 (52%), Gaps = 12/225 (5%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           + ++ALVTG+SRGIG   A +L + G +V+    S S  +KL ++  +    +   A D+
Sbjct: 4   ERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLTDSFGEQGAGL---ALDV 60

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
           R+ + +E   ++I + +G + +L+ NAGI    + + ++ E  + D++++++ A + + +
Sbjct: 61  RNLDEIEAVVSHIEQNYGPVLVLVNNAGITKD-NLLLRMSEDDWDDILNIHLKAVYRLSK 119

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
                + K+  GR I +SS  A+   P    YSA+KA IEA +R+ +KE  +  + V ++
Sbjct: 120 RVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSV 179

Query: 197 DPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            PG   T M        R K       N +  PQ +A  +SFL +
Sbjct: 180 APGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLAS 224


>gi|295699726|ref|YP_003607619.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. CCGE1002]
 gi|295438939|gb|ADG18108.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. CCGE1002]
          Length = 248

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 116/242 (47%), Gaps = 15/242 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           +  ++ LVTG   G+G   ALELA  GA V+ CGR+  +L +++  +Q++  + +IF  D
Sbjct: 4   MKGKVGLVTGGGSGMGRAAALELATEGAVVVLCGRTADKLSQVRQEIQQLGGQAEIFLGD 63

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA-NWNI 134
           +      +    Y+ +R+G+LD    NAG  G   PI +   +    VI +N     + +
Sbjct: 64  VSKREDNQSLVNYVEERFGRLDFAFNNAGGHGDFHPIHETSIEEAEWVIDLNFKGVYYGV 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG--AYSASKAAIEALARTWSKETVNTALR 192
               +  L+    G  +IL++ + +  R + G   Y A+K A+  L +  +KE  N  +R
Sbjct: 124 KFQIEAMLR---SGGGVILNNASIFGIRGMNGIAHYVAAKHAVVGLTKAVAKEYANFNIR 180

Query: 193 VINIDPGPTRTS--MRAKAMPAEDPNT------VPHPQKVAKIISFLCATQ-KIETGKLF 243
           +  + PG T T   MR+        ++      +  PQ+V K + FL + Q    TG   
Sbjct: 181 INAVCPGATETPNYMRSTGGDVHLLDSMIPMGRIGQPQEVGKAVLFLLSDQSSYVTGSTL 240

Query: 244 SV 245
           SV
Sbjct: 241 SV 242


>gi|82703459|ref|YP_413025.1| Short-chain dehydrogenase/reductase SDR [Nitrosospira multiformis
           ATCC 25196]
 gi|82411524|gb|ABB75633.1| Short-chain dehydrogenase/reductase SDR [Nitrosospira multiformis
           ATCC 25196]
          Length = 248

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 112/220 (50%), Gaps = 4/220 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ LVTG+ +GIG   AL  A  GA VI  GR++ +LE + + ++     +  IF  
Sbjct: 14  LKDRVILVTGAGQGIGRTAALTYAAHGATVILHGRNVKKLESVYDEIEAGGGAQPSIFPL 73

Query: 75  DLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +   +       I  + G+LD ++ NA +L +++P+     + +  ++ VN++A +
Sbjct: 74  DLEKAGDKDFAAIAHAIKLQLGRLDGILHNAALLFNLTPLETQTLEEWLALLRVNLIAPF 133

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE-TVNTAL 191
            + R+  P LK S     I+ S    +     WG ++ +KA +EAL +  ++E  +   L
Sbjct: 134 ALTRACLPLLKASPDASVIMTSDAHGHVPAAYWGGFAVAKAGVEALVKIQAQEWEILPTL 193

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           R+  + PGP  T  R +  P E   ++  PQ++     +L
Sbjct: 194 RINTLIPGPVHTPQRTRTHPGEVKQSLSQPQELMSCYLYL 233


>gi|220934694|ref|YP_002513593.1| short-chain dehydrogenase/reductase SDR [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996004|gb|ACL72606.1| short-chain dehydrogenase/reductase SDR [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 254

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 118/232 (50%), Gaps = 8/232 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L +R+ LVTG+  GIG   +L  A  GA VI   + I  LE + + ++K    +  I+  
Sbjct: 16  LRDRVILVTGAGMGIGRALSLACAGLGATVILLDKEIRALEAVYDEIEKAGGTQPAIYPM 75

Query: 75  DLRDSNA--LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           +L  + A   E     + K  G+LD L+ NAG +G  +P+     + ++ VI+ N+ A +
Sbjct: 76  NLEGATAKDHEDLAQNVEKELGRLDGLVHNAGWIGGFTPLKLYDVELWSRVITANLHAPF 135

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA-L 191
            + R+  P L+ +    A++ S+  + K    WGA+  +KA  EA+ +  + E      +
Sbjct: 136 LLTRAVLPLLEAA-GDPAVVFSAHESAKA--YWGAFGVAKAGQEAMLKILAAEYQGERFM 192

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKV-AKIISFLCATQKIETGKL 242
           RV  +D GP RT MR +  P E+PN  P P+ V A  + FL       TG++
Sbjct: 193 RVNGVDSGPLRTQMRVQHYPGENPNKNPKPESVIAPYLYFLGPDAGRTTGEI 244


>gi|225872596|ref|YP_002754051.1| clavaldehyde dehydrogenase [Acidobacterium capsulatum ATCC 51196]
 gi|225792820|gb|ACO32910.1| clavaldehyde dehydrogenase [Acidobacterium capsulatum ATCC 51196]
          Length = 235

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 110/212 (51%), Gaps = 2/212 (0%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDS 79
           + +VTG+SRGIG   +  LAR GA V+   R   +LE+L   ++    + ++FA DL   
Sbjct: 6   VGVVTGASRGIGAAVSRRLARLGAQVLLVARHRERLEELAAQIESEGGRAELFAVDLTQE 65

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
             +      I KR+G+ D+L+ NAGI    +P+  ++   + ++++ N+ A + ++R+  
Sbjct: 66  EEIAALGETIRKRYGRCDVLVNNAGISRMGAPLHAMQPADWDELMATNLRAPYLMIRALA 125

Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199
           P + +   G  + +SS A +       AYSASK A+  L  + ++E  +  +RV  I PG
Sbjct: 126 PLMIERQSGHIVNISSLAGHNPLRNGAAYSASKWALNGLTYSVAEELRDYGVRVSVIAPG 185

Query: 200 PTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
              TS      PA     +  P+ +A I++ L
Sbjct: 186 SVNTSFGGHE-PANAAARI-QPEDIADIVAML 215


>gi|271970500|ref|YP_003344696.1| short-chain dehydrogenase/reductase SDR [Streptosporangium roseum
           DSM 43021]
 gi|270513675|gb|ACZ91953.1| short-chain dehydrogenase/reductase SDR [Streptosporangium roseum
           DSM 43021]
          Length = 250

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 100/201 (49%), Gaps = 4/201 (1%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           +   +++ LVTG   GIG   A   AR GA V+   R    L++    ++    +     
Sbjct: 1   MKFQDKVVLVTGGGSGIGRAVAQGFARRGAQVVVAARGQEALDQTVKLIEAEGGRAAALT 60

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ DS ++      I +R+G+LDI I NAG+L ++  +    E  FA VI +N+   + 
Sbjct: 61  VDVSDSASVAGLVGRIVERYGRLDIAINNAGVL-AMGQVADQPEDDFAQVIDINLNGIFL 119

Query: 134 IMRSFDPWLKKSHCGRAIILSSG-AAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            M+   P +  +  G  +  SS    +K  P +GAY+ASKA + AL RT + E +   +R
Sbjct: 120 SMKHQIPAMLAAGGGVIVNFSSQIGTHKRIPGFGAYAASKAGVTALTRTAALEYIGRGIR 179

Query: 193 VINIDPGPTRTSMRAKAMPAE 213
           +  I PGP  TSM  +  P E
Sbjct: 180 INAISPGPHDTSMSMR--PGE 198


>gi|213619050|ref|ZP_03372876.1| short chain dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
          Length = 180

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (53%), Gaps = 1/162 (0%)

Query: 89  IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCG 148
           IA  + +LD ++ NAG+LG I P+ +   + + DV+ VNV A + + ++  P L KS  G
Sbjct: 13  IAAHYPRLDGVLHNAGLLGEIGPMSEQDPQIWQDVMQVNVNATFMLTQALLPLLLKSDAG 72

Query: 149 RAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK 208
             +  SS    + R  WGAY+ SK A E + +  + E  N +LRV  I+PG TRTSMRA 
Sbjct: 73  SLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNRSLRVNCINPGGTRTSMRAS 132

Query: 209 AMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNR 249
           A P EDP  +  P  +  +  +L     + +TG  F     R
Sbjct: 133 AFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTFDAQPGR 174


>gi|251795711|ref|YP_003010442.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Paenibacillus sp.
           JDR-2]
 gi|247543337|gb|ACT00356.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp. JDR-2]
          Length = 238

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 106/212 (50%), Gaps = 2/212 (0%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            ++AL+TG+ RGIG   A+  A+ G +V   GR++  L K+   L+    K+ + + D+ 
Sbjct: 6   GKVALITGAGRGIGRAVAIAFAQEGIHVGLVGRTLENLHKVAEELKPYGVKVALASADVA 65

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D  ++      I    G +DILI NAG+ G       +  + + ++I VNV   +   R+
Sbjct: 66  DLASITAAVEIIRSELGAIDILINNAGV-GKFGGFMDLTPEEWTNIIDVNVKGVYYTTRA 124

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P + + + G  + ++S A  +  PL  AY+ASKAA+  L+ +   E     +RVI + 
Sbjct: 125 VLPEMIERNTGDIVNIASTAGQRGAPLTSAYTASKAAVIGLSESLMLEVRKNNIRVITLT 184

Query: 198 PGPTRTSMRAK-AMPAEDPNTVPHPQKVAKII 228
           P    T M  +  +   +P  V  P+ +A +I
Sbjct: 185 PSTVATDMAVELKLTDGNPEKVMQPEDLADLI 216


>gi|186682463|ref|YP_001865659.1| short chain dehydrogenase [Nostoc punctiforme PCC 73102]
 gi|186464915|gb|ACC80716.1| short-chain dehydrogenase/reductase SDR [Nostoc punctiforme PCC
           73102]
          Length = 250

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 117/246 (47%), Gaps = 13/246 (5%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L  ++ALVTG+S GIG  TA+  AR+GA V+A  R  ++ E+  + +Q+I  +      
Sbjct: 4   QLYGKVALVTGASSGIGKATAIAFARAGAKVVAASRRTTEGEETAHYIQEIGGEAIFIKT 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+  +  +E         +G+LD    NAG+ G+ SPI  + EK +  ++ VN+   W  
Sbjct: 64  DVSKAADVETLIEKTIDIYGRLDCACNNAGLGGAASPIADMSEKDWDQLVDVNLKGTWLC 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           ++     + K   G  + ++S A     P +  Y A+K  + AL+R  + E     +R+ 
Sbjct: 124 LKYQIRAMLKQGSGAIVNIASAAGVVGFPGFTGYCATKGGVIALSRAAAMEYAKAGIRIN 183

Query: 195 NIDPGPTRTSMRAK-------AMPAEDP-NTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
            + PG   T M A         + A  P   +  P++VA+ + +LC+      G  F V 
Sbjct: 184 VVSPGAIATDMLATLPTDVLAQLTAMHPIGRIAKPEEVAESVVWLCS-----DGSSFLVG 238

Query: 247 QNRFVN 252
            N  V+
Sbjct: 239 HNMMVD 244


>gi|326331690|ref|ZP_08197978.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Nocardioidaceae bacterium Broad-1]
 gi|325950489|gb|EGD42541.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Nocardioidaceae bacterium Broad-1]
          Length = 271

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 99/189 (52%), Gaps = 1/189 (0%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           D R A++TG+S GIG  TA  LA +G  V    R + ++E++  A++    +      D+
Sbjct: 9   DRRPAVITGASSGIGAETARALATAGFPVALGARRLDRVEEIAAAIRADGGEAVAHPLDV 68

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
              +++      +A   G +++L++NAG+    + + ++  ++FA  + VN++    ++R
Sbjct: 69  TSDDSVAEFAAKVAADLGDVEVLVSNAGVTHPGATV-EVPTETFAGQVDVNLLGAHRVLR 127

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
           +F P + +   G  + LSS  A K RP  GAY+ASK  +E +      E   T +R   +
Sbjct: 128 AFGPGMVERRRGDLVFLSSDVAVKPRPFMGAYAASKWGLEGMVAALQMELEGTGVRASIV 187

Query: 197 DPGPTRTSM 205
            PGPT + +
Sbjct: 188 RPGPTHSDI 196


>gi|126436623|ref|YP_001072314.1| short-chain dehydrogenase/reductase SDR [Mycobacterium sp. JLS]
 gi|126236423|gb|ABN99823.1| short-chain dehydrogenase/reductase SDR [Mycobacterium sp. JLS]
          Length = 274

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 106/210 (50%), Gaps = 17/210 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS----------ISQLEKLKNALQKI 65
           L  ++A +TG++RG G   A+ +A  GA +IA   +           +  + L+  +Q++
Sbjct: 6   LTGKVAFITGAARGQGRAHAVRMAEEGADIIAVDLAGPLPDSVRYPSATPDDLQETVQEV 65

Query: 66  ---NKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIW-QIKEKSFA 121
                +I   A D+RD +AL        + +G+LD+++ANAGI   I   W +I  +SF 
Sbjct: 66  KAAGGRIMATAADIRDLDALRTAVDEGVEAYGRLDVIVANAGIC--IPAPWNEITPESFR 123

Query: 122 DVISVNVMANWN-IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
           D+I VNV   WN +M      +     G  I++SS A  K +P    Y+ASK A+  +AR
Sbjct: 124 DIIDVNVTGTWNTVMAGAQRIIDGGRGGSIILISSYAGVKVQPYMVHYTASKHAVTGMAR 183

Query: 181 TWSKETVNTALRVINIDPGPTRTSMRAKAM 210
            ++ E     +RV ++ PGP  T M    M
Sbjct: 184 AFAAELGKHDIRVNSVHPGPVNTPMGGGDM 213


>gi|86607690|ref|YP_476452.1| short chain dehydrogenase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556232|gb|ABD01189.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 243

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 106/213 (49%), Gaps = 3/213 (1%)

Query: 21  ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSN 80
           AL+TG+SRGIG   AL LAR G  V    RS   L  ++  +Q    K  +F  DL D  
Sbjct: 11  ALITGASRGIGRAVALALARQGIAVALVARSQPDLLAVQAQIQAQGGKAAVFPMDLADLA 70

Query: 81  ALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDP 140
           AL      +  R+G  D+L+ NAG +  + P+  +    +  VI +N+ A +   ++  P
Sbjct: 71  ALPQQLQALLDRFGVCDVLVNNAG-MAHVGPLATLPLSDWQRVIDLNLTAAFLCAQAVLP 129

Query: 141 WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGP 200
            +++  CG  + + S A  +  P WGAY ASK  +   ++  ++E     +RV ++ PG 
Sbjct: 130 GMRRQRCGTIVNVISIAGKRAFPNWGAYCASKFGLMGFSQALAEEERQHGIRVTSLCPGA 189

Query: 201 TRTSMRAKAMPAE--DPNTVPHPQKVAKIISFL 231
             TS+          D + +  P+ VA +I+++
Sbjct: 190 VDTSLWDTGTVGVNFDRSKMLSPEWVADLITYI 222


>gi|115446723|ref|NP_001047141.1| Os02g0557700 [Oryza sativa Japonica Group]
 gi|113536672|dbj|BAF09055.1| Os02g0557700 [Oryza sativa Japonica Group]
 gi|215694435|dbj|BAG89452.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 225

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 90/187 (48%), Gaps = 2/187 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R  L+TG SRG+G   ALELAR G  V+ CGRS   +  L+  +    +     A    D
Sbjct: 23  RTVLITGVSRGLGRALALELARRGHAVVGCGRSADHVRSLEAEIATPARHFLTVADVRSD 82

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           SN  EL K  + K+    DI++ NAG +   +  W +  + F  V+  N+    N++R F
Sbjct: 83  SNMAELAKAVVEKKQVP-DIIVNNAGTINKNNKTWSVPAEEFDTVVDTNIKGTANVLRHF 141

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P + +   G  + LSSG           Y ASK AIE L R+ +KE +   L  I + P
Sbjct: 142 IPLMIEKKHGIIVNLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE-LPPGLAAIALSP 200

Query: 199 GPTRTSM 205
           G   T M
Sbjct: 201 GVVNTDM 207


>gi|330897198|gb|EGH28617.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 198

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 86/166 (51%), Gaps = 3/166 (1%)

Query: 71  IFAFDLR--DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           +  FDL+  D        T I +  G+LD L+ NA I+G  + +  +  + F +V+ VNV
Sbjct: 19  VIPFDLQSADPAQYHALATMIERTVGRLDGLLHNASIIGPRTSVEHLPGEDFMEVMHVNV 78

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A + + ++  P L++S        SS    K R  WGAY  SK A E L +T + E   
Sbjct: 79  NATFMLTQALLPLLQRSEDASIAFTSSSVGRKGRAQWGAYGVSKFATEGLMQTLADELEG 138

Query: 189 -TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            + +R  +I+PG TRT MRA+A P E+P   P P+++  +  +L  
Sbjct: 139 VSTVRANSINPGATRTGMRAQAYPDENPQNNPAPEEIMPVYLYLMG 184


>gi|150378250|ref|YP_001314845.1| short-chain dehydrogenase/reductase SDR [Sinorhizobium medicae
           WSM419]
 gi|150032797|gb|ABR64912.1| short-chain dehydrogenase/reductase SDR [Sinorhizobium medicae
           WSM419]
          Length = 255

 Score = 98.2 bits (243), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 100/191 (52%), Gaps = 1/191 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  R ALVTG+SRGIG   AL LA +GA V    R+I  LE+ +  ++K+ ++   FA 
Sbjct: 7   DLSGRRALVTGASRGIGQSIALALAEAGADVAVTARTIDGLEETRALIEKVGRRAVAFAQ 66

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+RD  A        A+R G LDIL+ NAG   ++ P + + E  +  +IS N+   +  
Sbjct: 67  DVRDVGACGSVTGAAAERLGGLDILVNNAGFE-NVRPSFDVDEALWETIISTNLKGAFFC 125

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            ++    + +++ G  + L S  +Y   P    Y ASK+ +  + R  + E     +RV 
Sbjct: 126 AQAAGRIMAEANGGAIVNLCSLTSYVGIPTAAPYGASKSGLLGVTRALATEWAAHNIRVN 185

Query: 195 NIDPGPTRTSM 205
            I PG  RT+M
Sbjct: 186 AIAPGYFRTAM 196


>gi|159899298|ref|YP_001545545.1| short-chain dehydrogenase/reductase SDR [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159892337|gb|ABX05417.1| short-chain dehydrogenase/reductase SDR [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 223

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 106/214 (49%), Gaps = 10/214 (4%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            R+ L+TG+SRG+G   A +LA +G ++I  GR  + LE+ + AL   +  +   A D+ 
Sbjct: 2   QRIGLITGASRGLGLALAQQLALNGWHLIITGRGATALEQARAAL-ATHTTVQAIAGDIA 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISP---IWQIKEKSFADVISVNVMANWNI 134
           D  A         + WG LD+L+ NA ILG  SP   +      + A V ++NV A    
Sbjct: 61  DP-AHRQALAVATQAWGGLDLLVNNASILGP-SPQPNLLDYPLDNLAQVYAINVFAPLAA 118

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +++  P  K S   R I +SS AA +    WG Y +SKAA++ L    + E      RV 
Sbjct: 119 IQTLAPSFKPSI--RIINISSDAAVQAYEGWGGYGSSKAALDQLTAILAAE--QPTWRVY 174

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKII 228
            +DPG   T M  +A P ED +  P P+     I
Sbjct: 175 ALDPGDMNTQMHQEAFPGEDISDRPPPEASVPTI 208


>gi|218190981|gb|EEC73408.1| hypothetical protein OsI_07663 [Oryza sativa Indica Group]
          Length = 293

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 90/187 (48%), Gaps = 2/187 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R  L+TG SRG+G   ALELAR G  V+ CGRS   +  L+  +    +     A    D
Sbjct: 23  RTVLITGVSRGLGRALALELARRGHAVVGCGRSADHVRSLEAEIATPARHFLTVADVRSD 82

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           SN  EL K  + K+    DI++ NAG +   +  W +  + F  V+  N+    N++R F
Sbjct: 83  SNMAELAKAVVEKKQVP-DIIVNNAGTINKNNKTWSVPAEEFDTVVDTNIKGTANVLRHF 141

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P + +   G  + LSSG           Y ASK AIE L R+ +KE +   L  I + P
Sbjct: 142 IPLMIEKKHGIIVNLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE-LPPGLAAIALSP 200

Query: 199 GPTRTSM 205
           G   T M
Sbjct: 201 GVVNTDM 207


>gi|56964909|ref|YP_176640.1| oxidoreductase [Bacillus clausii KSM-K16]
 gi|56911152|dbj|BAD65679.1| oxidoreductase [Bacillus clausii KSM-K16]
          Length = 238

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 102/213 (47%), Gaps = 2/213 (0%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDS 79
           + ++TG+++G+G   A    R G  +    R+   L +L +ALQ  N  +   A D+  +
Sbjct: 4   IVMITGATKGLGRALAWHYGRKGYALAVTARTEDDLVQLASALQAENIPVVAVAGDMAKA 63

Query: 80  NALELTKTYIAKRWGKLDILIANAGILG-SISPIWQIKEKSFADVISVNVMANWNIMRSF 138
              E        R+ K+D+LI NA I G   S +    + +F +V+  N +  + + +  
Sbjct: 64  EDAERFAALTLARYKKVDVLINNASIFGPGPSLLLDYPDAAFQEVLLTNTLIPYFLTKQI 123

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P +     G  I L+S A       WGAY  SK A+E + +TW+ E  ++ +R   +DP
Sbjct: 124 LPTMLARDSGIVITLTSEAGKTGFAEWGAYGISKFAVEGMVQTWADEVADSNVRFHLVDP 183

Query: 199 GPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
           G   T M A+A+P  D    P PQK   +  +L
Sbjct: 184 GEMDTDMHAQALPDCDYFLDP-PQKRLAVFDYL 215


>gi|300782145|ref|YP_003762436.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Amycolatopsis
           mediterranei U32]
 gi|299791659|gb|ADJ42034.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Amycolatopsis
           mediterranei U32]
          Length = 241

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 119/239 (49%), Gaps = 15/239 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R+ALVTG +RGIG  TA  L  +GA V+  GR  +   + K A   +       A D
Sbjct: 3   LSGRVALVTGGTRGIGLATARVLVEAGATVVLTGRDEA---RAKEAAASVGAS--GLALD 57

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D+ A+      +AK  GKLDI++ANAGI+   + +  IKE+     +S NV    + +
Sbjct: 58  VTDAKAVSSLVRGVAKEHGKLDIVVANAGIM-EDALLGMIKEELVDTTLSTNVAGTLHTV 116

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++    + +   G  ++L+S            Y+ASKAA+  +AR+ +KE   + +RV  
Sbjct: 117 QAAARAMMRKKTGSIVVLASIVGEYGSAGQTVYAASKAAVANIARSAAKELGRSGIRVNA 176

Query: 196 IDPGPTRTSMRA---KAMPAEDPNTVP-----HPQKVAKIISFLCATQ-KIETGKLFSV 245
           + PG   T + A   +   AE+ +  P      P++VA  I FL + +    TG++  +
Sbjct: 177 VAPGVIETDLTAGLSEGAKAENSSRTPLGRLGRPEEVANAIRFLVSDEASFITGQVLGI 235


>gi|308186843|ref|YP_003930974.1| 3-oxoacyl-ACP-reductase [Pantoea vagans C9-1]
 gi|308057353|gb|ADO09525.1| 3-oxoacyl-ACP-reductase [Pantoea vagans C9-1]
          Length = 249

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 118/236 (50%), Gaps = 21/236 (8%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++ +L  ++ALVTG + GIG  TA ELA  GA V   GR  ++L+    A+ +I   +  
Sbjct: 1   MNASLAGKIALVTGGTSGIGLATARELAAQGAQVFITGRRQAELDA---AVAEIGGTVSG 57

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D    + L+   + IA + G+LDIL ANAG  G + P+  I E+    +   NV   
Sbjct: 58  MRADASQLHDLDNVYSRIAAQAGRLDILFANAGG-GDMLPLGAITEEHVDRIFGTNVRGV 116

Query: 132 WNIMRSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
              ++   P L     G ++IL+ S AA +    +  YSASKAA+   AR+W+ +  +  
Sbjct: 117 LFTVQKALPLLVD---GASVILTGSTAASQGTAAFSVYSASKAAVRNFARSWALDLKDRG 173

Query: 191 LRVINIDPGPTRTSMRA------------KAMPAEDP-NTVPHPQKVAKIISFLCA 233
           +RV  + PGP RT                 A+ A+ P   +  PQ+VA+ ++FL +
Sbjct: 174 IRVNVVSPGPIRTPGLGGLVSEDQRQGLFDALAAQIPLGRLGEPQEVARTVAFLAS 229


>gi|323488604|ref|ZP_08093848.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Planococcus
           donghaensis MPA1U2]
 gi|323397821|gb|EGA90623.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Planococcus
           donghaensis MPA1U2]
          Length = 238

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 103/215 (47%), Gaps = 2/215 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL  + AL+TG+ RGIG  TA+  A  G  V   GR+   LEK+   L++   K      
Sbjct: 3   NLTGKNALITGAGRGIGRSTAIAFAAEGINVGLVGRTAENLEKVVAELEQYGVKTVFAVA 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ D +++     ++    G +DILI NAGI G       +  + F  +I  N+M  + +
Sbjct: 63  DVADQDSVNAAVEHVLAELGSIDILINNAGI-GKFGNFLDLSPEEFKAIIDTNLMGVYYV 121

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R+  P + +   G  I +SS A  K  P+  AYSASK  +  L  +   E     +RV 
Sbjct: 122 TRAVLPQMIERQSGDIINISSTAGQKGAPVTSAYSASKFGLMGLTESLMLEVRKHNIRVS 181

Query: 195 NIDPGPTRTSMR-AKAMPAEDPNTVPHPQKVAKII 228
            + P    T +   + +   +P+ V  P+ +A+++
Sbjct: 182 ALTPSTVATDLAIGENLTDGNPDKVMQPEDLAEMM 216


>gi|18976446|ref|NP_577803.1| alcohol dehydrogenase, short chain [Pyrococcus furiosus DSM 3638]
 gi|18891982|gb|AAL80198.1| alcohol dehydrogenase, short chain [Pyrococcus furiosus DSM 3638]
          Length = 251

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 116/218 (53%), Gaps = 11/218 (5%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLR 77
           ++A++TG+SRGIG   A  LA  G Y +A G RS+ +LEK+   L +    +++F +D  
Sbjct: 19  KVAVITGASRGIGEAIAKALAEDG-YSLALGARSVDRLEKIAKELSE-KHGVEVF-YDYL 75

Query: 78  DSNALELTKTYIAK---RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D +  E  + +  K    +G +D+++ANAG LG    + ++ E+ F ++I VN++  W  
Sbjct: 76  DVSKPESVEEFARKTLAHFGDVDVVVANAG-LGYFGRLEELTEEQFHEMIEVNLLGVWRT 134

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +++F   LK++  G AI+++S  + +  P  G Y A+K A  AL RT+  E  N  +R  
Sbjct: 135 IKAFLNSLKRT-GGVAIVVTSDVSARLLPYGGGYVATKWAARALVRTFQIE--NPDVRFF 191

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
            + PG   T                 P++VA+ + +L 
Sbjct: 192 ELRPGAVDTYFGGSKAGKPKEQGYLKPEEVAEAVKYLL 229


>gi|154685787|ref|YP_001420948.1| YkvO [Bacillus amyloliquefaciens FZB42]
 gi|154351638|gb|ABS73717.1| YkvO [Bacillus amyloliquefaciens FZB42]
          Length = 248

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 108/233 (46%), Gaps = 19/233 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
            + ++ALVTG + GIG   A +    GAYV   GR  ++L+K   A+ +I K +     D
Sbjct: 4   FEGKIALVTGGTSGIGLAAAQKFVNEGAYVYITGRRQNELDK---AVNQIGKNVTGVQGD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN-WNI 134
           +     L+     I +  GKLDIL ANAG  G+  P+ +I E+       +NV    + +
Sbjct: 61  ISKLEDLDKLYDMIKQEKGKLDILFANAGT-GNFLPLGEITEEQVDRTFDINVKGTIFTV 119

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            ++   +  K   G  I+  S A     P +  Y ASKAA+ AL R W  +   T +RV 
Sbjct: 120 QKALSLFPDK--VGSIIVTGSTAGSIGNPAFSVYGASKAALRALVRNWILDLKGTEIRVN 177

Query: 195 NIDPG----PTRTSMRAKAMPAEDPNT--------VPHPQKVAKIISFLCATQ 235
            + PG    P    +   A+     NT        V  P++VA  +SFL + +
Sbjct: 178 VVSPGVILTPAYDELFGDALEGAMENTRNTVPAGKVGTPEEVANAVSFLASDE 230


>gi|110680428|ref|YP_683435.1| oxidoreductase, putative [Roseobacter denitrificans OCh 114]
 gi|109456544|gb|ABG32749.1| oxidoreductase, putative [Roseobacter denitrificans OCh 114]
          Length = 211

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 98/197 (49%), Gaps = 5/197 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            + AL+TG+SRG+GY  A  LA +  ++IA  ++   LE+L + +Q       +   D+ 
Sbjct: 2   TKTALITGASRGLGYALAEALAPT-HHIIAVAKTTGALEELDDRIQSHGGTTTLAPMDIT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +++A+      I  RWG LD+ +  A     ++P   I  K  A  I+ NV A   ++  
Sbjct: 61  NTDAMATLCRGIFDRWGSLDLWLHAAIHAAPLTPTSHIDSKDLAKSIATNVTATATLITF 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L  +  G+A+      A      +G+Y ASKAA  ALAR+W  E+  T  RV  + 
Sbjct: 121 VAPLLGTT--GQAVFFDD--ARAGEKFFGSYGASKAAQVALARSWQAESATTGPRVDIVT 176

Query: 198 PGPTRTSMRAKAMPAED 214
           P P  T+ R +  P E+
Sbjct: 177 PPPMPTATRGRFYPGEN 193


>gi|182439486|ref|YP_001827205.1| putative short chain dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178468002|dbj|BAG22522.1| putative short chain dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 241

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 115/231 (49%), Gaps = 10/231 (4%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAFDLRD 78
           +AL+TG S+G+G   A ELA  G  ++   R+   LE+    L+ +   ++     D+ D
Sbjct: 3   VALITGGSKGLGRALAAELAGQGWDLVLDARTAGVLEETARDLRGRFGTRVVAVPGDVTD 62

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKE---KSFADVISVNVMANWNIM 135
           + A        A   G LD+L++NA +LG+  P+ ++     +     +  NV+A   ++
Sbjct: 63  A-AHRADLVAAAGALGGLDLLVSNASVLGA-EPLVRLDALPLEGLRRALETNVVAALGLV 120

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P L+ +  G  +++SS AA +  P WG Y ASKAA++ LA     E     LRV  
Sbjct: 121 QEALPSLRAAEAGAVVVISSDAAAEPYPTWGGYGASKAALDQLAAVLGAE--EPGLRVWA 178

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
           +DPG   T + A A+P E     P P+ VA   +FL   ++   G  F+ P
Sbjct: 179 VDPGDMGTDLYAAAVPEEADEVRPTPESVAP--AFLRLIRERPAGGRFAAP 227


>gi|302798871|ref|XP_002981195.1| hypothetical protein SELMODRAFT_113925 [Selaginella moellendorffii]
 gi|302801836|ref|XP_002982674.1| hypothetical protein SELMODRAFT_116810 [Selaginella moellendorffii]
 gi|300149773|gb|EFJ16427.1| hypothetical protein SELMODRAFT_116810 [Selaginella moellendorffii]
 gi|300151249|gb|EFJ17896.1| hypothetical protein SELMODRAFT_113925 [Selaginella moellendorffii]
          Length = 234

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 103/199 (51%), Gaps = 17/199 (8%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL---QKINKKID 70
           ++   R  L+TG +RG+G   ALE+A  G  +I CGR   +L  L+N L   + I + +D
Sbjct: 5   IDCTARTVLITGVTRGLGRALALEIASRGHTIIGCGRDEEKLTSLQNQLGDSKHILRAVD 64

Query: 71  IFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
           + +    DSN  E  +  I  + G  DIL+ NAG++ S   +W++  + F +VI VN+  
Sbjct: 65  VAS----DSNVQEFARAVIELK-GAPDILVNNAGVINSNGKLWEVAREEFDNVIDVNIKG 119

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSG----AAYKCRPLWGAYSASKAAIEALARTWSKET 186
             N +R F P +     G  +  SSG    AA +  P    Y ASK A+E L R+ +KE 
Sbjct: 120 PANCLRHFVPHMMSKKQGVIVNFSSGWGRSAAAEVSP----YCASKWAMEGLTRSLAKE- 174

Query: 187 VNTALRVINIDPGPTRTSM 205
           +   +  + ++PG   T M
Sbjct: 175 LPPGIAAVALNPGVICTDM 193


>gi|326780150|ref|ZP_08239415.1| short-chain dehydrogenase/reductase SDR [Streptomyces cf. griseus
           XylebKG-1]
 gi|326660483|gb|EGE45329.1| short-chain dehydrogenase/reductase SDR [Streptomyces cf. griseus
           XylebKG-1]
          Length = 241

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 115/231 (49%), Gaps = 10/231 (4%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAFDLRD 78
           +AL+TG S+G+G   A ELA  G  ++   R+   LE+    L+ +   ++     D+ D
Sbjct: 3   VALITGGSKGLGRALAAELAGQGWDLVLDARTAGVLEETARDLRGRFGTRVVAVPGDVTD 62

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKE---KSFADVISVNVMANWNIM 135
           + A        A   G LD+L++NA +LG+  P+ ++     +     +  NV+A   ++
Sbjct: 63  A-AHRADLVAAAGALGGLDLLVSNASVLGA-EPLVRLDALPLEGLRRALETNVVAALGLV 120

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P L+ +  G  +++SS AA +  P WG Y ASKAA++ LA     E     LRV  
Sbjct: 121 QEALPSLRAAEAGAVVVISSDAAAEPYPTWGGYGASKAALDQLAAVLGAE--EPGLRVWA 178

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
           +DPG   T + A A+P E     P P+ VA   +FL   ++   G  F+ P
Sbjct: 179 VDPGDMGTDLYAAAVPEEADEVRPTPESVAP--AFLRLIRERPAGGRFAAP 227


>gi|118465413|ref|YP_880804.1| carveol dehydrogenase [Mycobacterium avium 104]
 gi|254774389|ref|ZP_05215905.1| carveol dehydrogenase [Mycobacterium avium subsp. avium ATCC 25291]
 gi|118166700|gb|ABK67597.1| carveol dehydrogenase [Mycobacterium avium 104]
          Length = 273

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 105/210 (50%), Gaps = 17/210 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIA---CGR----------SISQLEKLKNAL 62
           L+ R+A +TG++RG G   A+ +A  GA +IA    G+          S   L +    +
Sbjct: 5   LEGRVAFITGAARGQGRAHAVRMAAEGADIIAVDIAGKLPSCVPYDPASPEDLSETVRLV 64

Query: 63  QKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQ-IKEKSFA 121
           +  N++I     D RD + L           G+LDI++ANAG+    +  W  I  + F 
Sbjct: 65  EAANRRIVAAVVDTRDFDGLRKVVDDGVAALGRLDIIVANAGVAAPQA--WDDITPEDFR 122

Query: 122 DVISVNVMANWNIMRSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALAR 180
           DV+ +NV   WN + +  P + +   G +IIL SS A  K +P    Y+ASK A+  LAR
Sbjct: 123 DVMDINVTGTWNTVMAGAPRIIEGGRGGSIILISSAAGMKMQPFMIHYTASKHAVTGLAR 182

Query: 181 TWSKETVNTALRVINIDPGPTRTSMRAKAM 210
            ++ E    ++RV ++ PGP  T M +  M
Sbjct: 183 AFAAELGKHSIRVNSVHPGPVNTPMGSGDM 212


>gi|307155352|ref|YP_003890736.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7822]
 gi|306985580|gb|ADN17461.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7822]
          Length = 242

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           + +N   + A++TG+S GIG  TAL  A++G  V    RS  +LE++ NA   +  K   
Sbjct: 1   MSLNSSQQRAIITGASSGIGKATALAFAKAGIDVALVSRSQDKLEEVVNAALAVGVKARS 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           +  DL     ++     I + +G +DIL+ NAGI G  + +       +  V+ +N+ + 
Sbjct: 61  YPVDLAKIEEVKQKIEEIVQDFGSIDILVNNAGI-GYTNSLSDTSLTHWQQVMDINLTSV 119

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           +  +    P +++   G  I ++S AA    PLWGAYS SKA I A ++  + E     +
Sbjct: 120 FQCVLGVLPQMRQQGQGTIINVASCAANNAFPLWGAYSVSKAGIVAFSKVLAAEERANGI 179

Query: 192 RVINIDPGPTRTSM-RAKAMPAE-DPNTVPHPQKVAKII 228
           RV+ I PG   T +   + + A+ + + + HP+ VA+ I
Sbjct: 180 RVMTISPGSVNTPLWDTETVQADFERSVMLHPETVAQAI 218


>gi|3288810|gb|AAC25556.1| short chain alcohol dehydrogenase [Pyrococcus furiosus DSM 3638]
          Length = 234

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 116/218 (53%), Gaps = 11/218 (5%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLR 77
           ++A++TG+SRGIG   A  LA  G Y +A G RS+ +LEK+   L +    +++F +D  
Sbjct: 2   KVAVITGASRGIGEAIAKALAEDG-YSLALGARSVDRLEKIAKELSE-KHGVEVF-YDYL 58

Query: 78  DSNALELTKTYIAK---RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D +  E  + +  K    +G +D+++ANAG LG    + ++ E+ F ++I VN++  W  
Sbjct: 59  DVSKPESVEEFARKTLAHFGDVDVVVANAG-LGYFGRLEELTEEQFHEMIEVNLLGVWRT 117

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +++F   LK++  G AI+++S  + +  P  G Y A+K A  AL RT+  E  N  +R  
Sbjct: 118 IKAFLNSLKRT-GGVAIVVTSDVSARLLPYGGGYVATKWAARALVRTFQIE--NPDVRFF 174

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC 232
            + PG   T                 P++VA+ + +L 
Sbjct: 175 ELRPGAVDTYFGGSKAGKPKEQGYLKPEEVAEAVKYLL 212


>gi|163758608|ref|ZP_02165695.1| 20-beta-hydroxysteroid dehydrogenase, putative [Hoeflea
           phototrophica DFL-43]
 gi|162283898|gb|EDQ34182.1| 20-beta-hydroxysteroid dehydrogenase, putative [Hoeflea
           phototrophica DFL-43]
          Length = 252

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 109/198 (55%), Gaps = 9/198 (4%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI-- 69
           + V+L+ + AL+TG+SRGIG  TA   A  GA V+   RS + L+++   +      +  
Sbjct: 1   MSVDLNGKTALITGASRGIGEATARIFADYGANVVLAARSTADLKRIAAEIGHRAHAVRC 60

Query: 70  DIFAF-DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           D+  F D++D+    +      +R+G+LDIL+ NA ++  I+ + +   +++  VI VNV
Sbjct: 61  DVSRFADVQDAVNASV------ERFGQLDILVNNAAVIEPIARLEESDPEAWGRVIDVNV 114

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
              +  +R+  P +K+S  G  + +SSGAA      W  Y ASKAA+ +L R   +E + 
Sbjct: 115 KGVYYGLRAAIPVMKRSGGGVVVNVSSGAAVSVLEGWSHYCASKAAVLSLTRAAHRENMQ 174

Query: 189 TALRVINIDPGPTRTSMR 206
             +RV+ + PG   T M+
Sbjct: 175 DNVRVVGLSPGTVATDMQ 192


>gi|237711953|ref|ZP_04542434.1| FabG protein [Bacteroides sp. 9_1_42FAA]
 gi|237725790|ref|ZP_04556271.1| FabG protein [Bacteroides sp. D4]
 gi|229435598|gb|EEO45675.1| FabG protein [Bacteroides dorei 5_1_36/D4]
 gi|229454648|gb|EEO60369.1| FabG protein [Bacteroides sp. 9_1_42FAA]
          Length = 249

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 119/240 (49%), Gaps = 24/240 (10%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++ +L+N++ALVTG+  GIG   A  LA  GA V+  GR+ + L +        + KI  
Sbjct: 1   MYKSLNNKVALVTGAGTGIGRAIAQRLADEGANVLIVGRTETTLVE----TAAYSDKISY 56

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            A DL   + +      + +R+G+LDIL+ NAG    ++P   +K   +  V ++NV A 
Sbjct: 57  LAIDLESEDGIRTIIRTVGERYGRLDILVNNAG-WAPVTPFATMKIDEYDKVFAINVRAV 115

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL--WGAYSASKAAIEALARTWSKETVNT 189
             + ++F P +K     +  IL+        P+     Y+ASKAA+  + R W+KE    
Sbjct: 116 VMLTQAFLPMIK---AAKGNILNVTTTMTTNPIATMANYAASKAAVYTMTRAWAKELAKD 172

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDP---------NTVP-----HPQKVAKIISFLCATQ 235
            +RV ++  GP  T +  K   +++           +VP      P++VA +++FL + +
Sbjct: 173 GVRVNSLGVGPIETPIYGKTELSDEAAKAHKDMVTKSVPLGRMGQPEEVAAVVAFLTSDE 232


>gi|222099886|ref|YP_002534454.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Thermotoga neapolitana
           DSM 4359]
 gi|221572276|gb|ACM23088.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Thermotoga neapolitana
           DSM 4359]
          Length = 260

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 117/232 (50%), Gaps = 9/232 (3%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           + + L+ ++ ++TG++ GIG   +L   + GA V AC  S + L  L    + +  K++ 
Sbjct: 13  VSMRLEGKVCMITGAASGIGKAASLLFVQEGAIVAACDVSETSLNTLVEEAKDLPGKVEP 72

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           +  D+ +   ++     I +++G++D+L+ NAGI    + + ++KE+ +  VI+VN+   
Sbjct: 73  YVLDVTNREQVKEVVESIVQKYGRIDVLVNNAGITRD-ALLVRMKEEDWDAVINVNLKGV 131

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           +N+ ++  P + K   G  I +SS       P    Y+ASKA +  + +TW+KE     +
Sbjct: 132 FNVTQAVVPHMIKQRSGSIINVSSVVGVYGNPGQTNYAASKAGVIGMTKTWAKELAGRNI 191

Query: 192 RVINIDPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           RV  + PG   T M        R  A+          P++VA++  FL + +
Sbjct: 192 RVNAVAPGFIETPMTEKLPDKAREAALSRIPLGRFGKPEEVAQVYLFLASDE 243


>gi|89890866|ref|ZP_01202375.1| short-chain dehydrogenases/reductases family (SDR) protein
           [Flavobacteria bacterium BBFL7]
 gi|89517011|gb|EAS19669.1| short-chain dehydrogenases/reductases family (SDR) protein
           [Flavobacteria bacterium BBFL7]
          Length = 244

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 118/237 (49%), Gaps = 32/237 (13%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVI--------ACGRSISQLEKLKNALQKINK 67
           L N+  +VTGSS+GIG   AL LA++GA ++        A  R++ ++  L      +  
Sbjct: 3   LKNKSIIVTGSSKGIGKEIALLLAQNGAELVVNYHSKKDAADRTVEEILNLGGKAIAVQA 62

Query: 68  KIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
            + +        +   L  T I + +GK+D+LI NAGI+ +   +    E +F D+I+VN
Sbjct: 63  DVSV------KEDFTRLFDTTI-EAYGKVDVLINNAGIMIN-KLVKDYTEDNFQDIINVN 114

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           +   +N ++  D  L  +  G  I  SS       P +G YSASKAA+E L R +SKE +
Sbjct: 115 LKGVFNGLQEADEKL--ADNGNIINFSSSTVKMMLPTYGVYSASKAAVEQLTRVFSKE-I 171

Query: 188 NTALRVINIDPGPTRTSM-----------RAKAMPAEDPNTVPHPQKVAKIISFLCA 233
              + V +I PGPT T +           + K M A D   +  P  +AK++ FL +
Sbjct: 172 GRGISVNSIAPGPTETELFLEGKSEEFIEKLKGMSAFD--RIADPIDIAKVVLFLAS 226


>gi|86135010|ref|ZP_01053592.1| short chain dehydrogenase [Polaribacter sp. MED152]
 gi|85821873|gb|EAQ43020.1| short chain dehydrogenase [Polaribacter sp. MED152]
          Length = 254

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 114/230 (49%), Gaps = 16/230 (6%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDL 76
            +LA+VTG++ GIG+  A  L   G  VI  G    +  E+LK  L+    + D + FD+
Sbjct: 6   GQLAIVTGATGGIGFAVAKRLGNEGYTVILNGIDDDAGAERLKE-LKADGIEADYYGFDV 64

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
            D NA+    T I +++GK+D+L+ NAG LG  S   ++    +  V+++N+ + +   R
Sbjct: 65  TDENAVTSNITKIGEKYGKIDVLVNNAGGLGGRSRFEEMTTDFYRFVMALNLDSTFFASR 124

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKC-RPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +  P+LKKS     I  +S A +    P  G Y  SKAA+ A+ R  +K+     +RV  
Sbjct: 125 AAIPFLKKSDNPSIINYTSNAGWNAGGPGAGIYGTSKAAVHAITRALAKDLAEYQIRVNA 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNT------------VPHPQKVAKIISFLCA 233
           + PG   T    K + +  P              +  P+ VA +++FL +
Sbjct: 185 VSPGTIDTDFH-KQIKSTKPEVFKSWANNIMLGRLGQPEDVAGVVAFLAS 233


>gi|307331421|ref|ZP_07610539.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
 gi|306882920|gb|EFN13988.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
          Length = 252

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 102/210 (48%), Gaps = 13/210 (6%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            + ALVTG+  G+G   AL  A  GA V+A GR+ S L +    ++  + +      D+ 
Sbjct: 6   GKTALVTGAGTGLGRAIALAFAAEGASVVATGRTASTLAETVRLIEAADGRAAAVPADVT 65

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           DS  L         R+G LDI + NAGI+    P+ ++ E+ +  V+  NV   W  M+ 
Sbjct: 66  DSGQLRELVHQAVTRFGGLDIAVNNAGIMRGQGPLGEVSEEDWEAVLRTNVTGVWLAMKH 125

Query: 138 FDPWLKKSHCGRAII-LSSGAAYKCR-PLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
               +K+ H G AI+ +SS      R P  GAYS SKAA+  L R  + + ++  +R+  
Sbjct: 126 QIAHMKE-HGGGAIVNVSSNLGAHLRVPGLGAYSTSKAAVATLTRAAALDHIHQGIRINA 184

Query: 196 IDPGPTRTSM----------RAKAMPAEDP 215
           + PG +   M          RA+ M  E+P
Sbjct: 185 VSPGASDAPMSLRPGETEADRAERMKTENP 214


>gi|222529148|ref|YP_002573030.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Caldicellulosiruptor
           bescii DSM 6725]
 gi|222455995|gb|ACM60257.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Caldicellulosiruptor
           bescii DSM 6725]
          Length = 248

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 101/191 (52%), Gaps = 2/191 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           L +++AL+TG+SRGIG   AL+ A++GA  VI    S SQ E LK  ++KI  K  I   
Sbjct: 4   LKDKVALITGASRGIGRAIALKFAQNGANVVINYSSSQSQAENLKEEIEKIGTKTMIIKC 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ + + +    + +   +G+LDIL+ NAGI      I +I E+ F  VIS+N+   +  
Sbjct: 64  DVSNPDEVNQMFSQVENEFGRLDILVNNAGITKD-GLILRINEEDFDKVISINLKGAFLC 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R+    + K   G  I +SS            Y+ASKA I  L ++ +KE  +  +RV 
Sbjct: 123 ARAAAKMMVKQRFGNIINISSVVGIAGNVGQANYAASKAGIIGLTKSLAKELASRNIRVN 182

Query: 195 NIDPGPTRTSM 205
            I PG  +T M
Sbjct: 183 AIAPGFIKTDM 193


>gi|158333274|ref|YP_001514446.1| short-chain dehydrogenase/reductase SDR [Acaryochloris marina
           MBIC11017]
 gi|158303515|gb|ABW25132.1| short-chain dehydrogenase/reductase SDR [Acaryochloris marina
           MBIC11017]
          Length = 227

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 112/231 (48%), Gaps = 6/231 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +R  ++TG ++G+G   A+   ++G  V  CGR+ + +  L    Q+          D+ 
Sbjct: 2   SRKIVITGVTQGLGEALAIGFIQAGHTVWGCGRTTASINHLA---QQYTSPHHFSTVDVA 58

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
            +  ++     + +     DI+I NAG++ +++P+W++ E   +DV+ VNV    NI+RS
Sbjct: 59  QAQQVQAWANQLLQTDEPPDIVINNAGVINTVAPLWEVPEPDISDVLDVNVKGTINIIRS 118

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
           F P +K    G  I  SSG      P    Y ASK AIE L + +++E V   +  I ++
Sbjct: 119 FLPSMKTKGQGIIINFSSGWGRSTSPGVAPYCASKWAIEGLNQAFAQE-VPPGIATIALN 177

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVA-KIISFLCATQKIETGKLFSVPQ 247
           PG   T M       +   + P P   A K + F+    + + G+  +VPQ
Sbjct: 178 PGIIHTEMLETCF-GQQARSYPSPTAWAQKAVPFILGLSENDNGQALTVPQ 227


>gi|152979284|ref|YP_001344913.1| short-chain dehydrogenase/reductase SDR [Actinobacillus
           succinogenes 130Z]
 gi|150841007|gb|ABR74978.1| short-chain dehydrogenase/reductase SDR [Actinobacillus
           succinogenes 130Z]
          Length = 248

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 120/246 (48%), Gaps = 21/246 (8%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL N+ ALVTG   GIG   A  +A+ GA V+  GR+ + LE+  +A Q  N  I     
Sbjct: 3   NLVNKTALVTGGGTGIGRAIAKRMAKDGANVVIIGRNEATLEE--SAEQHEN--ITYLVA 58

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+  S  +    T I + +GKLDI++ NAGI   ++PI  I    F    ++NV A  ++
Sbjct: 59  DVLKSEDIARVLTEIQEEFGKLDIVVNNAGI-APMTPIENINLADFDRTFALNVRAVIDV 117

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
                P+LK S  G  + + SG  +   P    Y+ASKAA+ +L RTW+KE     +RV 
Sbjct: 118 TAQAIPYLKASK-GNIVNIISGLVHNPMPGNCIYTASKAAVLSLTRTWAKELAAYGIRVN 176

Query: 195 NIDPGPTRTSMR-AKAMPAEDPN--------TVP-----HPQKVAKIISFLCATQ-KIET 239
            +  G   TS+  A     E  N         VP      P ++A I++FL +   +  T
Sbjct: 177 CVSVGAANTSIHDALGFSEEQMNAYKQAVSSAVPLGRFGEPDEIAPIVAFLASEHARYVT 236

Query: 240 GKLFSV 245
           G  + V
Sbjct: 237 GSDYGV 242


>gi|110589148|gb|ABG77083.1| short-chain dehydrogenase/reductase SDR oxidoreductase UcpA
           [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 263

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 116/233 (49%), Gaps = 6/233 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  R+  VTG+  G G   A   A  GA VI  GR++S+LE+  +A++     +  IF  
Sbjct: 25  LKERVIAVTGAGSGFGQAAAKAYAAHGATVILLGRTLSKLEETYDAIEAAGGAQPAIFPI 84

Query: 75  DLRDSNALE---LTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           +L      E   L++T I K + +LD L+  A  L  +S I     +++  V+ VN+ A 
Sbjct: 85  NLESLTEQEYYALSET-IYKEFNRLDGLLHCAAQLALLSRIDDYDLETWNKVMQVNLTAP 143

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + +   P LK++     I  S     K +  WGAY  SK  +E L +  ++ET ++ L
Sbjct: 144 FMLTQVCLPLLKRADDASIIFTSDQVGRKGKAYWGAYGVSKFGVEGLMQILAEETEDSPL 203

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGKLF 243
           RV +I PG  RT++RA A P EDP   P P+   +   +L        TG+ F
Sbjct: 204 RVNSIAPGAARTALRAWAYPGEDPQERPLPEAFMRPFLYLMGPDSAGVTGQAF 256


>gi|298242910|ref|ZP_06966717.1| short-chain dehydrogenase/reductase SDR [Ktedonobacter racemifer
           DSM 44963]
 gi|297555964|gb|EFH89828.1| short-chain dehydrogenase/reductase SDR [Ktedonobacter racemifer
           DSM 44963]
          Length = 259

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 1/203 (0%)

Query: 1   MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKN 60
           M D +     EI++ L  + ALVTGS+ GIG   A   AR G  V+  GR+  + + + +
Sbjct: 1   MRDEKQTLEKEIYMRLQGKTALVTGSTSGIGQAIAEAFAREGVRVVVSGRNAQRGQAVVD 60

Query: 61  ALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSF 120
           A++    +    A D      +          +G +DIL+ NAGI    +P+ Q+ E +F
Sbjct: 61  AIRAKGGQATFLAADQASVEGVRRLAKEATAVFGSIDILVNNAGIF-PFAPLEQVDEATF 119

Query: 121 ADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
               ++NV   + +  +  P + +   G+ I +++  A+   P+   Y ++KAA+  L +
Sbjct: 120 DTTYAINVKGPFFLTAALAPQMAERGSGKVINITTMVAHVGEPMMSLYGSTKAALTLLTK 179

Query: 181 TWSKETVNTALRVINIDPGPTRT 203
            W+ E     + V  I PGPT T
Sbjct: 180 AWATELGPKGVNVNAIAPGPTYT 202


>gi|302872016|ref|YP_003840652.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574875|gb|ADL42666.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 248

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 103/191 (53%), Gaps = 2/191 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIA-CGRSISQLEKLKNALQKINKKIDIFAF 74
           L +++AL+TG+SRGIG   AL+ A++GA VI     S SQ E LK  ++KI  K  I   
Sbjct: 4   LKDKVALITGASRGIGRAIALKFAQNGANVIINYSSSQSQAENLKEEIEKIGTKAMIIKC 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ +S+ +    + I K +G+LDIL+ NAGI      I ++ E+ F  VI++N+   +  
Sbjct: 64  DVSNSDEVNQMFSQIEKEFGRLDILVNNAGITKD-GLILRMNEEDFDKVIAINLKGAFLC 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            ++    + K   G  I +SS            Y+ASKA I  L ++ +KE  +  +RV 
Sbjct: 123 AKAAAKMMVKQRFGNIINISSVVGITGNIGQANYAASKAGIIGLTKSLAKELASRNIRVN 182

Query: 195 NIDPGPTRTSM 205
            I PG  +T M
Sbjct: 183 AIAPGFIKTDM 193


>gi|302876932|ref|YP_003845565.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Clostridium
           cellulovorans 743B]
 gi|307687621|ref|ZP_07630067.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Clostridium
           cellulovorans 743B]
 gi|302579789|gb|ADL53801.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Clostridium
           cellulovorans 743B]
          Length = 246

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 118/229 (51%), Gaps = 14/229 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIFAF 74
           L  + A+VTG++RGIG   A +LA SGA V+   RS   + EKLK  L+ +  KI +   
Sbjct: 2   LAGQCAIVTGATRGIGRAIATKLATSGANVVVNYRSNTEEAEKLKTELEALGVKILLVQG 61

Query: 75  DLRDSNALELTKTYIAKR--WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           D+  S   E  K  +A +  +GK+DIL+ NAGI      I ++KE+ F  VI VN+   +
Sbjct: 62  DI--SKDEEAKKLILAAKDAFGKIDILVNNAGITKD-GLIMRMKEEDFDKVIEVNLKGTF 118

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           N  +     + K   G+ I +SS            YSASKA I  + ++ +KE  +  + 
Sbjct: 119 NCSKHVTSVMIKQKYGKIINISSVVGIVGNAGQVNYSASKAGIIGMTKSLAKELGSRGIN 178

Query: 193 VINIDPGPTRTSMR---AKAMPAEDPNTVP-----HPQKVAKIISFLCA 233
           V  + PG   T M    ++ +  E  N++P      P+ VA++++FL +
Sbjct: 179 VNAVAPGYIVTDMTEELSEKIKEETKNSIPLKRLGEPEDVAELVAFLAS 227


>gi|297156140|gb|ADI05852.1| putative dehydrogenase [Streptomyces bingchenggensis BCW-1]
          Length = 252

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 108/228 (47%), Gaps = 14/228 (6%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            + ALVTG+  G+G   AL  A  GA V+A GR+ + L++    ++    K      D+ 
Sbjct: 6   GKTALVTGAGSGLGRAIALAFAAEGASVVAAGRTAATLDETVGLIEAAGGKAAAAVADVT 65

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           DS  L         R+G LDI + NAGIL  + P+ ++ E+ +  V   NV   W  M+ 
Sbjct: 66  DSGQLRALVQETVTRFGGLDIAVNNAGILRGVGPVGEVSEEDWDAVQRTNVTGVWLAMKH 125

Query: 138 FDPWLKKSHCGRAI--ILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
               +K  H G AI  I S+  A+   P   AY  SKAA+ AL R  + + ++  +R+  
Sbjct: 126 EIAHMKD-HGGGAIVNIASNLGAHLRIPNLAAYLTSKAAVSALTRAAALDHIHQGIRINA 184

Query: 196 IDPGPTRTSM----------RAKAMPAEDP-NTVPHPQKVAKIISFLC 232
           + PG   TSM          RA+ M  E P   +   ++VA  + +L 
Sbjct: 185 VSPGAAATSMSLRPGETEAGRAERMKRETPLGRLAETEEVAAAVLYLA 232


>gi|300864358|ref|ZP_07109231.1| short-chain dehydrogenase/reductase SDR [Oscillatoria sp. PCC 6506]
 gi|300337633|emb|CBN54377.1| short-chain dehydrogenase/reductase SDR [Oscillatoria sp. PCC 6506]
          Length = 258

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 122/252 (48%), Gaps = 24/252 (9%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID---- 70
           ++ +++ L+TG+S GIG   A   AR GA +I   R   +LE+LKN   ++ K+ +    
Sbjct: 3   SVQDKIVLITGASSGIGAACARIFARGGAKLILAAR---RLERLKNMAAELTKEFETEIY 59

Query: 71  IFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
               D+RD   +E   T +   W K+DILI NAG+   +  +++   + + ++I  NV  
Sbjct: 60  FLQLDVRDRAQVESAFTKLPDAWAKVDILINNAGLSRGLDKLYEGDFQDWEEMIDTNVKG 119

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
              + R   P +     G  I + S A ++  P    Y ASKAA++A++    ++ + T 
Sbjct: 120 LLYVTRYIVPGMVSRGRGHVINIGSIAGHQTYPGGNVYCASKAAVKAISEGLKQDLLGTP 179

Query: 191 LRVINIDPGPTRTSM----------RAK-AMPAEDPNTVPHPQKVAKIISFLCATQ--KI 237
           +RV ++DPG   T            RAK       P T   P  VA ++ F CAT+   +
Sbjct: 180 IRVSSVDPGLVETEFSQIRFHGDGERAKNVYQGLTPLT---PDDVADVVYF-CATRSPHV 235

Query: 238 ETGKLFSVPQNR 249
              ++  VP ++
Sbjct: 236 NISEVLLVPTDQ 247


>gi|167946229|ref|ZP_02533303.1| short-chain dehydrogenase/reductase SDR [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 250

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 116/233 (49%), Gaps = 6/233 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L  R+  VTG+  G G   A   A  GA VI  GR++S+LE+  +A++     +  IF  
Sbjct: 12  LKERVIAVTGAGSGFGQAAAKAYAAHGATVILLGRTLSKLEETYDAIEAAGGAQPAIFPI 71

Query: 75  DLRDSNALE---LTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           +L      E   L++T I K + +LD L+  A  L  +S I     +++  V+ VN+ A 
Sbjct: 72  NLESLTEQEYYALSET-IYKEFNRLDGLLHCAAQLALLSRIDDYDLETWNKVMQVNLTAP 130

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + + +   P LK++     I  S     K +  WGAY  SK  +E L +  ++ET ++ L
Sbjct: 131 FMLTQVCLPLLKRADDASIIFTSDQVGRKGKAYWGAYGVSKFGVEGLMQILAEETEDSPL 190

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE-TGKLF 243
           RV +I PG  RT++RA A P EDP   P P+   +   +L        TG+ F
Sbjct: 191 RVNSIAPGAARTALRAWAYPGEDPQERPLPEAFMRPFLYLMGPDSAGVTGQAF 243


>gi|296445027|ref|ZP_06886988.1| short-chain dehydrogenase/reductase SDR [Methylosinus trichosporium
           OB3b]
 gi|296257448|gb|EFH04514.1| short-chain dehydrogenase/reductase SDR [Methylosinus trichosporium
           OB3b]
          Length = 249

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 113/233 (48%), Gaps = 22/233 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++A+VTG S GIG  TA   A  GA V+  GR   +LE    A+ +I         D
Sbjct: 4   LQGKIAVVTGGSSGIGLATAKLFAAEGAKVVITGRRKPELEA---AVAEIGSNAFGVQGD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +   + L+     +  R G++DIL ANAG L  ++P+  + E  F  +  VNV     ++
Sbjct: 61  VAKLDDLDRLYAEVKARHGRIDILFANAG-LARLAPLEAVDEAHFDLLFGVNVK---GLL 116

Query: 136 RSFDPWLKKSHCGRAIILSSGAA-YKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            +    L     G AI+L+S  A  K  P +G YSA+KAA+ +  R+W+ E  +  +RV 
Sbjct: 117 FTVQKALPLFSAGGAIVLNSSVANTKGMPAFGVYSATKAAVRSFVRSWTSELKDRGIRVN 176

Query: 195 NIDPGPTRTSM-RAKAMPAED--------PNTVP-----HPQKVAKIISFLCA 233
            I PGP  T +     +PAE           +VP      P+++A  + FL +
Sbjct: 177 AISPGPIETPIFDTLGLPAEQVAEFGANISQSVPLGRFGRPEEIAAAVLFLAS 229


>gi|229825604|ref|ZP_04451673.1| hypothetical protein GCWU000182_00966 [Abiotrophia defectiva ATCC
           49176]
 gi|229790167|gb|EEP26281.1| hypothetical protein GCWU000182_00966 [Abiotrophia defectiva ATCC
           49176]
          Length = 248

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 110/227 (48%), Gaps = 10/227 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74
           LD ++ LVTG+SRGIG  T    AR GA V A  R+   L+ L   L +K N  +    F
Sbjct: 4   LDGKVCLVTGASRGIGAATVKRFAREGAVVYANARTPKNLDDLCIELSEKYNTTVKALYF 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+RD  A +     I K  G+LD+L+ NAG++   + I  I +    ++  +NV    N+
Sbjct: 64  DVRDETAAKKAVLQIRKETGRLDVLVNNAGVMKD-ALIGMISKDLMQEMFDINVFGVMNL 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           ++     +     G  I LSS    +  P    YSA+K A+ A+ +T +KE  +  +RV 
Sbjct: 123 LQLASKIMMFQKSGSIINLSSIVGLEGIPGKLVYSAAKGAVAAMTKTAAKELASQGIRVN 182

Query: 195 NIDPGPTRTSMRA----KAMPAEDPNT----VPHPQKVAKIISFLCA 233
            + PG   T M      + M  +  N     +  P++VA  I FL +
Sbjct: 183 AVAPGMIDTDMLKSVGDEKMKEQIANIRMGRLGTPEEVADAILFLAS 229


>gi|119511943|ref|ZP_01631041.1| Short-chain dehydrogenase/reductase SDR [Nodularia spumigena
           CCY9414]
 gi|119463439|gb|EAW44378.1| Short-chain dehydrogenase/reductase SDR [Nodularia spumigena
           CCY9414]
          Length = 257

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 113/231 (48%), Gaps = 10/231 (4%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK-INKKIDIF 72
           ++L+NR+ L+TG+S GIG   A   A +GA +I   R   +LE+L + L K    +  + 
Sbjct: 2   ISLENRIILITGASSGIGTACAKIFAGAGAKLILAARRWERLEELADTLNKEFGVETHLL 61

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+RD +A+E   + +   W  +DILI NAG+   +  + +   + + ++I  N+    
Sbjct: 62  QLDVRDRSAVESAISSLPPAWSDIDILINNAGLSRGLDKLHEGDFQGWDEMIDTNIKGLL 121

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + R   P + K   G  + L S A ++  P    Y A+KAA++A++    ++ + T +R
Sbjct: 122 YLTRYVVPGMVKRDRGHIVNLGSIAGHQTYPGGNVYCATKAAVKAISEGLKQDLLGTPVR 181

Query: 193 VINIDPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
           V +IDPG   T           A+A       T      VA +I F C T+
Sbjct: 182 VTSIDPGMVETEFSNVRFHGDNARADKVYQGVTPLTADDVADVI-FFCVTR 231


>gi|15614773|ref|NP_243076.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Bacillus halodurans
           C-125]
 gi|10174829|dbj|BAB05929.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Bacillus halodurans
           C-125]
          Length = 244

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 113/233 (48%), Gaps = 8/233 (3%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKN-ALQKINKKIDIFAFD 75
           D ++ ++TG+S+G+G   AL  AR+   +  C R+   LE +K  AL+   + +     D
Sbjct: 3   DTKVVMITGASKGLGKALALTFARNHWSLALCARNEQALEAVKQEALESGAESVLAIQAD 62

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEK--SFADVISVNVMANWN 133
                 ++   +     +G +D+LI NA I G   P W +     SF DV+  NV+  + 
Sbjct: 63  GAVEKDMDRFVSLTESTFGHIDVLIVNASIFGP-GPAWLLDYDLSSFQDVLLTNVLHPFM 121

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           I +   P + +   G  + ++S A       WGAY  SK A+E LA TW+ E   T + +
Sbjct: 122 ITKRVLPGMLQRKKGTILHVTSEAGKTGFAEWGAYGISKFALEGLAETWANELTETDIAL 181

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIET--GKLFS 244
             IDPG   T M A A+P  D   +  P+ VA +  F  A++K E   GK F 
Sbjct: 182 SWIDPGEMDTDMHAIAVPDCD-YPLAKPEDVANVF-FAIASRKREEVHGKRFE 232


>gi|270157930|ref|ZP_06186587.1| serine 3-dehydrogenase [Legionella longbeachae D-4968]
 gi|289163798|ref|YP_003453936.1| L-allo-threonine dehydrogenase, NAD(P)-binding [Legionella
           longbeachae NSW150]
 gi|269989955|gb|EEZ96209.1| serine 3-dehydrogenase [Legionella longbeachae D-4968]
 gi|288856971|emb|CBJ10785.1| L-allo-threonine dehydrogenase, NAD(P)-binding [Legionella
           longbeachae NSW150]
          Length = 258

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 100/192 (52%), Gaps = 1/192 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFA 73
           +L +++ L+TG+S GIG   A   A+ GA +I C R + +LE+L   L+++  K+  I  
Sbjct: 3   DLMDKIILITGASSGIGQACAQLCAKYGARLILCARRVERLEQLAKELKQLYGKEHYILP 62

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+R+   ++     +  +W  ++ILI NAG+     P+ Q  E+ +  +I  N+     
Sbjct: 63  LDVREHEQVKKQLAALPSQWQSIEILINNAGLALDTLPVQQGIEEHWDIMIDTNIKGLLY 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + R+  P + +   G  + + S A ++C P    Y A+K A+ AL++T   + + + +RV
Sbjct: 123 VSRALIPGMLERGYGHVVNIGSIAGHECYPNGNVYCATKHAVHALSKTMRLDMLGSPVRV 182

Query: 194 INIDPGPTRTSM 205
             I PG   T  
Sbjct: 183 TEIAPGAVETEF 194


>gi|88810637|ref|ZP_01125894.1| short chain dehydrogenase [Nitrococcus mobilis Nb-231]
 gi|88792267|gb|EAR23377.1| short chain dehydrogenase [Nitrococcus mobilis Nb-231]
          Length = 262

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 125/237 (52%), Gaps = 9/237 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN-KKIDIFAF 74
           L N+  L+TG+  GIG  TAL  A++GA VI   R I  LE++ + ++     +  I+  
Sbjct: 20  LANQRVLITGAGAGIGRATALAAAQAGATVILLDRHIPPLERVYDEIETAGGPQPAIYPM 79

Query: 75  DLRDSNALELTKTYIAKRW----GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
           DL  +   + T+  +A+R       LD LI NA  LG   PI     +++   + +N+ A
Sbjct: 80  DLLGAKPQDYTE--LAQRLNDSLAGLDALIHNAAELGRPCPIAHYDIETWFRTLHINLNA 137

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-T 189
            + + R+  P L+++   R I +S  A    +P  GAY  +K+ +E L RT + E  + +
Sbjct: 138 PFLLTRACLPLLERASHSRVIFISDLAGRIGKPYAGAYGVAKSGLEGLMRTLAAELPDDS 197

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAK-IISFLCATQKIETGKLFSV 245
            +R ++ DPG TRT++RA A PAE+P  +  P   A+ +I  L   +    G +F++
Sbjct: 198 PVRCVSYDPGATRTALRALAYPAENPAELRSPDGAARGLIYLLDPRRPARQGGMFTL 254


>gi|312622601|ref|YP_004024214.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203068|gb|ADQ46395.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 248

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 102/191 (53%), Gaps = 2/191 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           L +++AL+TG+SRGIG   AL+ A++GA  VI    S SQ E LK  ++KI  K  I   
Sbjct: 4   LKDKVALITGASRGIGRAIALKFAQNGANVVINYSSSQSQAENLKEEIEKIGTKTMIIKC 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ + + +    + + K +G+LDIL+ NAGI      I ++ E+ F  VI++N+   +  
Sbjct: 64  DVSNPDEVSHMFSQVEKEFGRLDILVNNAGITKD-GLILRMNEEDFDKVIAINLKGAFLC 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R+    + K   G  I +SS            Y+ASKA I  L ++ +KE  +  +RV 
Sbjct: 123 ARAAAKMMVKQRFGNIINISSVVGIAGNVGQANYAASKAGIIGLTKSLAKELASRNIRVN 182

Query: 195 NIDPGPTRTSM 205
            I PG  +T M
Sbjct: 183 AIAPGFIKTDM 193


>gi|325955465|ref|YP_004239125.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Weeksella virosa DSM
           16922]
 gi|323438083|gb|ADX68547.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Weeksella virosa DSM
           16922]
          Length = 236

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 107/214 (50%), Gaps = 2/214 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ + AL+TG SRG+G   AL  A+ G  V   GR+   L+K+   LQ++  +     FD
Sbjct: 2   LNTKKALITGGSRGLGKAIALAFAKEGIDVAITGRNKDLLKKVVTELQELGVRATYAIFD 61

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +++   +  + T + + +G  DIL+ NAGI      + +++E  + +++  NV+  + + 
Sbjct: 62  IKNREEVHSSLTKLTEDFGPFDILVNNAGI-SKFGTLLEMEESDWENILLTNVLGMYYVT 120

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R   P + + + G    +SS A     P   AYSASK A+  +  +  KE     +RV  
Sbjct: 121 REILPQMIEKNEGDIFNVSSTAGLAGNPTTSAYSASKFAVIGMNESLMKEVRKNNIRVTT 180

Query: 196 IDPGPTRTSMRAK-AMPAEDPNTVPHPQKVAKII 228
           + P    + M  +  +   +P +V  P+  A++I
Sbjct: 181 LTPSTIASDMSKQLGLTDGNPESVLQPEDFAELI 214


>gi|300313745|ref|YP_003777837.1| short-chain alcohol dehydrogenase [Herbaspirillum seropedicae SmR1]
 gi|300076530|gb|ADJ65929.1| short-chain alcohol dehydrogenase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 249

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 113/235 (48%), Gaps = 25/235 (10%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L+ ++ALVTG + GIG  TA ELA  GA V   GR  ++L+    ++      I     
Sbjct: 4   QLNGKIALVTGGTSGIGLATAQELAAQGAQVFITGRRQAELDAAVASIGAAATGIR---- 59

Query: 75  DLRDSNAL-ELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D++ L EL   Y  IAK  G+LDIL ANAG  G + P+  I E+ F  +   NV   
Sbjct: 60  --ADASVLSELDTVYAQIAKSAGRLDILFANAGG-GDMMPLGAITEEHFDRIFGTNVRGV 116

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
              ++   P L        I+ SS  +      +  YSASKAA+   AR+W+ +  + A+
Sbjct: 117 LFTVQKALPLLVDGAS--VILTSSTTSVLGTANFSVYSASKAAVRNFARSWALDLKDRAI 174

Query: 192 RVINIDPGPTRTSMRAKAMPAED--------PNTVP-----HPQKVAKIISFLCA 233
           RV  + PGP RT    + +P +          + VP      PQ++ K ++FL +
Sbjct: 175 RVNVVSPGPIRTPGLGELVPDDARQGLFDYLASQVPLGRLGEPQEIGKAVAFLAS 229


>gi|302187660|ref|ZP_07264333.1| short chain dehydrogenase [Pseudomonas syringae pv. syringae 642]
          Length = 246

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 98/201 (48%), Gaps = 8/201 (3%)

Query: 34  TALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW 93
           T L L R+ A ++     I    K    LQ +    D+ + D    +AL      I +  
Sbjct: 39  TVLLLGRTEASLVQVHDEI----KAAGLLQPLVIPFDLESADPAQYHAL---AAMIERTV 91

Query: 94  GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIIL 153
           G+LD L+ NA I+G  + +  +  + F  V+ VNV A + + ++  P L++S        
Sbjct: 92  GRLDGLLHNASIIGPRTSVEHLPGEDFMQVMHVNVNATFMLTQALLPLLQRSEDASIAFT 151

Query: 154 SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN-TALRVINIDPGPTRTSMRAKAMPA 212
           SS    K R  WGAY  SK A E L +T + E    + +R  +I+PG TRT MRA+A P 
Sbjct: 152 SSSVGRKGRAQWGAYGVSKFATEGLMQTLADELEGVSTVRANSINPGATRTGMRAQAYPD 211

Query: 213 EDPNTVPHPQKVAKIISFLCA 233
           E+P   P P+++  +  +L  
Sbjct: 212 ENPQNNPAPEEIMPVYLYLLG 232


>gi|161579552|ref|YP_883621.2| short chain dehydrogenase [Mycobacterium avium 104]
          Length = 275

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 103/205 (50%), Gaps = 15/205 (7%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACG-------------RSISQLEKLKNA 61
           +L  R+A +TG++RG G   A+ LA  GA +IAC               S   L++    
Sbjct: 7   SLQGRVAFITGAARGQGRSHAVRLAAEGADIIACDICAPVSASVTYAPASPEDLDETARL 66

Query: 62  LQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFA 121
           ++   +K      D+RD  AL        +++G+LD+++ANAG+L S   +W++ ++ + 
Sbjct: 67  VEDQGRKALTRVLDVRDDAALRELVADGMEQFGRLDVVVANAGVL-SWGRVWELTDEQWD 125

Query: 122 DVISVNVMANWNIMRSFDP-WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
            VI VN+   W  +R+  P  ++  + G  +++SS A  K  P  G YSASK  + AL  
Sbjct: 126 TVIGVNLTGTWRTLRATVPAMIEAGNGGSIVVVSSSAGLKATPGNGHYSASKHGLTALTN 185

Query: 181 TWSKETVNTALRVINIDPGPTRTSM 205
           T + E     +RV +I P    T M
Sbjct: 186 TLAIELGEYGIRVNSIHPYSVETPM 210


>gi|312597538|pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From
           Mycobacterium Paratuberculosis Bound To Nicotinamide
           Adenine Dinucleotide
 gi|312597539|pdb|3PGX|B Chain B, Crystal Structure Of A Putative Carveol Dehydrogenase From
           Mycobacterium Paratuberculosis Bound To Nicotinamide
           Adenine Dinucleotide
 gi|312597540|pdb|3PGX|C Chain C, Crystal Structure Of A Putative Carveol Dehydrogenase From
           Mycobacterium Paratuberculosis Bound To Nicotinamide
           Adenine Dinucleotide
 gi|312597541|pdb|3PGX|D Chain D, Crystal Structure Of A Putative Carveol Dehydrogenase From
           Mycobacterium Paratuberculosis Bound To Nicotinamide
           Adenine Dinucleotide
          Length = 280

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 103/205 (50%), Gaps = 15/205 (7%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACG-------------RSISQLEKLKNA 61
           +L  R+A +TG++RG G   A+ LA  GA +IAC               S   L++    
Sbjct: 12  SLQGRVAFITGAARGQGRSHAVRLAAEGADIIACDICAPVSASVTYAPASPEDLDETARL 71

Query: 62  LQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFA 121
           ++   +K      D+RD  AL        +++G+LD+++ANAG+L S   +W++ ++ + 
Sbjct: 72  VEDQGRKALTRVLDVRDDAALRELVADGMEQFGRLDVVVANAGVL-SWGRVWELTDEQWD 130

Query: 122 DVISVNVMANWNIMRSFDP-WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
            VI VN+   W  +R+  P  ++  + G  +++SS A  K  P  G YSASK  + AL  
Sbjct: 131 TVIGVNLTGTWRTLRATVPAMIEAGNGGSIVVVSSSAGLKATPGNGHYSASKHGLTALTN 190

Query: 181 TWSKETVNTALRVINIDPGPTRTSM 205
           T + E     +RV +I P    T M
Sbjct: 191 TLAIELGEYGIRVNSIHPYSVETPM 215


>gi|41408508|ref|NP_961344.1| hypothetical protein MAP2410 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41396864|gb|AAS04727.1| hypothetical protein MAP_2410 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 273

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 105/210 (50%), Gaps = 17/210 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIA---CGR----------SISQLEKLKNAL 62
           L+ R+A +TG++RG G   A+ +A  GA +IA    G+          S   L +    +
Sbjct: 5   LEGRVAFITGAARGQGRAHAVRMAAEGADIIAVDIAGKLPSCVPYDPASPDDLSETVRLV 64

Query: 63  QKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQ-IKEKSFA 121
           +  N++I     D RD + L           G+LDI++ANAG+    +  W  I  + F 
Sbjct: 65  EAANRRIVAAVVDTRDFDRLRKVVDDGVAALGRLDIIVANAGVAAPQA--WDDITPEDFR 122

Query: 122 DVISVNVMANWNIMRSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALAR 180
           DV+ +NV   WN + +  P + +   G +IIL SS A  K +P    Y+ASK A+  LAR
Sbjct: 123 DVMDINVTGTWNTVMAGAPRIIEGGRGGSIILISSAAGMKMQPFMIHYTASKHAVTGLAR 182

Query: 181 TWSKETVNTALRVINIDPGPTRTSMRAKAM 210
            ++ E    ++RV ++ PGP  T M +  M
Sbjct: 183 AFAAELGKHSIRVNSVHPGPVNTPMGSGDM 212


>gi|41410244|ref|NP_963080.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Mycobacterium avium
           subsp. paratuberculosis K-10]
 gi|41399078|gb|AAS06696.1| hypothetical protein MAP_4146 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 275

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 103/205 (50%), Gaps = 15/205 (7%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACG-------------RSISQLEKLKNA 61
           +L  R+A +TG++RG G   A+ LA  GA +IAC               S   L++    
Sbjct: 7   SLQGRVAFITGAARGQGRSHAVRLAAEGADIIACDICAPVSASVTYAPASPEDLDETARL 66

Query: 62  LQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFA 121
           ++   +K      D+RD  AL        +++G+LD+++ANAG+L S   +W++ ++ + 
Sbjct: 67  VEDQGRKALTRVLDVRDDAALRELVADGMEQFGRLDVVVANAGVL-SWGRVWELTDEQWD 125

Query: 122 DVISVNVMANWNIMRSFDP-WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
            VI VN+   W  +R+  P  ++  + G  +++SS A  K  P  G YSASK  + AL  
Sbjct: 126 TVIGVNLTGTWRTLRATVPAMIEAGNGGSIVVVSSSAGLKATPGNGHYSASKHGLTALTN 185

Query: 181 TWSKETVNTALRVINIDPGPTRTSM 205
           T + E     +RV +I P    T M
Sbjct: 186 TLAIELGEYGIRVNSIHPYSVETPM 210


>gi|325279832|ref|YP_004252374.1| Serine 3-dehydrogenase [Odoribacter splanchnicus DSM 20712]
 gi|324311641|gb|ADY32194.1| Serine 3-dehydrogenase [Odoribacter splanchnicus DSM 20712]
          Length = 251

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 97/188 (51%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           N++AL+TG++ GIG  TAL+ A +G  VI  GR   +L++L  ++ +    +   AFD+R
Sbjct: 2   NKIALITGATSGIGQATALKAAEAGFDVIITGRRNDRLQELAESICQKGADVLPLAFDIR 61

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
            S  +E     +  +W  + +L+ NAG+   ++PI +     +  +I  NV     I R+
Sbjct: 62  QSGEVETAIRNLGGKWRDISVLVNNAGLAVGVAPIQEGVLDDWERMIDTNVKGLLYITRA 121

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P +   + G  + L+S A  +  P    Y A+K A++AL+R    + +   ++V NI 
Sbjct: 122 VAPLMIARNTGHIVNLASIAGKEVYPGGNVYCATKHAVDALSRAMRTDMLKHHIKVTNIA 181

Query: 198 PGPTRTSM 205
           PG   T  
Sbjct: 182 PGMVETEF 189


>gi|262369307|ref|ZP_06062635.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter johnsonii
           SH046]
 gi|262315375|gb|EEY96414.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter johnsonii
           SH046]
          Length = 244

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 115/225 (51%), Gaps = 12/225 (5%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           + ++ALVTG+SRGIG   A +L + G +V+    S S  EKL  +  +          D+
Sbjct: 4   ERKIALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAEKLAASFGEHGAGK---VLDV 60

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
           RD  A++   T I + +G + +L+ NAGI    + + ++ E  + D++++++ A + + +
Sbjct: 61  RDGTAIDALVTDIEQNYGPVLVLVNNAGITKD-NLLLRMSEDDWDDILNIHLKAVYRLSK 119

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
                + K+  GR I +SS  A+   P    YSA+KA IEA +R+ +KE  +  + V ++
Sbjct: 120 RVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSV 179

Query: 197 DPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCA 233
            PG   T M        R K       N +  PQ +A  +SFL +
Sbjct: 180 APGFIATEMTEQLSEDIRKKMSDQVALNRLGDPQDIANAVSFLAS 224


>gi|326793453|ref|YP_004311273.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Marinomonas
           mediterranea MMB-1]
 gi|326544217|gb|ADZ89437.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Marinomonas
           mediterranea MMB-1]
          Length = 249

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 104/210 (49%), Gaps = 13/210 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  + AL+TG S GIG+ TA +    GA V+  GR +  LEK K  L        IF  D
Sbjct: 4   LAKKYALITGGSAGIGFETARQFIAEGAEVLITGRHVEGLEKAKALL---GDNAHIFQND 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
             D  + +    YIA  + +LDI+  NAG +  + P+    E +F  VIS N+   + ++
Sbjct: 61  AGDIASQQALSCYIADTFPRLDIVFVNAGDVTHL-PVADWDEAAFDRVISTNLKGPFFLI 119

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +S    L  S     I+  S +A+   P    Y+ASKA +++L+RT S E  +  +RV +
Sbjct: 120 QSLQALLSGS--ASIILCGSVSAHIGLPQSSVYAASKAGLQSLSRTLSGELKHLGIRVNS 177

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVA 225
           + PGPT T        A D   +P  +K A
Sbjct: 178 LSPGPTETG-------AFDKFGLPQKEKEA 200


>gi|269126287|ref|YP_003299657.1| short-chain dehydrogenase/reductase SDR [Thermomonospora curvata
           DSM 43183]
 gi|268311245|gb|ACY97619.1| short-chain dehydrogenase/reductase SDR [Thermomonospora curvata
           DSM 43183]
          Length = 268

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 120/248 (48%), Gaps = 29/248 (11%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIAC-------------GRSISQLEKLKNAL 62
           L  ++A +TG++RG G   A+ LA  GA +IA                + + L++    +
Sbjct: 4   LAGKVAFITGAARGQGRAEAVRLAAEGADIIAIDLVDNPSRYVKYPAATQADLDETAKLV 63

Query: 63  QKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFAD 122
           ++  +++     D+R  + LE        ++G+LD+++ANAGI+ +    W++ E+ + D
Sbjct: 64  EQQGRRVLARKADVRKLDELEAVVREGVAQFGRLDVVVANAGIV-NYGRTWELDEEQWQD 122

Query: 123 VISVNVMANWNIMRSFDP-WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALART 181
           +I +N+   W  +++  P  L++   G  II+SS A  K  P    Y+A+K  +  LA+T
Sbjct: 123 LIDINLTGVWKTVKATVPVLLEQKQGGSVIIISSVAGLKGLPFLAHYAAAKHGVVGLAKT 182

Query: 182 WSKETVNTALRVINIDPGPTRTSMRAKAMP---AEDPNTVP-----------HPQKVAKI 227
            + E     +RV  I P   RT M   +M    A+ P   P            P+ +A +
Sbjct: 183 LANELAEHDIRVNTIHPHGVRTGMTDDSMRDFLAQSPMLAPIYMPALPYQMVEPEDIANM 242

Query: 228 ISFLCATQ 235
           ++FL + +
Sbjct: 243 VAFLASDE 250


>gi|282863033|ref|ZP_06272093.1| short-chain dehydrogenase/reductase SDR [Streptomyces sp. ACTE]
 gi|282562015|gb|EFB67557.1| short-chain dehydrogenase/reductase SDR [Streptomyces sp. ACTE]
          Length = 285

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 99/203 (48%), Gaps = 9/203 (4%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF--DLRDS 79
            +TG+SRGIG     +L   G  V A  RS    E+L  AL        + A   DL D 
Sbjct: 11  FITGASRGIGLELVRQLLAQGDNVAATTRST---ERLTAALGGTADTSRLLALTVDLTDE 67

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
             +       A+R+G+LD+++ NAG  G ++ + +   K   D++ V V+  WN++R+  
Sbjct: 68  AEVGSAVDQAAERFGRLDVVVNNAGY-GFLAAVEETSTKDVRDMLDVQVVGVWNVLRAAL 126

Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199
           P L++   GR I +SS       P W  Y A K A+E L+   + E  +  ++V  ++PG
Sbjct: 127 PVLREQRAGRVINISSILGLTTMPGWALYCAGKFALEGLSEALAAEVADLGIKVTVVEPG 186

Query: 200 PTRTSM---RAKAMPAEDPNTVP 219
             RTS     + A+PAE     P
Sbjct: 187 YFRTSFLTTDSLALPAETSKHYP 209


>gi|322834743|ref|YP_004214770.1| short-chain dehydrogenase/reductase SDR [Rahnella sp. Y9602]
 gi|321169944|gb|ADW75643.1| short-chain dehydrogenase/reductase SDR [Rahnella sp. Y9602]
          Length = 246

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 112/227 (49%), Gaps = 19/227 (8%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIA-CGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           +ALVTG+SRGIG   A  LA  G  VI    R  ++ + +   +++   K      D+ D
Sbjct: 8   VALVTGASRGIGAAIAERLAHDGFTVIVNYSRGAAEADAVVRKIEQAGGKAISAQADVSD 67

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           + A+        + +G +D+L+ NAGI+ ++S I +  + +F  +I +N+   +N +R  
Sbjct: 68  AAAVGRMFASAEQAFGGVDVLVNNAGIM-TLSAIAETDDAAFDRLIDINLKGTFNTLREA 126

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
              L     GR I  SS      +P +G Y+A+KAA+EAL+R  +KE     + V  + P
Sbjct: 127 AKHLHDG--GRIINFSSTVVGLYQPTYGVYAATKAAVEALSRVLTKEMRGRQITVNTVAP 184

Query: 199 GPTRTSMR------------AKAMPAEDPNTVPHPQKVAKIISFLCA 233
           GPT T +             AK  P E    +  P+ +A +++FL  
Sbjct: 185 GPTATDLFLNGKSDQLVETIAKTSPLE---RLGQPEDIASVVAFLAG 228


>gi|269128150|ref|YP_003301520.1| short-chain dehydrogenase/reductase SDR [Thermomonospora curvata
           DSM 43183]
 gi|268313108|gb|ACY99482.1| short-chain dehydrogenase/reductase SDR [Thermomonospora curvata
           DSM 43183]
          Length = 292

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 91/178 (51%), Gaps = 4/178 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ R  ++TG++ GIG  TA  L   GA V    R   Q E ++    ++      FA D
Sbjct: 12  LNGRTVVLTGAAGGIGGQTARLLVERGAQVALLDR---QEEAVRALADELGPHAAPFAVD 68

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + DS ALE      A+R+G +D+++ANAGI G ++ I  I+   F  V+ VN +  W  +
Sbjct: 69  VTDSAALEAVMAQTAERFGGIDVVVANAGISGPMATIATIEPAEFERVVEVNFLGVWRTV 128

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           R+  P++ +   G  ++ SS AA    P  G Y ASKAA+E   R    E  +T   V
Sbjct: 129 RAALPYVTERR-GHILMTSSIAAAMPTPTVGVYGASKAAVEMFGRALRIELAHTGTTV 185


>gi|293394438|ref|ZP_06638736.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Serratia odorifera DSM
           4582]
 gi|291423063|gb|EFE96294.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Serratia odorifera DSM
           4582]
          Length = 248

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 111/228 (48%), Gaps = 18/228 (7%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            + A++TG   GIG   A +L+  GA VI  GR+    + L+ A++ + K +     D+ 
Sbjct: 7   GKFAVITGGGSGIGLAIAKDLSDEGADVIITGRN---AQTLQEAVKALGKNVKGIVADVS 63

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
              +++     +   +G +DIL+ANAG  G  +P+ +I EK   D  + NV      ++ 
Sbjct: 64  SKVSIDALYEQVKTEFGHIDILVANAG-GGVHAPLGEITEKQIHDQFATNVKGVVLTVQQ 122

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L K      II+ S A+    P    Y A+KAA+  + R+W  E   T +R+  + 
Sbjct: 123 AMPLLGKGSS--VIIIGSTASADPGPTMSIYGATKAAVRNMVRSWITELHGTGIRINIVS 180

Query: 198 PGPTRT-SMRA----------KAMPAEDP-NTVPHPQKVAKIISFLCA 233
           PGP  T S+RA            + A+ P   +  P+++A ++SFL +
Sbjct: 181 PGPVNTASLRAAFGDNAEEGIAFLTAKSPLGRIGEPEEIASVVSFLAS 228


>gi|195940931|ref|ZP_03086313.1| short-chain dehydrogenase/reductase SDR [Escherichia coli O157:H7
           str. EC4024]
          Length = 249

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 111/236 (47%), Gaps = 21/236 (8%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++  L  ++ALVTG S GIG  TA ELA  GA V   GR  ++L+    A   I   +  
Sbjct: 1   MNTTLAGKIALVTGGSTGIGLATAQELAAQGAKVYITGRRQAELDA---ARADIGAAVVA 57

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+     L+     IAK  G+LDIL ANAG  G + P+  I E+ F  + + NV   
Sbjct: 58  IRADVSRMADLDAVYAQIAKEEGRLDILFANAG-GGDMLPLGAITEEQFDRIFATNVRGV 116

Query: 132 WNIMRSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
              ++   P L     G +IIL+ S  + K    +  YSASKAA+   AR+W+ +     
Sbjct: 117 LFTVQKALPLL---SSGSSIILTGSTVSIKGTANFSVYSASKAAVRNFARSWALDLQGRG 173

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPN--------TVP-----HPQKVAKIISFLCA 233
           +RV  + PGP +T      +P E            VP      P +V K ++FL +
Sbjct: 174 IRVNVVSPGPVKTPGLGDLVPEEQRQGLYDALAAQVPLGRLGAPGEVGKAVAFLAS 229


>gi|225012293|ref|ZP_03702730.1| short-chain dehydrogenase/reductase SDR [Flavobacteria bacterium
           MS024-2A]
 gi|225003848|gb|EEG41821.1| short-chain dehydrogenase/reductase SDR [Flavobacteria bacterium
           MS024-2A]
          Length = 254

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 116/235 (49%), Gaps = 18/235 (7%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNA--LQKINKKIDIF 72
           N +NR+AL+TG++ GIG+  A  L + G  V+  G  I  +E  K A  L  +    +  
Sbjct: 3   NSENRVALITGATGGIGFEVAKRLGQDGITVVLNG--IEDIEGQKKAAELTSLGITAEYV 60

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            FD+ D  A+      + +++GK+D+++ NAG LG      ++  + +  V+++N+ + +
Sbjct: 61  GFDVTDEEAVNQNIKALGEKYGKIDVVVNNAGGLGGRQRFEEMTTEFYRKVMALNLDSAF 120

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKC-RPLWGAYSASKAAIEALARTWSKETVNTAL 191
            + R+  P+LKK      I  +S A +    P  G Y  SKA + A+ R  +K+     +
Sbjct: 121 FVSRAAIPFLKKGEHPTIINYTSNAGWNAGGPGAGIYGTSKAGVHAMTRALAKDLAEYNI 180

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNT------------VPHPQKVAKIISFLCAT 234
           RV  + PG   T   A+ + +  P              +  P++VA ++SFL ++
Sbjct: 181 RVNAVSPGTIDTPFHAQ-IKSTKPEVFASWKNNIMLGRLGQPEEVANVVSFLASS 234


>gi|254429727|ref|ZP_05043434.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Alcanivorax sp. DG881]
 gi|196195896|gb|EDX90855.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Alcanivorax sp. DG881]
          Length = 252

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 121/254 (47%), Gaps = 25/254 (9%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  + A++TG + GIG+ TA + +  GA V+  GRS  ++     +L  I    D+   
Sbjct: 3   DLKGKKAVITGGNSGIGFATAKKFSELGAQVMITGRSADKVSSAAESLSVIGAVADV--- 59

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
             +D + ++     + + +G +DIL  NAGI    +PI QI E+ F   + +N       
Sbjct: 60  --QDLSQIDNLVDQVKREFGTIDILFVNAGIFAP-APIGQISEEMFDQQMGINFKGAIFT 116

Query: 135 MRSFDPWLKKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           +    P L +   G +II LSS  AY   P+   Y+ASKAA+ A  RT + E     +RV
Sbjct: 117 IEKLLPVLNE---GASIINLSSINAYTGMPMTAVYAASKAALNAYTRTAATELAPRKIRV 173

Query: 194 INIDPGPTRTSM-------------RAKAMPAEDP-NTVPHPQKVAKIISFLCATQ-KIE 238
             ++PGPT T +              A+A+ A  P      P ++A ++S+L +      
Sbjct: 174 NAVNPGPTETPIFGKTGMSQEELGGFAQALQANIPLKRFAQPDEIASLVSYLASDDAAFV 233

Query: 239 TGKLFSVPQNRFVN 252
           TG  F++     +N
Sbjct: 234 TGAEFNIDGGANIN 247


>gi|326794059|ref|YP_004311879.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Marinomonas
           mediterranea MMB-1]
 gi|326544823|gb|ADZ90043.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Marinomonas
           mediterranea MMB-1]
          Length = 251

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 129/261 (49%), Gaps = 29/261 (11%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L  + AL+TG + GIG+ TA +    GA V+  GR        K AL K + ++ + A
Sbjct: 2   ISLKGKKALITGGNSGIGFATAQKFKALGAEVVITGRD-------KEALNKASSELGVQA 54

Query: 74  F--DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D    + L      I ++ GKLDIL  NAGI    +P+ ++ E +F +++++N    
Sbjct: 55  ILADQAKMDDLNQLAVQIEEQLGKLDILFINAGIT-VFAPVGKMDEATFDNMMNINFKGA 113

Query: 132 WNIMRSFDPWLKKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
           +  ++   P L   + G ++I LSS  AY   P    Y+ASKAA+ A+ RT + E     
Sbjct: 114 FFTLQKLLPLL---NDGASVINLSSINAYTGMPNTAVYAASKAAMNAVTRTAATELAPRK 170

Query: 191 LRVINIDPGPTRTSMRAK---------AMPAEDPNTVP-----HPQKVAKIISFLCATQ- 235
           +RV +++PGP  T +  K          + A   N +P       + +AK+++FL + + 
Sbjct: 171 IRVNSVNPGPVNTPIFGKLGMSQEVLSELSATMQNRIPLKRFGEAEDIAKLVAFLASDEA 230

Query: 236 KIETGKLFSVPQNRFVNYLTP 256
              TG  +++     +N + P
Sbjct: 231 SFITGSEYNIDGGTNINPILP 251


>gi|312127789|ref|YP_003992663.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777808|gb|ADQ07294.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 248

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 102/191 (53%), Gaps = 2/191 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIA-CGRSISQLEKLKNALQKINKKIDIFAF 74
           L +++AL+TG+SRGIG   AL+ A++GA VI     S SQ E LK  ++KI  K  I   
Sbjct: 4   LKDKVALITGASRGIGRAIALKFAQNGANVIINYSSSQSQAENLKEEIEKIGTKTMIIKC 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+  ++ +    + + K +G+LDIL+ NAGI      I ++ E+ F  VI++N+   +  
Sbjct: 64  DVSSADEVNQMFSQVEKEFGRLDILVNNAGITKD-GLILRMNEEDFDKVIAINLKGAFLC 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R+    + K   G  I +SS            Y+ASKA I  L ++ +KE  +  +RV 
Sbjct: 123 ARAAARMMVKQRFGNIINISSVVGIAGNVGQANYAASKAGIIGLTKSLAKELASRNIRVN 182

Query: 195 NIDPGPTRTSM 205
            I PG  +T M
Sbjct: 183 AIAPGFIKTDM 193


>gi|83953873|ref|ZP_00962594.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83841818|gb|EAP80987.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Sulfitobacter sp. NAS-14.1]
          Length = 216

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 108/219 (49%), Gaps = 6/219 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            + AL+TG+SRG+G   A  L  +  ++IA  ++   LE+L + +Q       +   D+ 
Sbjct: 2   TKTALITGASRGLGAALAEALCDTH-HIIAVAKTTGALEELDDRIQSRGGSATLAPMDIT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +++A+      I  RWG LD+ +  A     ++P   I  K  A  ++ NV A   ++  
Sbjct: 61  NADAMATLCRGIYDRWGSLDLWLHTAVHAAPLAPTDHIDAKDMAKSVACNVTATSTLITY 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L +S  G+A+             +G+Y A+KAA  ALA++W  E V    RV  + 
Sbjct: 121 VAPLLGQS--GQAVFFDD--PVVATKFFGSYGATKAAQIALAKSWQSEAVAIGPRVHIMT 176

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQ-KVAKIISFLCATQ 235
           P P  T+ RA+  P ED   +  PQ + A+I++ L  +Q
Sbjct: 177 PAPMPTATRARFHPGEDREALNTPQSQAAEILAQLAVSQ 215


>gi|293607511|ref|ZP_06689846.1| short chain dehydrogenase/reductase family oxidoreductase
           [Achromobacter piechaudii ATCC 43553]
 gi|292814082|gb|EFF73228.1| short chain dehydrogenase/reductase family oxidoreductase
           [Achromobacter piechaudii ATCC 43553]
          Length = 262

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 117/248 (47%), Gaps = 21/248 (8%)

Query: 1   MIDCESKNNSEIHVN--LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKL 58
           M D    N+ E+ +N  L+ ++ALVTG + GIG  TA ELA  GA V   GR  ++L+  
Sbjct: 1   MADNLLINSLELIMNQQLNGKIALVTGGTTGIGLATAQELAAQGARVFITGRRQAELDAA 60

Query: 59  KNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEK 118
             ++      I   A  L D   L+     IAK  GKLDIL ANAG  G + P+  I E+
Sbjct: 61  VASIGSAATGIRADASVLSD---LDRVYAQIAKSAGKLDILFANAGG-GDMLPLGAITEE 116

Query: 119 SFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEAL 178
            F  +   NV      ++   P L        I+ +S  + +    +  YSASKAA+   
Sbjct: 117 HFDRIFGTNVRGTLFTVQKALPLLVNGAS--VILTASTVSIQGTANFSVYSASKAAVRNF 174

Query: 179 ARTWSKETVNTALRVINIDPGPTRTSMRAKA------------MPAEDP-NTVPHPQKVA 225
           AR+W+ +  +  +RV  + PGP RT                  + A+ P   +  PQ++ 
Sbjct: 175 ARSWALDLKDRGIRVNVVSPGPVRTPGLGGLVGDDARQGLFDYLAAQVPLGRLGEPQEIG 234

Query: 226 KIISFLCA 233
           K ++FL +
Sbjct: 235 KAVAFLAS 242


>gi|83942632|ref|ZP_00955093.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Sulfitobacter sp. EE-36]
 gi|83846725|gb|EAP84601.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Sulfitobacter sp. EE-36]
          Length = 216

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 108/219 (49%), Gaps = 6/219 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            + AL+TG+SRG+G   A  L  +  ++IA  ++   LE+L + +Q       +   D+ 
Sbjct: 2   TKTALITGASRGLGAALAEALCDTH-HIIAVAKTTGALEELDDRIQSRGGSATLAPMDIT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +++A+      I  RWG LD+ +  A     ++P   I  K  A  ++ NV A   ++  
Sbjct: 61  NADAMATLCRGIYDRWGSLDLWLHTAVHAAPLAPTDHIDAKDMAKSVACNVTATSTLITY 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L +S  G+A+             +G+Y A+KAA  ALA++W  E V    RV  + 
Sbjct: 121 VAPLLGQS--GQAVFFDD--PVVATKFFGSYGATKAAQIALAKSWQSEAVAIGPRVHIMT 176

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQ-KVAKIISFLCATQ 235
           P P  T+ RA+  P ED   +  PQ + A+I++ L  +Q
Sbjct: 177 PAPMPTATRARFHPGEDREALNTPQSQAAEILAQLAVSQ 215


>gi|242065400|ref|XP_002453989.1| hypothetical protein SORBIDRAFT_04g022790 [Sorghum bicolor]
 gi|241933820|gb|EES06965.1| hypothetical protein SORBIDRAFT_04g022790 [Sorghum bicolor]
          Length = 246

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 90/184 (48%), Gaps = 2/184 (1%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           L+TG SRG+G   ALELAR G  V+ CGRS   L  L+  +   ++     A    DS+ 
Sbjct: 25  LITGVSRGLGRALALELARRGHAVVGCGRSAEHLRSLEAEITSPSRHFLTVADVRSDSSV 84

Query: 82  LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW 141
            EL K  + ++    DI++ NAG +   +  W +  + F  V+  N+    N++R F P 
Sbjct: 85  AELAKAVVERKQVP-DIIVNNAGTINKNNKTWNVPAEDFDMVVDTNIKGTANVLRHFVPL 143

Query: 142 LKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT 201
           + +   G  I LSSG           Y ASK AIE L R+ +KE +   L  I + PG  
Sbjct: 144 MIEKRHGIIINLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE-LPPGLAAIALSPGVV 202

Query: 202 RTSM 205
            T M
Sbjct: 203 NTDM 206


>gi|158319148|ref|YP_001511655.1| short-chain dehydrogenase/reductase SDR [Alkaliphilus oremlandii
           OhILAs]
 gi|158139347|gb|ABW17659.1| short-chain dehydrogenase/reductase SDR [Alkaliphilus oremlandii
           OhILAs]
          Length = 246

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 122/226 (53%), Gaps = 13/226 (5%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +++ LVTG+++GIG  TA++ A  GA V+A    +  ++++ + + +I  ++  +  ++ 
Sbjct: 5   DKVVLVTGAAQGIGKATAVKFAEEGAKVVAIDVKLEAMDEVSSEINEIGAELLTYEVNVV 64

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +   ++   + +  +WGK+D+L+ NAGI    S + +++E++F  VI+VN+   +N  + 
Sbjct: 65  NREQIQAMVSDVVAKWGKIDVLVNNAGITAD-SQLVKMEEEAFDKVIAVNLKGVYNCTQI 123

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGA--YSASKAAIEALARTWSKETVNTALRVIN 195
             P + ++  G  +IL++ +       +G   Y+A+K  +  + +TW+KE     +RV  
Sbjct: 124 VVPVMVEN--GGGVILNASSVVGLYGNFGQTNYAATKFGVIGMTKTWAKELGKKGIRVNT 181

Query: 196 IDPGPTRTSMRAK-------AMPAEDP-NTVPHPQKVAKIISFLCA 233
           + PG   T M AK        M  + P N +  P+ +A   +FL +
Sbjct: 182 VAPGFIGTPMVAKMPDKVIDMMKGKSPLNRLGTPEDIANAYAFLAS 227


>gi|330972350|gb|EGH72416.1| putative oxoacyl-(acyl carrier protein) reductase [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 246

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 97/193 (50%), Gaps = 4/193 (2%)

Query: 45  VIACGRSISQLEKLKNALQKINKKID-IFAFDLR--DSNALELTKTYIAKRWGKLDILIA 101
           V+  GR+ + L ++ + ++   +    +  FDL+  D          I +  G+LD L+ 
Sbjct: 40  VLLLGRTDASLAQVHDEIKAAGQLPPLVIPFDLQSADPAQYHALAAMIERTVGRLDGLLH 99

Query: 102 NAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC 161
           NA I+G  + +  +  + F  V+ VNV A + + ++  P L++S        SS    K 
Sbjct: 100 NASIIGPRTSVEHLPGEDFMQVMHVNVNATFMLTQALLPLLQRSADASIAFTSSSVGRKG 159

Query: 162 RPLWGAYSASKAAIEALARTWSKETVN-TALRVINIDPGPTRTSMRAKAMPAEDPNTVPH 220
           R  WGAY  SK A E L +T + E    + +R  +I+PG TRT MRA+A P E+P   P 
Sbjct: 160 RAQWGAYGVSKFATEGLMQTLADELEGVSTVRANSINPGATRTGMRAQAYPDENPQNNPA 219

Query: 221 PQKVAKIISFLCA 233
           P+++  +  +L  
Sbjct: 220 PEEIMPVYLYLMG 232


>gi|281420691|ref|ZP_06251690.1| NADP-dependent L-serine/L-allo-threonine dehydrogenase YdfG
           [Prevotella copri DSM 18205]
 gi|281405464|gb|EFB36144.1| NADP-dependent L-serine/L-allo-threonine dehydrogenase YdfG
           [Prevotella copri DSM 18205]
          Length = 251

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 95/188 (50%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           N++AL+TG++ GIG   A   AR G  +I  GR+  +LE LK  L+    ++   AFD+R
Sbjct: 2   NKIALITGATSGIGEGCARRFARGGYNLILTGRNTGKLEILKKELEAEGVEVLALAFDVR 61

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +  A +    YI + W  +D+LI NAG+   + P ++   + +  +I  N+     + R 
Sbjct: 62  NREAAKKAVDYIPEEWRNVDVLINNAGLARGLEPEYEGDFEDWDQMIDTNIKGLLTMTRL 121

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P + + + G  I + S A          Y A+KAA++A+      +  +T +RV N+ 
Sbjct: 122 IVPGMVERNHGHVINIGSVAGDAAYAGGNVYCATKAAVKAITDGLRIDVAHTKVRVTNVK 181

Query: 198 PGPTRTSM 205
           PG   T+ 
Sbjct: 182 PGLVETNF 189


>gi|300771350|ref|ZP_07081226.1| possible serine 3-dehydrogenase [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300762020|gb|EFK58840.1| possible serine 3-dehydrogenase [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 254

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 99/189 (52%), Gaps = 2/189 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL--QKINKKIDIFAFDL 76
           ++A +TG+S GIG   A  LA+ G +++ C R I +LE+LK  +  Q  +  I IF  D+
Sbjct: 3   KIAFITGASSGIGAACAEVLAKEGYHLLLCARRIERLEELKQHISAQYPDCNIYIFKLDV 62

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
           R++  ++L+   + ++W  +D+LI NAG+   + PI       +  +I  N+     + R
Sbjct: 63  RNAEEVQLSVNNLPEKWKNIDVLINNAGLSQGLDPIQNGDIGDWDRMIDTNIKGLLYVTR 122

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
           +  P+++    G  + L S A  +  P    Y A+K A++AL +    + ++  ++V  I
Sbjct: 123 TVVPFMEARKKGHIVNLGSIAGKEVYPNGNVYCATKHAVDALNKAMRIDLLSKGIKVTGI 182

Query: 197 DPGPTRTSM 205
           +PG   T  
Sbjct: 183 NPGMVETEF 191


>gi|159899846|ref|YP_001546093.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159892885|gb|ABX05965.1| short-chain dehydrogenase/reductase SDR [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 260

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 120/240 (50%), Gaps = 22/240 (9%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           +NL N +AL+TG+  GIG  TAL LA  GA V A GR+  +L +    +Q+         
Sbjct: 1   MNLRNTVALITGAGSGIGKATALYLAAHGANVAALGRTEDELTETVETIQRAGGDALALI 60

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+   + L+     + + WGKL+ + ANAGI G  +PI Q+  + + + +++N+   + 
Sbjct: 61  ADITQPDELQAAVDQMLETWGKLNCVFANAGINGVWAPIEQLSLEEWQNTLNINLTGTFL 120

Query: 134 IMRSFDPWLKKSHCGRAIILSS---GAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            +++  P LKK   G AII++S   G          AYS +KA   A+A+  + E     
Sbjct: 121 TLQTTVPALKKQ--GGAIIITSSINGTRTFSNVGATAYSTTKAGQVAMAKMLALELAQFK 178

Query: 191 LRVINIDPGPTRTS---------MRAKAMPAEDP-NTVP--HPQ-----KVAKIISFLCA 233
           +RV  I PG   TS         +   A+PAE P   +P  H Q     +VA+++ FL +
Sbjct: 179 IRVNVICPGAIETSIDESTEKRAIETVAVPAEFPEGDIPLTHGQPGTAEQVAQLVGFLAS 238


>gi|254784454|ref|YP_003071882.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Teredinibacter turnerae T7901]
 gi|237687485|gb|ACR14749.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Teredinibacter turnerae T7901]
          Length = 233

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 98/191 (51%), Gaps = 2/191 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL  + ALVTGSSRGIG   AL LA+ G  ++  GR+   L      L   +  +   A 
Sbjct: 4   NLKGKWALVTGSSRGIGQQIALGLAQLGCNLVVHGRTQENLTATLGMLTDFDVTVHPVAG 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           +L     L      + K   ++DIL  NA I    +P+++    ++  V  VNV A   +
Sbjct: 64  ELDGEAPLNAVIEQVNKVAPQVDILYNNAAISCPSTPVFEFDMATWMSVFQVNVFAMVKL 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           + +F P +K  + GR + +SSG A   +P    YS SKAA++ L +  + E  +TA+RV 
Sbjct: 124 VNAFGPGMKARNWGRIVNVSSGIA--DQPNLAPYSVSKAAVDKLTQDLAFEFKDTAVRVN 181

Query: 195 NIDPGPTRTSM 205
            +DPG  RT +
Sbjct: 182 AVDPGWIRTDL 192


>gi|324106162|gb|ADY18327.1| hypothetical protein [Rhodococcus rhodochrous]
          Length = 269

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 103/198 (52%), Gaps = 13/198 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIAC----GRSISQLEKLKNALQKINKKIDI 71
           +  ++AL+TG++ G+G   A  LA  GA ++A     GR+ ++L++    ++   ++I  
Sbjct: 4   MTGKVALITGAAGGLGRACATRLAEEGADIVALDLPGGRTEAELDETARLVRATGRRIVT 63

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+RD +A+           G LD+++ANAGI  +  P W+I ++ +   I VN+   
Sbjct: 64  GTADVRDLDAVVAAVRAGVSELGPLDVVVANAGISDNPGPSWEIDDEIWNRSIDVNLTGT 123

Query: 132 WNIMRS----FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           W+ +++     DP       G  II+SS AA K  P    YSA+K A+  LA+T + E  
Sbjct: 124 WHTVKAGVAELDP-----AGGSVIIVSSTAAIKAVPGASHYSAAKHAVTGLAKTLANELG 178

Query: 188 NTALRVINIDPGPTRTSM 205
             A+RV  + PG   T M
Sbjct: 179 ARAIRVNTVHPGAAATPM 196


>gi|75908750|ref|YP_323046.1| short chain dehydrogenase [Anabaena variabilis ATCC 29413]
 gi|75702475|gb|ABA22151.1| Short-chain dehydrogenase/reductase SDR [Anabaena variabilis ATCC
           29413]
          Length = 241

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 100/190 (52%), Gaps = 7/190 (3%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R AL+TG+S GIG  TAL  A++G  V    RS  +L  +  A ++       +  DL D
Sbjct: 7   RRALITGASSGIGKATALAFAKAGIDVALVSRSGDKLTPVVEATKQTGVVAKAYTVDLAD 66

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFAD---VISVNVMANWNIM 135
            + +E     IA  +G +DIL+ NAG+  + +    + E   AD   VI++N+ + +  +
Sbjct: 67  VSQVEAKIQAIAIDFGDIDILVNNAGVAYTAT----LSETPLADWQQVINLNLTSVFECI 122

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P ++  H G  I +SS AA +  P WG YS SKA + AL++T ++E     +RV  
Sbjct: 123 KGILPRMRARHTGTIINVSSIAAKQSFPHWGVYSVSKAGLMALSQTLAQEERVHGIRVSA 182

Query: 196 IDPGPTRTSM 205
           I PG   T +
Sbjct: 183 ICPGAVNTGL 192


>gi|187930481|ref|YP_001900968.1| short-chain dehydrogenase/reductase SDR [Ralstonia pickettii 12J]
 gi|187727371|gb|ACD28536.1| short-chain dehydrogenase/reductase SDR [Ralstonia pickettii 12J]
          Length = 262

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 111/197 (56%), Gaps = 13/197 (6%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-----N 66
           ++++L N+LALVTGS++GIG+  A+ LA  GA VI  GR+ + ++   +A+ ++     +
Sbjct: 1   MNLHLQNKLALVTGSTKGIGHAIAVALAAEGARVIVNGRTQASVD---DAIARLRTEVPD 57

Query: 67  KKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISV 126
            +++ FA DL D   ++     +  R+ K+DILI N GI     P  +I +  +    +V
Sbjct: 58  AQVEGFAGDLSDPGQVD----ALLGRFPKVDILINNLGIFDP-KPFEEIDDAEWQHFFNV 112

Query: 127 NVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKET 186
           NV++   + R++ P ++  + GR + +SS +  +       Y  +K A+  L+R  ++ T
Sbjct: 113 NVLSGARLSRAYLPGMRAQNWGRIVFISSESGVQIPVEMIHYGVTKTALLGLSRGLAELT 172

Query: 187 VNTALRVINIDPGPTRT 203
             TA+ V  + PGPTR+
Sbjct: 173 AGTAITVNAVLPGPTRS 189


>gi|294498036|ref|YP_003561736.1| short chain dehydrogenase/reductase family oxidoreductase [Bacillus
           megaterium QM B1551]
 gi|294347973|gb|ADE68302.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Bacillus megaterium QM B1551]
          Length = 239

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 108/215 (50%), Gaps = 2/215 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  ++AL+TG+ +GIG  TA+ELA+ G  +    R+ S L+ + + L+  + ++     
Sbjct: 4   SLKGKVALITGAGKGIGRSTAIELAKEGVNIGLIARTESDLKAVASELEAFDVQVAYATA 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+     +     ++  + G  DILI NAGI G      ++    +  +I VN+M  + +
Sbjct: 64  DVSSMEEVNAAVEHLHTKLGATDILINNAGI-GKFGSFLELDPAEWKQIIDVNLMGVYYV 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R+  P L + + G  I +SS A  K  P+  AYSASK  +  L  + + E     +RV 
Sbjct: 123 TRAVLPQLIEKNGGDIINISSTAGQKGAPVTSAYSASKFGVLGLTESLALEVRKHNIRVT 182

Query: 195 NIDPGPTRTSMRAKA-MPAEDPNTVPHPQKVAKII 228
            + P    T +  K  +   +P+ V  P+ +A+I+
Sbjct: 183 ALTPSTVATELAYKENLTDGNPDKVMQPEDLAEIM 217


>gi|85813896|emb|CAG44632.1| SriL03.9 [Streptomyces rimosus subsp. paromomycinus]
          Length = 285

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 99/203 (48%), Gaps = 9/203 (4%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF--DLRDS 79
            VTG+SRG+G     +L   G  V A  RS    E+L  AL        + A   DL D 
Sbjct: 11  FVTGASRGLGLELVRQLLAQGDNVAATTRSP---ERLTTALGGAADTGRLLALNVDLTDE 67

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
             ++       +R+G+LD+++ NAG  G ++ + +   K   D++ V V+  WN++R+  
Sbjct: 68  AQVQHAVDRTTERFGRLDVVVNNAGY-GYLAAVEETSAKDVRDMLDVQVVGVWNVLRAAL 126

Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199
           P L++   GR I +SS       P W  Y A K A+E L+   + E  +  ++V  ++PG
Sbjct: 127 PVLREQRAGRVINISSILGLTTMPGWALYCAGKFALEGLSEALAAEVADFGIKVTVVEPG 186

Query: 200 PTRTSM---RAKAMPAEDPNTVP 219
             RTS     + A+PAE     P
Sbjct: 187 YFRTSFLTTESLALPAETSEHYP 209


>gi|209515572|ref|ZP_03264437.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. H160]
 gi|209504039|gb|EEA04030.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. H160]
          Length = 260

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 107/213 (50%), Gaps = 9/213 (4%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L+ ++ALVTG+SRG+G+  A  LA +GA VI C RS + LE    +++K    +DI  F
Sbjct: 5   SLEGQIALVTGASRGLGFAMASALASAGATVILCARSRASLETAAESIRKTGGDVDIEPF 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D NA+      +  R G++D+L+ NAGI    S   Q   + +   +  NV A + +
Sbjct: 65  DLTDQNAIRNGVRNVLARHGRIDVLLNNAGIC-EWSDFLQSNVEMWQRTMDTNVTAAYLL 123

Query: 135 MRSF-DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
            +    P +++ H GR I + S  +   R    AY ASK AI  L ++   E     +R 
Sbjct: 124 AQEVARPMIERGH-GRIINVGSYVSVLGREKLQAYVASKHAIAGLTKSLGAELGRHGIRC 182

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAK 226
             I PG   T M      AE   + P  +++ +
Sbjct: 183 NGICPGYFLTDM------AEPVTSNPQMKEIVR 209


>gi|291565729|dbj|BAI88001.1| short-chain dehydrogenase/reductase SDR [Arthrospira platensis
           NIES-39]
          Length = 228

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 104/230 (45%), Gaps = 6/230 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +++ L+TG SRG+G          G  VI C RS   ++ L    Q+  K  D    ++ 
Sbjct: 3   SKIILITGVSRGLGRVLTESFINLGHTVIGCARSPEPIDLLN---QQYGKPHDFQVVNVE 59

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D  ++E    ++ K +   DI+I NA I+  ++P+W++    F  VI VN+    N++R 
Sbjct: 60  DHQSVENWVNHLLKNYPAPDIVINNAAIINPLAPLWEVPPHEFNQVIDVNIKGVANVIRY 119

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P + K   G  I LSSG      P    Y  SK AIE L +  ++E +   L  I + 
Sbjct: 120 LVPAMIKRGSGIIINLSSGWGRSTSPQVATYCTSKWAIEGLTQALAQE-LPPGLAAIPMS 178

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQK-VAKIISFLCATQKIETGKLFSVP 246
           PG   T M       ED      PQ+ V K + F+      + G   +VP
Sbjct: 179 PGIIHTDMLEICY-GEDAAAFTSPQEWVKKAVPFILGLSPKKNGVPVTVP 227


>gi|326532722|dbj|BAJ89206.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 247

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 91/187 (48%), Gaps = 2/187 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           R  L+TG SRG+G   ALELAR G  V+ CGRS   +  L+  +   ++     A    D
Sbjct: 23  RTVLITGISRGLGRALALELARRGHAVVGCGRSADPIRSLEAEMGSPSRHFLTVADVRSD 82

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           S+  EL K  + ++    DI++ NAG +   +  W +  + F  V+  N+    N++R F
Sbjct: 83  SSMGELAKAVVERKQIP-DIIVNNAGTINKNNKTWNVPAEEFDTVVDTNIKGTANVLRHF 141

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P + +   G  I LSSG           Y ASK AIE L R+ +KE +   L  I + P
Sbjct: 142 VPLMIQKKHGMIINLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE-LPPGLAAIALSP 200

Query: 199 GPTRTSM 205
           G   T M
Sbjct: 201 GVVNTDM 207


>gi|108797964|ref|YP_638161.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Mycobacterium sp. MCS]
 gi|119867061|ref|YP_937013.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Mycobacterium sp. KMS]
 gi|126433627|ref|YP_001069318.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Mycobacterium sp. JLS]
 gi|108768383|gb|ABG07105.1| short-chain dehydrogenase/reductase SDR [Mycobacterium sp. MCS]
 gi|119693150|gb|ABL90223.1| short-chain dehydrogenase/reductase SDR [Mycobacterium sp. KMS]
 gi|126233427|gb|ABN96827.1| short-chain dehydrogenase/reductase SDR [Mycobacterium sp. JLS]
          Length = 284

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 105/210 (50%), Gaps = 15/210 (7%)

Query: 10  SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIAC-------------GRSISQLE 56
           S +   L  R+AL+TG++RG G   A+ LA  GA +IA                +   L 
Sbjct: 2   SAVEGPLAGRVALITGAARGQGRAHAVRLAADGADIIAIDICAPVHDTITYPAATAEDLA 61

Query: 57  KLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIK 116
           +   A++   +K+     D+RD  ALE       +++G+LDIL+ANAG+L S   +W++ 
Sbjct: 62  ETVRAVEATGRKVLAREVDIRDLAALEQVVADGVEQFGRLDILVANAGVL-SWGRLWEMS 120

Query: 117 EKSFADVISVNVMANWNIMRSFDP-WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI 175
           E  ++ VI VN+   W  +R+  P  ++  + G  I++SS A  K  P  G Y+ASK  +
Sbjct: 121 EDQWSAVIDVNLNGTWKTIRAVVPAMIEAGNGGSIIVVSSSAGLKATPGNGHYAASKHGL 180

Query: 176 EALARTWSKETVNTALRVINIDPGPTRTSM 205
            AL    + E     +RV +I P    T M
Sbjct: 181 TALTNGLALEAGEYGIRVNSIHPYSIDTPM 210


>gi|66046881|ref|YP_236722.1| short chain dehydrogenase [Pseudomonas syringae pv. syringae B728a]
 gi|63257588|gb|AAY38684.1| Short-chain dehydrogenase/reductase SDR [Pseudomonas syringae pv.
           syringae B728a]
          Length = 246

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 97/193 (50%), Gaps = 4/193 (2%)

Query: 45  VIACGRSISQLEKLKNALQKINKKID-IFAFDLR--DSNALELTKTYIAKRWGKLDILIA 101
           V+  GR+ + L ++ + ++   +    +  FDL+  D          I +  G+LD L+ 
Sbjct: 40  VLLLGRTDASLAQVHDEIKAAGQLPPLVIPFDLQSADPAQYHALAAMIERTVGRLDGLLH 99

Query: 102 NAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC 161
           NA I+G  + +  +  + F  V+ VNV A + + ++  P L++S        SS    K 
Sbjct: 100 NASIIGPRTSVEHLPGEDFMQVMHVNVNATFMLTQALLPLLQRSADASIAFTSSSVGRKG 159

Query: 162 RPLWGAYSASKAAIEALARTWSKETVN-TALRVINIDPGPTRTSMRAKAMPAEDPNTVPH 220
           R  WGAY  SK A E L +T + E    + +R  +I+PG TRT MRA+A P E+P   P 
Sbjct: 160 RAQWGAYGVSKFATEGLMQTLADELEGVSTVRANSINPGATRTGMRAQAYPDENPQNNPA 219

Query: 221 PQKVAKIISFLCA 233
           P+++  +  +L  
Sbjct: 220 PEEIMPVYLYLMG 232


>gi|326797096|ref|YP_004314916.1| carbonyl reductase (NADPH) [Marinomonas mediterranea MMB-1]
 gi|326547860|gb|ADZ93080.1| Carbonyl reductase (NADPH) [Marinomonas mediterranea MMB-1]
          Length = 253

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 100/201 (49%), Gaps = 3/201 (1%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           N+  L+TG+  G+G  TAL LA  GA +   GR    L++L   ++ +       + D+ 
Sbjct: 8   NKNILITGAGTGMGRATALRLALEGAQLALVGRREEPLQQLVTEIEALGGNAVALSCDIS 67

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
              AL      I  R G LD + ANAG+LG    +     + FA +IS+N++  +  ++S
Sbjct: 68  QYKALTHCAEQIKNRMGHLDGVFANAGVLGEFQSLSDTHLEQFAQLISINLLGTFLTIKS 127

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L+    G  +I SS  A    P  GAY+++K+A+ A+ +T + E    A+RV  I 
Sbjct: 128 CLPLLES---GSIVINSSWTASAVMPGAGAYASTKSALLAMMKTLAVEQGANAIRVNAIS 184

Query: 198 PGPTRTSMRAKAMPAEDPNTV 218
           PG   T M    +  E  NT+
Sbjct: 185 PGIILTPMADDVLSPELENTL 205


>gi|307323699|ref|ZP_07602909.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
 gi|306891188|gb|EFN22164.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
          Length = 815

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 63/217 (29%), Positives = 104/217 (47%)

Query: 5   ESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK 64
           ESK  + I   L+ R  +VTG++ GIG  TAL+ AR GA V+      +  E+    ++ 
Sbjct: 555 ESKEQNMISTGLEGRAVVVTGAASGIGRTTALKFAREGAKVLVADLDQAGAEETVKEIKA 614

Query: 65  INKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVI 124
                     DL D   ++       + +G+LD+L+ NAGI+  +S + +  +  +  VI
Sbjct: 615 AGGHALAVVGDLSDQQVVDDVVARAVEAFGRLDVLVNNAGIMDRMSALGETDDAEWERVI 674

Query: 125 SVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSK 184
            +N+ A + + R+  P +  +  G  +  +S AA +      AY+ASK A+  L ++ + 
Sbjct: 675 RINLTAPFLLTRAVLPHMLAAGSGSIVFTASEAALRGSAAGAAYTASKHAVVGLVKSLAV 734

Query: 185 ETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHP 221
                 +R   I PGPT TS+R  A       TV  P
Sbjct: 735 MYRGQGIRANAIAPGPTATSIRVDAGAEAHGPTVIGP 771


>gi|163756619|ref|ZP_02163731.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Kordia algicida OT-1]
 gi|161323513|gb|EDP94850.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Kordia algicida OT-1]
          Length = 251

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/255 (30%), Positives = 119/255 (46%), Gaps = 25/255 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++A+VTG + GIGY +A +L  +GA VI  GRS  ++EK  N L       D+ + D
Sbjct: 4   LQGKIAVVTGGNSGIGYASAAKLKANGATVIITGRSQERVEKAANELGVTGIVADVTSLD 63

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
                A++     +    GK+D+L  NAGI  + +PI QI E+ +     +N        
Sbjct: 64  -----AIDNLVNQVKDAHGKVDVLFVNAGIF-TPAPIGQITEEVYDTQFGINFKGAVFTT 117

Query: 136 RSFDPWLKKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
             F P L     G +II LSS  AY   P    Y+A+KAA+ +  RT + E     +RV 
Sbjct: 118 EKFLPILND---GASIINLSSINAYTGMPNTAIYAATKAALNSYTRTAATELAPRKIRVN 174

Query: 195 NIDPGPTRTSMRAK-------------AMPAEDP-NTVPHPQKVAKIISFLCATQ-KIET 239
            ++PGP  T +  K             AM    P   +  P+ +A +++FL +      T
Sbjct: 175 AVNPGPVETPIFGKTGMEQEQLEGFAAAMLERIPLKRIGQPEDIANLVAFLASDDASFIT 234

Query: 240 GKLFSVPQNRFVNYL 254
           G  +++     VN L
Sbjct: 235 GSEYNIDGGMNVNPL 249


>gi|85703142|ref|ZP_01034246.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Roseovarius sp. 217]
 gi|85672070|gb|EAQ26927.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Roseovarius sp. 217]
          Length = 217

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 108/213 (50%), Gaps = 6/213 (2%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDS 79
           +ALVTG+SRG+G   A  LA++  +V+A  R+   LE L + +Q    +  +   D+ + 
Sbjct: 9   IALVTGASRGLGAAMAEALAKTH-HVVAVARTTGALEDLDDRIQAAGGQATLAPMDVTNV 67

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
            A+      I  RWG +   +  A     ++P+  + E  ++  ++ NV A   ++    
Sbjct: 68  GAMAQLCRSIHDRWGAIATWVHAAVHAAPLTPVAHLSEGDWSKSVACNVTATGILIPFIA 127

Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199
           P L  S  G+AI      A +    + AY A+KAA  ALAR+W  ET  T  RV  + P 
Sbjct: 128 PLLGTS--GQAIFFDDPRAGE--KFYAAYGATKAAQIALARSWQAETAQTGPRVHILTPH 183

Query: 200 PTRTSMRAKAMPAEDPNTVPHPQ-KVAKIISFL 231
           P  T+ RA+  P ED  T+  P+ + A++++ L
Sbjct: 184 PMPTATRARFHPGEDRETLAFPRDEAARLLAEL 216


>gi|209515362|ref|ZP_03264228.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. H160]
 gi|209504082|gb|EEA04072.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. H160]
          Length = 247

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 119/238 (50%), Gaps = 23/238 (9%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYV----IACGRSISQLEKLKNALQKINKKI 69
           +N + +LALV G SRGIG      L R G  V     +   +  +LE   +A      +I
Sbjct: 1   MNENRQLALVFGGSRGIGAACVEALVRDGMDVAFTYTSQAEAARELEAKGDAH---GARI 57

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGK-LDILIANAGILGSISPIWQIKEKSFADVISVNV 128
             +  D+RD+ A++       + +G+ L  +IANAGI    +P+ Q  +  F  ++ VN+
Sbjct: 58  RGYQVDIRDAAAVDAVCHEATRDFGRPLQAVIANAGINVPPAPLAQFSDADFQRLVEVNI 117

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
           +  +N++R+     + S  G  + L++       P  G YSA+KAA+E L R+ SKE  +
Sbjct: 118 VGAFNVLRA--AAREVSEGGAIVALTTSLVRHAVPGVGPYSATKAAVECLVRSMSKELAS 175

Query: 189 TALRVINIDPGPTRTSM-----------RAKAMPAEDPNTVPHPQKVAKIISFLCATQ 235
             +RV  + PGP  T +           R+ AM     N V  P +VA++++FL +++
Sbjct: 176 RTVRVNAVAPGPVDTDLFRAGKTDEAKQRSAAM--SPMNRVGQPAEVAEVVAFLVSSK 231


>gi|307727135|ref|YP_003910348.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. CCGE1003]
 gi|307587660|gb|ADN61057.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. CCGE1003]
          Length = 254

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 98/189 (51%), Gaps = 5/189 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+N++ALVTG++ GIG  +A   A  GA+V   GR  ++L+    A+++   K      D
Sbjct: 5   LENKIALVTGATSGIGLASAQRFAAEGAHVYLTGRRQAELDSAVKAIREAGGKATGVRVD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
               + L+     I +  G+LD+L ANAG  GS+ P+  I E+ F D    NV      +
Sbjct: 65  STKLSELDALYAQIKEEHGRLDVLFANAGG-GSMLPLGSITEEHFDDTFDRNVKGVLFTV 123

Query: 136 RSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P L +   G ++IL+ S A       +  YSASKAA+ A AR+W  +     +RV 
Sbjct: 124 QKALPLLAE---GASVILTGSTAGSAGTAAFSVYSASKAAVRAFARSWILDLKERRIRVN 180

Query: 195 NIDPGPTRT 203
            I PG TRT
Sbjct: 181 TISPGATRT 189


>gi|284050042|ref|ZP_06380252.1| short-chain dehydrogenase/reductase SDR [Arthrospira platensis str.
           Paraca]
          Length = 227

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 104/230 (45%), Gaps = 6/230 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +++ L+TG SRG+G          G  VI C RS   ++ L    Q+  K  D    ++ 
Sbjct: 2   SKIILITGVSRGLGRVLTESFINLGHTVIGCARSPEPIDLLN---QQYGKPHDFQVVNVE 58

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D  ++E    ++ K +   DI+I NA I+  ++P+W++    F  VI VN+    N++R 
Sbjct: 59  DHQSVENWVNHLLKNYPAPDIVINNAAIINPLAPLWEVPPHEFNQVIDVNIKGVANVIRY 118

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P + K   G  I LSSG      P    Y  SK AIE L +  ++E +   L  I + 
Sbjct: 119 LVPAMIKRGSGIIINLSSGWGRSTSPQVATYCTSKWAIEGLTQALAQE-LPPGLAAIPMS 177

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQK-VAKIISFLCATQKIETGKLFSVP 246
           PG   T M       ED      PQ+ V K + F+      + G   +VP
Sbjct: 178 PGIIHTDMLEICY-GEDAAAFTSPQEWVKKAVPFILGLSPKKNGVPVTVP 226


>gi|83952414|ref|ZP_00961145.1| 20-beta-hydroxysteroid dehydrogenase, putative [Roseovarius
           nubinhibens ISM]
 gi|83836087|gb|EAP75385.1| 20-beta-hydroxysteroid dehydrogenase, putative [Roseovarius
           nubinhibens ISM]
          Length = 249

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 92/193 (47%), Gaps = 3/193 (1%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           + ++ +  L+TG+SRGIG   A   A  GA V    RS  QL +L    Q+I        
Sbjct: 1   MTVEGKTVLITGASRGIGAAAARIFAAQGANVALLARSTDQLAELS---QEIGDAALALP 57

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ D    E     +   +G LD+LI NAG++  I+P+ +     +   I +N+   ++
Sbjct: 58  CDVADYADYEAAIQKVVAHFGGLDVLIGNAGVIDPIAPLAESDPAGWGRAIDINLKGIYH 117

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
            MR+  P +  S  G  I +SSGAA++    W  Y ASKA    L      ET    LR+
Sbjct: 118 GMRAAMPVMLNSGGGTIITISSGAAHRALEGWSHYCASKAGAAMLTEAAHLETAGQGLRI 177

Query: 194 INIDPGPTRTSMR 206
           + + PG   T M+
Sbjct: 178 LALSPGTVATDMQ 190


>gi|283781340|ref|YP_003372095.1| short-chain dehydrogenase/reductase SDR [Pirellula staleyi DSM
           6068]
 gi|283439793|gb|ADB18235.1| short-chain dehydrogenase/reductase SDR [Pirellula staleyi DSM
           6068]
          Length = 264

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 116/230 (50%), Gaps = 12/230 (5%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRS-ISQLEKLKNALQKINKKIDIF 72
           VNL  R+A+VTG+S GIG   ALELAR GA V+   RS + Q E++   ++K+  +  +F
Sbjct: 4   VNLKGRVAVVTGASLGIGRAAALELARCGASVVVNYRSHLHQAEEVIAEVEKLGSRGIVF 63

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+ D  A+E         +G+LDI ++NA         ++     F   ++V +   +
Sbjct: 64  QADVADQGAVEAMVQAAVDNFGRLDIAVSNAA-YSDRERFFEADMAGFHRTVNVTMWGAF 122

Query: 133 NIMRSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
            +MR+    + +   G AI L SS  A+   P   AY+ SKAAIE  ART + E     +
Sbjct: 123 YLMRAATQQMIRQGEGGAICLVSSPHAFIPAPKAMAYNMSKAAIEHAARTAAIEVAEYKI 182

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNT----VP-----HPQKVAKIISFLC 232
           R+  I PG T T    K    E   +    +P     +P+++ + I+FLC
Sbjct: 183 RINLIQPGWTDTPGERKFASEETLQSAGAKIPLGRLGNPEEMGRAIAFLC 232


>gi|262373284|ref|ZP_06066563.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter junii
           SH205]
 gi|262313309|gb|EEY94394.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter junii
           SH205]
          Length = 244

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 115/223 (51%), Gaps = 12/223 (5%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           ++ALVTG+SRGIG   A +L + G +V+    S S  +KL  +  +          D+R+
Sbjct: 6   KVALVTGASRGIGAAIAQQLIQDGFFVVGTATSESGAQKLTESFAENGAGA---VLDVRN 62

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
             A++   T I +++G + +L+ NAGI    + + ++ E  + D++++++ A + + +  
Sbjct: 63  GEAIDALVTDIEQKYGSVLVLVNNAGITKD-NLLLRMSEDDWDDILNIHLKAVYRLSKRV 121

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
              + K+  GR I +SS  A+   P    YSA+KA IEA +R+ +KE  +  + V ++ P
Sbjct: 122 LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP 181

Query: 199 GPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           G   T M        R K       N +  PQ +A  +SFL +
Sbjct: 182 GFIATEMTDQLSEDVRKKMSDQVALNRLGEPQDIAHAVSFLAS 224


>gi|227486385|ref|ZP_03916701.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Anaerococcus
           lactolyticus ATCC 51172]
 gi|227235566|gb|EEI85581.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Anaerococcus
           lactolyticus ATCC 51172]
          Length = 249

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 112/232 (48%), Gaps = 19/232 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++A+VTGSSRGIG+  A +   +GA V   G   S+ E    A+ K+ +K D   F 
Sbjct: 4   LEGKVAVVTGSSRGIGFAVAEKFLDNGAKVAILG---SREESANKAIDKLKEKYDSSLFK 60

Query: 76  -----LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
                L D  +++     + K +GK+DIL+  AGI  +I P        FA V+ +NV  
Sbjct: 61  GYWPRLTDEVSVKEFVGEVIKDFGKVDILVNCAGISDNI-PSVDADLAHFAKVMDINVNG 119

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            +N++ +F P   +   G  I  SS  +   +P   AY  SK AI  L  + ++E   + 
Sbjct: 120 TYNMIHNFLPHFLERKSGSIINFSSMVSKNGQPTGVAYPTSKFAINGLTVSLARELGPSG 179

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPH---------PQKVAKIISFLCA 233
           +RV  + PG T T M  K +P E    V           P+ VAK + FL +
Sbjct: 180 IRVNAVGPGVTNTDM-VKVLPKEQIEPVKQMIPLKRIGEPEDVAKAVLFLAS 230


>gi|225573662|ref|ZP_03782417.1| hypothetical protein RUMHYD_01858 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038955|gb|EEG49201.1| hypothetical protein RUMHYD_01858 [Blautia hydrogenotrophica DSM
           10507]
          Length = 246

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 123/242 (50%), Gaps = 13/242 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIA-CGRSISQLEKLKNALQKINKKIDIFAF 74
           L+N++ALVTG+S GIG   A  LA+ GA+VI     S +  E+ K  ++    K  ++  
Sbjct: 2   LENKVALVTGASSGIGREIARTLAKEGAFVIINYNGSQAGAEEAKGIIESEGGKAAVYQC 61

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           ++ D +A E     + K +G +DIL+ NAGI    + I ++KE+ F  V+++N+   +N 
Sbjct: 62  NVSDFDACEAMMKDLVKEYGHIDILVNNAGITRD-NLIMKMKEEDFDAVLNINLKGTFNT 120

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R     + K   G+ I +SS +          Y+ASKA +  L +T ++E  +  + V 
Sbjct: 121 IRHLSRQMLKQRSGKIINISSVSGILGNAGQANYAASKAGVIGLTKTMARELASRGITVN 180

Query: 195 NIDPGPTRTSMRA-------KAMPAEDP-NTVPHPQKVAKIISFLCATQKIE--TGKLFS 244
            + PG   T M         KA   + P         +A +++FL A++K +  TG++ S
Sbjct: 181 AVAPGFVDTKMTQVLSEDVKKAACGQIPLGRFGKTSDIANVVAFL-ASEKADYITGQVIS 239

Query: 245 VP 246
           V 
Sbjct: 240 VD 241


>gi|298247140|ref|ZP_06970945.1| short-chain dehydrogenase/reductase SDR [Ktedonobacter racemifer
           DSM 44963]
 gi|297549799|gb|EFH83665.1| short-chain dehydrogenase/reductase SDR [Ktedonobacter racemifer
           DSM 44963]
          Length = 279

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 118/243 (48%), Gaps = 13/243 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++A+VTG SRGIG   AL LA  GA V    RS  QL +    ++++  +      D
Sbjct: 11  LIGQVAVVTGGSRGIGRAIALALAAEGASVAVVARSEEQLAETTMLIREMGGEAIAIVGD 70

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D  A+      + ++ G +DIL+ NAG   ++ P+W +    +   +  N+ + +  M
Sbjct: 71  VSDRQAVVQMAKQVVQQLGPVDILVNNAGRHYALGPLWLVDPDEWLKDVEGNLFSTFLCM 130

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
            +  P + +   GR I +SSGA    RP   AY++SKAA+  L  + +       + +  
Sbjct: 131 HAIMPGMIERRQGRIINISSGAGNLPRPHSTAYTSSKAAVTRLTESAAISARPYDISIFA 190

Query: 196 IDPGPTRTSMRAKAMPAEDPNT-VPH-----------PQKVAKIISFLCATQ-KIETGKL 242
           I PG  RT+M    + +E+ N  VP             ++V +++ FL + +  + TG+ 
Sbjct: 191 IHPGSVRTAMADYLVNSEEANKWVPEFRTIYDETEIPAERVGELVVFLASGKADLLTGRF 250

Query: 243 FSV 245
            +V
Sbjct: 251 LNV 253


>gi|188501520|gb|ACD54650.1| short-chain dehydrogenase/reductase-like protein [Adineta vaga]
          Length = 250

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 122/238 (51%), Gaps = 31/238 (13%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQL--EKLKNALQKINKKIDIFA 73
           LD ++A +TG + GIG  TA      GAYV      I+ L  EKL  A+Q+I K+ +I A
Sbjct: 4   LDGKVAYITGGAEGIGLATAQRFVIEGAYVF-----ITDLHQEKLDLAVQQIGKQ-NITA 57

Query: 74  FDLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
                S   +  + Y  I +  GKLDI+ ANAGI G++S +  I E+ F  + +VNV   
Sbjct: 58  IRADVSKLDDHHRVYNVIQREKGKLDIVFANAGIAGTMS-LGSITEEYFDHMFNVNVKG- 115

Query: 132 WNIMRSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
             ++ +    L   + G AIIL +S A  K  P    YSA+KA + + AR+WS +  +  
Sbjct: 116 --VLFTVQEVLSILNDGSAIILDASIATIKGPPASSIYSATKAVLRSFARSWSVDLKHRH 173

Query: 191 LRVINIDPGPTRTSM---------RAKAMPAEDPNT------VPHPQKVAKIISFLCA 233
           +RV  I PGP  T+M         ++KA  AE   T      V  P +VA+ + FL +
Sbjct: 174 IRVNTISPGPIDTAMLWNMYDTEEKSKAF-AERITTSTVLGRVGQPDEVARAVVFLAS 230


>gi|254776922|ref|ZP_05218438.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Mycobacterium avium
           subsp. avium ATCC 25291]
          Length = 275

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 103/205 (50%), Gaps = 15/205 (7%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACG-------------RSISQLEKLKNA 61
           +L  R+A +TG++RG G   A+ LA  GA +IAC               +   L++    
Sbjct: 7   SLQGRVAFITGAARGQGRSHAVRLAAEGADIIACDICAPVSASVTYAPATPEDLDETARL 66

Query: 62  LQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFA 121
           ++   +K      D+RD  AL        +++G+LD+++ANAG+L S   +W++ ++ + 
Sbjct: 67  VEDQGRKALTRVLDVRDDAALRELVADGMEQFGRLDVVVANAGVL-SWGRVWELTDEQWD 125

Query: 122 DVISVNVMANWNIMRSFDP-WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
            VI VN+   W  +R+  P  ++  + G  +++SS A  K  P  G YSASK  + AL  
Sbjct: 126 TVIGVNLTGTWRTLRATVPAMIEAGNGGSIVVVSSSAGLKATPGNGHYSASKHGLTALTN 185

Query: 181 TWSKETVNTALRVINIDPGPTRTSM 205
           T + E     +RV +I P    T M
Sbjct: 186 TLAIELGEYGIRVNSIHPYSVETPM 210


>gi|124515493|gb|EAY57003.1| putative short-chain dehydrogenase/reductase SDR [Leptospirillum
           rubarum]
          Length = 286

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 108/197 (54%), Gaps = 3/197 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK-IDIFAF 74
           + +++AL+TG++ G+G +       +G  +    R+   +  + ++L K N + +  FA 
Sbjct: 1   MKSKVALITGANGGLGEFLVRRFWDAGYSLCLVARNERSIMAISSSLPKRNDQNVSFFAC 60

Query: 75  DLRDSN-ALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           DL D    +ELTKT I K   +LD+L+ NA   G I P+W+   +++   I VN+++   
Sbjct: 61  DLSDPVLVVELTKT-IRKHHQRLDVLVNNAATHGPIGPLWESDLQAWQRTIQVNLLSPVA 119

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + R+F PW+K++  G  I +S G A   R  + AY+ SK A+   + T ++ET    +RV
Sbjct: 120 LCRAFVPWMKENGGGSIINVSGGGATGPRANFSAYATSKGALVRFSETLAEETRLLGIRV 179

Query: 194 INIDPGPTRTSMRAKAM 210
             I PG  +T M A+ +
Sbjct: 180 NCIAPGAMKTRMLAEVI 196


>gi|90415852|ref|ZP_01223785.1| putative short-chain type dehydrogenase/reductase [marine gamma
           proteobacterium HTCC2207]
 gi|90332226|gb|EAS47423.1| putative short-chain type dehydrogenase/reductase [marine gamma
           proteobacterium HTCC2207]
          Length = 246

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 111/231 (48%), Gaps = 15/231 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIA-CGRSISQLEKLKNALQKINKKIDIFAF 74
           L+N++A+VTGSSRGIG   A+ LA +GA V+    R+    +K+ + ++           
Sbjct: 4   LNNKVAIVTGSSRGIGAQIAITLAEAGASVVVNYSRNHKPADKVVSDIKANGGSAIAIKA 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAG-ILGSISPIWQIKEKSFADVISVNVMANWN 133
           D+     ++L       ++GK++ILI NAG IL     I    +  F  + SVNV   +N
Sbjct: 64  DISSPKEVKLMFDSAISQFGKINILINNAGSIL--YKTIQDTTDDDFDKIFSVNVKGTFN 121

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
            +R     L+  + GR I  SS       P +G Y A+K A+E L R +SKE     + V
Sbjct: 122 TLREAASRLE--NDGRIINFSSSTTRLMLPTYGVYCATKGAVEQLTRVFSKEVGARNITV 179

Query: 194 INIDPGPTRTSMRAKAMPAEDPN---------TVPHPQKVAKIISFLCATQ 235
            +I PGP  T +       E  N          +  P  VA+I+SFL + +
Sbjct: 180 NSISPGPINTELFTAGKSEEVINRLASMSAFGRIGEPVDVARIVSFLVSEE 230


>gi|149202605|ref|ZP_01879577.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Roseovarius sp. TM1035]
 gi|149143887|gb|EDM31921.1| oxidoreductase, short-chain dehydrogenase/reductase family protein
           [Roseovarius sp. TM1035]
          Length = 217

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 109/213 (51%), Gaps = 6/213 (2%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDS 79
           +ALVTG+SRG+G   A  LA++  +V+A  R+   LE+L + +Q    +  +   D+ ++
Sbjct: 9   IALVTGASRGLGAAMAEALAKT-HHVVAVARTTGALEELDDRIQAAGGQATLAPMDITNT 67

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
            A+      I  RWG +   +  A     ++P+  + E  +A  ++ NV A   ++    
Sbjct: 68  GAMAQLCRSIHDRWGAVATWVHAAVHAAPLTPVAHLSEGDWAKSVACNVTATGILIPFIA 127

Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199
           P L     G+A+      A +    +GAY A+KA+  ALAR+W  ET  T  RV  + P 
Sbjct: 128 PLLGTD--GQAVFFDDPRAGE--KFYGAYGATKASQIALARSWQAETAKTGPRVHILAPA 183

Query: 200 PTRTSMRAKAMPAEDPNTVPHPQ-KVAKIISFL 231
           P  T+ RA+  P ED   +  P+ + A++++ L
Sbjct: 184 PMPTATRARFHPGEDREGLASPRDEAARLMAAL 216


>gi|120402969|ref|YP_952798.1| short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii
           PYR-1]
 gi|119955787|gb|ABM12792.1| short-chain dehydrogenase/reductase SDR [Mycobacterium vanbaalenii
           PYR-1]
          Length = 272

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 98/210 (46%), Gaps = 17/210 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACG-------------RSISQLEKLKNAL 62
           L+ R+A +TG++RG G   A+ +A  GA +IA                +   L +    +
Sbjct: 4   LEGRVAFITGAARGQGRAHAVRMATEGADIIAVDIAGPLPPCVPYDHATPDDLAETVKLV 63

Query: 63  QKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQ-IKEKSFA 121
           +   ++I     D RD  AL  T        G+LD+++ANAGI  +    W  I    F 
Sbjct: 64  EATGRRILASKVDTRDGEALRATVEKGVAELGRLDVIVANAGI--TAPQAWDDIGADDFR 121

Query: 122 DVISVNVMANWN-IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALAR 180
           DV+ VNV   WN +M      +     G  I++SS A  K +P    Y+ASK A+  +AR
Sbjct: 122 DVMDVNVTGTWNTVMAGAHKIIDGGRGGSIILISSAAGIKLQPFMIHYTASKHAVTGMAR 181

Query: 181 TWSKETVNTALRVINIDPGPTRTSMRAKAM 210
            ++ E    ++RV ++ PGP  T M    M
Sbjct: 182 AFAAELGKHSIRVNSVHPGPVLTDMGTGDM 211


>gi|256374523|ref|YP_003098183.1| short-chain dehydrogenase/reductase SDR [Actinosynnema mirum DSM
           43827]
 gi|255918826|gb|ACU34337.1| short-chain dehydrogenase/reductase SDR [Actinosynnema mirum DSM
           43827]
          Length = 283

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 106/219 (48%), Gaps = 1/219 (0%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
            VTG+S+G+G     +L   GA V A  RS  +L            ++   A DL D   
Sbjct: 8   FVTGASKGLGLELVRQLLAQGANVAATSRSADRLRAALADADADTTRLLPLAVDLADEAD 67

Query: 82  LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW 141
           ++   T  A+R+G+LD+++ NAG  G ++ + +   ++  D++ V V+  WN++R+  P 
Sbjct: 68  VQRAVTAAAERFGRLDVVVNNAGY-GYLAAVEETTAQAVRDMLDVQVVGVWNVLRAALPV 126

Query: 142 LKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT 201
           +++   GR + +SS       P W  Y A K A+EA+    + E     + V  ++PG  
Sbjct: 127 MREQRSGRVVNVSSVLGLVSLPGWALYCAGKFALEAMTEALAGEVAGHGIEVTLVEPGYF 186

Query: 202 RTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG 240
           RTS  +    A    T  H  ++ ++++   A Q  + G
Sbjct: 187 RTSFLSPDSLALPETTTDHYPQIRRMVADHRALQGSQLG 225


>gi|126658147|ref|ZP_01729298.1| putative ketoacyl reductase [Cyanothece sp. CCY0110]
 gi|126620518|gb|EAZ91236.1| putative ketoacyl reductase [Cyanothece sp. CCY0110]
          Length = 266

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 115/247 (46%), Gaps = 24/247 (9%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           +   + N++AL+TG+  GIG  TA  LA  G  +    ++  QL+     + +I + I +
Sbjct: 1   MDFGIKNKVALITGADSGIGKATAKLLAAEGVKIALSDKTTDQLQANAEEISEIGEVIPV 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            A DL     +E  K  I  R+G L IL+  AGI G+     ++ ++ +   + ++ MA 
Sbjct: 61  TA-DLTKPEDIEAAKKEILTRFGTLHILVNCAGITGATKDFLELSDEDWYQTLEIDFMAA 119

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + R+F P ++K   GR +++ S  A +  P    Y A+KAAI  LA+  SK      +
Sbjct: 120 VRVCRAFIPMMQKEQWGRVVLIGSEDAVQPYPDEMPYCAAKAAILNLAKNLSKVYAKDGI 179

Query: 192 RVINIDPGPTRTSM-------RAK--------AMPAEDPNTVPH--------PQKVAKII 228
            V ++ P    T M       RAK        A+     N  PH          +VA +I
Sbjct: 180 LVNSVSPAYIETPMTDAMMEKRAKEKDISFDQAIDTFLENKRPHLVLNRRGKANEVAAVI 239

Query: 229 SFLCATQ 235
           +FLC+ Q
Sbjct: 240 AFLCSQQ 246


>gi|254486073|ref|ZP_05099278.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Roseobacter sp. GAI101]
 gi|214042942|gb|EEB83580.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Roseobacter sp. GAI101]
          Length = 216

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 105/218 (48%), Gaps = 6/218 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            + AL+TG+SRG+G   A  L  S  ++IA  ++   LE+L + +Q       +   D+ 
Sbjct: 2   TKTALITGASRGLGAALAEALCDSH-HIIAVAKTTGALEELDDRIQARGGSATLAPMDIT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +  A+      I  RWG LD+ +  A     ++P   I  K  A  ++ N+ A   ++  
Sbjct: 61  NDAAMATLCRGIFDRWGSLDLWLHTAVHAAPLTPTDHIDAKDMAKSVAANITATSTLITY 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L ++  G+A+             +G+Y A+KAA  ALAR+W  ET     +V  + 
Sbjct: 121 VSPLLGQA--GQAVFFDD--PVIATKFFGSYGATKAAQIALARSWQAETAQIGPKVHIVT 176

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVA-KIISFLCAT 234
           P P  T+ RA+  P ED   +  PQ  A KII+ L A+
Sbjct: 177 PAPMPTATRARFHPGEDRAALHSPQSQADKIIASLSAS 214


>gi|146302653|ref|YP_001197244.1| short-chain dehydrogenase/reductase SDR [Flavobacterium johnsoniae
           UW101]
 gi|146157071|gb|ABQ07925.1| short-chain dehydrogenase/reductase SDR [Flavobacterium johnsoniae
           UW101]
          Length = 250

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 115/235 (48%), Gaps = 26/235 (11%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL+N++A+VTG + GIGY  A ELA  GA VI  GR+       K AL K   ++++   
Sbjct: 3   NLENKVAIVTGGNSGIGYAAAAELASKGAKVIVTGRN-------KEALAKAETELNVTGI 55

Query: 75  --DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D  D  +++     +  ++GK+DIL  NAGI  + +P+    E+ +  +++VNV   +
Sbjct: 56  VADQSDLKSIDNLVEEVKAKFGKVDILFLNAGI-AAFAPVDSASEEHYDSIMNVNVKGVY 114

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
             ++   P L  +  G  I  +S  A    P    Y ASKAA+ +L R ++ E  +  +R
Sbjct: 115 FTVQKVLPIL--NDGGSIIFNTSVNAQLGMPGSSVYGASKAAVLSLNRIFAAELASRKIR 172

Query: 193 VINIDPGPTRTSMRAK-AMPAEDPNTV-------------PHPQKVAKIISFLCA 233
           V  + PGP  T +  K  +  E+   +                 +VAK ISFL +
Sbjct: 173 VNAVSPGPIETPLYGKVGLEKEEVEGLGAALGEKILLKRFGQASEVAKTISFLAS 227


>gi|261342051|ref|ZP_05969909.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Enterobacter cancerogenus ATCC 35316]
 gi|288315707|gb|EFC54645.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Enterobacter cancerogenus ATCC 35316]
          Length = 249

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 112/232 (48%), Gaps = 21/232 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L N++ALVTG S GIG  +A ELA  GA V   GR   + ++L  A+  I         D
Sbjct: 5   LSNKIALVTGGSTGIGLASAQELAAQGAKVYITGR---RQQELDAAIALIGTSAKGIRAD 61

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +   + L+     IA+  G+LDIL ANAG  G + P+  I E+ F  +   NV      +
Sbjct: 62  VSRLDDLDKVYAQIAEESGRLDILFANAG-GGDMLPLGAISEEHFDRIFGTNVRGVLFTV 120

Query: 136 RSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P L     G +IIL+ S  + K    +  YSASKAA+   AR+W+ +     +RV 
Sbjct: 121 QKALPLL---GAGSSIILTGSTVSVKGTANFSVYSASKAAVRNFARSWALDLQGRGIRVN 177

Query: 195 NIDPGPTRTSMRA------------KAMPAEDP-NTVPHPQKVAKIISFLCA 233
            + PGP +T                +A+ A+ P   +  P +V K ++FL +
Sbjct: 178 VVSPGPVKTPGLGGLVAEEQRQGLFEALAAQVPLGRIGEPAEVGKAVAFLAS 229


>gi|326328956|ref|ZP_08195286.1| short-chain dehydrogenase/reductase SDR [Nocardioidaceae bacterium
           Broad-1]
 gi|325953215|gb|EGD45225.1| short-chain dehydrogenase/reductase SDR [Nocardioidaceae bacterium
           Broad-1]
          Length = 255

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 114/238 (47%), Gaps = 20/238 (8%)

Query: 13  HVN-LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           H+  LD + A+VTG S GIG  TAL LA  GAYV   GR  ++LE    A+    ++   
Sbjct: 5   HIGQLDGKTAVVTGGSSGIGLATALRLADEGAYVFVTGRREAELEAAVTAIGP--ERATG 62

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+ +   L+     +  R   LD+L+ANA + G+   + +  E+ F  +  +N    
Sbjct: 63  VTGDISELADLDRLYDAVRARGRGLDVLVANAAV-GTFVTLEETTEEHFDQIFGINTRGT 121

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
              ++   P L        I++ S AA +    +GAY+ASKAA+ + ARTWS E  +  +
Sbjct: 122 LFTVQKALPLLNDGAS--VILIGSTAADRGMEAFGAYAASKAALRSFARTWSAELKHRGI 179

Query: 192 RVINIDPG----PTRTSM-----RAKAMPAEDPNTVP-----HPQKVAKIISFLCATQ 235
           RV  + P     P  T+       A+A+      TV       P++ A +++FL + Q
Sbjct: 180 RVNVVSPAWIETPGGTAAFGDEETARAIKEHVEATVAKGRMGRPEEAAAVVAFLASEQ 237


>gi|113474106|ref|YP_720167.1| short-chain dehydrogenase/reductase SDR [Trichodesmium erythraeum
           IMS101]
 gi|110165154|gb|ABG49694.1| short-chain dehydrogenase/reductase SDR [Trichodesmium erythraeum
           IMS101]
          Length = 257

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 61/191 (31%), Positives = 97/191 (50%), Gaps = 1/191 (0%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIF 72
           ++++N++ L+TG+S GIG   A   A+SGA +I   R   +LEKL   L +K   K+ + 
Sbjct: 2   ISVENKIVLITGASSGIGESCAQIFAQSGAQLILLARRQEKLEKLAEVLTKKYQTKVYLL 61

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+RD  A+E     + + W K+DILI NAG+   ++ +     K + ++I  NV    
Sbjct: 62  NLDIRDRLAVESAINSLPEPWKKIDILINNAGLSRGLNKLHIGDFKDWEEMIDTNVKGLL 121

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            I R   P +     G  + + S A     P    Y ASKAA+ A++    ++ + T +R
Sbjct: 122 YITRYIVPEMVSRGRGHVVNIGSIAGRGAYPKGNVYCASKAAVRAISEGLKQDLLGTPIR 181

Query: 193 VINIDPGPTRT 203
           V  I PG   T
Sbjct: 182 VTEIQPGLVET 192


>gi|225010484|ref|ZP_03700955.1| short-chain dehydrogenase/reductase SDR [Flavobacteria bacterium
           MS024-3C]
 gi|225005313|gb|EEG43264.1| short-chain dehydrogenase/reductase SDR [Flavobacteria bacterium
           MS024-3C]
          Length = 226

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 103/225 (45%), Gaps = 9/225 (4%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           ++TG+SRGIG+  A      G  V+A  R+ S ++ LK         +  FAFD+  S  
Sbjct: 5   VITGTSRGIGFEMAKIYVAQGHQVLALSRNPSPIDALKL------DGLYAFAFDICQSED 58

Query: 82  LELTKTYIAKRWG-KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDP 140
           ++    ++A +WG KLD+LI NAG L +  P  +     F  V +VNV     + ++  P
Sbjct: 59  IQKAAHFVATQWGGKLDVLINNAGTLIN-KPFLETTTADFQQVYAVNVFGVAALTKALIP 117

Query: 141 WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGP 200
           +++K H      +         P   AYS+SK A+  L   W++E   T      +  G 
Sbjct: 118 FMEKGHVVTVSSMGGVQGSSKFPGLAAYSSSKGAVITLTELWAEEFKETGPSFNVLAIGA 177

Query: 201 TRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSV 245
            RT M A A P  +P T    Q  A I+ F      +  GK+  V
Sbjct: 178 VRTEMLAAAFPGYEPPTTAE-QMGAYIVDFSLNGHALYNGKMLQV 221


>gi|86136911|ref|ZP_01055489.1| 20-beta-hydroxysteroid dehydrogenase, putative [Roseobacter sp.
           MED193]
 gi|85826235|gb|EAQ46432.1| 20-beta-hydroxysteroid dehydrogenase, putative [Roseobacter sp.
           MED193]
          Length = 256

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 104/199 (52%), Gaps = 8/199 (4%)

Query: 11  EIHV-NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI 69
           EI++ ++  +  ++TG+SRGIG   A   A++GA +    RS   L  L    ++I    
Sbjct: 4   EIYLMDIKGKTVVITGASRGIGADAARVFAQAGANLALLARSADSLAALA---EEIGGNT 60

Query: 70  DIFAFDLRDSNALE--LTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVN 127
             FA D+ D  A+   L +T++A  +G LD+LI NAG++  I+ I      ++  ++ VN
Sbjct: 61  LAFACDVSDPAAVAAALQQTHLA--FGSLDVLINNAGVIDPIARIEDADPAAWGQLMDVN 118

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
           +   +N + +  P +K    G  I + SGAAY     W AY ASKAA+  L +    E  
Sbjct: 119 IKGVFNGIHAALPLMKSGSGGTIINIGSGAAYNALEGWSAYCASKAAVLMLTKALHLEEA 178

Query: 188 NTALRVINIDPGPTRTSMR 206
              +RV+++ PG   T M+
Sbjct: 179 ENGIRVLSLSPGTVATDMQ 197


>gi|207721982|ref|YP_002252420.1| hypothetical protein RSMK02298 [Ralstonia solanacearum MolK2]
 gi|206587155|emb|CAQ17739.1| hypothetical protein RSMK02298 [Ralstonia solanacearum MolK2]
          Length = 283

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 104/194 (53%), Gaps = 7/194 (3%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL--QKINKKI 69
           + ++L N+LALVTGS++GIG+  A+ LA  GA VI  GR+ + + +  + L  +     +
Sbjct: 22  MDLHLQNKLALVTGSTKGIGHAIAVALAAEGARVILNGRTDASVAEAVSRLLAEAPGAHV 81

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           + FA DL D    E     +A R+ ++DIL+ N GI     P   I +  +    +VNVM
Sbjct: 82  EAFAGDLSDPAQAE----ALAARFPRVDILVNNLGIFDP-KPFEDIDDAEWLRFFNVNVM 136

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           +   + R++ P +K  + GR + +SS +  +       Y  +K A+  L+R  ++    T
Sbjct: 137 SGVRLSRAYLPGMKAQNWGRIVFISSESGVQIPAEMVHYGVTKTALLGLSRGLAELCAGT 196

Query: 190 ALRVINIDPGPTRT 203
           A+ V  + PGPTR+
Sbjct: 197 AVTVNAVLPGPTRS 210


>gi|325983084|ref|YP_004295486.1| short-chain dehydrogenase/reductase SDR [Nitrosomonas sp. AL212]
 gi|325532603|gb|ADZ27324.1| short-chain dehydrogenase/reductase SDR [Nitrosomonas sp. AL212]
          Length = 248

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 111/222 (50%), Gaps = 4/222 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAF 74
           L +R+ LVTG+ +G+G   AL  A  GA VI  GR + +LE + + ++ I K +  I+  
Sbjct: 14  LKDRVILVTGAGQGLGRAAALSYANHGATVILHGRKVKKLESVYDEIETIGKAQALIYPL 73

Query: 75  DLRDSNALEL--TKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
           DL  +   +       IA++ G+LD ++ NA  L  +SP+     + +  ++ VN++A +
Sbjct: 74  DLERAEEKDFFALAHAIAQQLGRLDGILHNAAYLPGLSPLEHQTTEHWQALLQVNLIAPF 133

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKE-TVNTAL 191
            + ++  P LK S     I+ SS   +     WG ++ +KA +EAL +  + E +  + L
Sbjct: 134 ALTKACLPLLKVSPDASIIMTSSTQGHNPSAYWGGFAVAKAGLEALVKIQADEWSQMSNL 193

Query: 192 RVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           R+  + PG   T  R    P E    +  P ++  +  +L  
Sbjct: 194 RINTVIPGLVNTPQRVITHPGEIKQKMRQPDELMAVYLYLMG 235


>gi|159898018|ref|YP_001544265.1| short-chain dehydrogenase/reductase SDR [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159891057|gb|ABX04137.1| short-chain dehydrogenase/reductase SDR [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 249

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 104/208 (50%), Gaps = 19/208 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYV-IACGRSISQLEKLKNALQKINKKIDIFAF 74
           L  ++ALVTG SRGIG  +A+ LA  GA V I+   S S+ E +   LQ +  K   F  
Sbjct: 5   LAGKVALVTGGSRGIGAASAVALAEQGADVAISYVASASKAEAVVEQLQALGVKAVAFQA 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPI------WQIKEKSFADVISVNV 128
           D  DS+ +      +   +GKLDIL+ NAG++  ++P+       +  E  FA    VNV
Sbjct: 65  DQADSDQVAALVNKVVSHFGKLDILVNNAGVI-QLAPLNDANADLEAVEHMFA----VNV 119

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCR-PLWGAYSASKAAIEALARTWSKETV 187
               + +R+  P L+    GR I + S +A     P +G YSA+KAA+    R W+ E  
Sbjct: 120 KGVASAVRAATPLLQDG--GRIISIGSVSADTAPIPGFGDYSATKAAVAGYTRAWANELG 177

Query: 188 NTALRVINIDPGPTRTSMRAKAMPAEDP 215
              + V NI PGP  T M     P + P
Sbjct: 178 RRGITVNNIQPGPIDTDMG----PGDGP 201


>gi|307327443|ref|ZP_07606629.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
 gi|306886842|gb|EFN17842.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           violaceusniger Tu 4113]
          Length = 282

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 100/199 (50%), Gaps = 7/199 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD   AL+TG+SRGIG   A   A +GA +    R+   L+   + L   N K  +   D
Sbjct: 12  LDGLRALITGASRGIGQAIAATFAEAGAELALSARTTQALKPTSDLLNGHNPKRVLIGAD 71

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGS-------ISPIWQIKEKSFADVISVNV 128
           L D  A E T    A   G LDI++ NAG L         ++P+ + +++ F  V+SVN+
Sbjct: 72  LADRGAAEQTVNEAAAALGGLDIIVHNAGTLPQDDDGNPILAPLHKTRQRDFEHVVSVNL 131

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A   + R+  P L++S     +I+SS AA    P   AY+A+KAA  AL R+ +     
Sbjct: 132 NATAALARAAHPHLERSDNASLVIMSSAAAVSGCPGMDAYAATKAAQLALTRSLAVGWAR 191

Query: 189 TALRVINIDPGPTRTSMRA 207
           T +RV  + PG   T M A
Sbjct: 192 TGIRVNALCPGWVATDMTA 210


>gi|150021701|ref|YP_001307055.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Thermosipho
           melanesiensis BI429]
 gi|149794222|gb|ABR31670.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Thermosipho
           melanesiensis BI429]
          Length = 244

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 119/230 (51%), Gaps = 15/230 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++ ++TG+  GIG   AL  ++ GA VIAC      L+KLK      + +ID+F  D
Sbjct: 3   LEGKVCIITGAGSGIGKAAALLFSQEGAKVIACDVVEENLKKLKEE----DDRIDVFVLD 58

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + +  A++     + +++G++D+L+ NAGI    + + ++KE+ +  VI+VN+   +N+ 
Sbjct: 59  VTNREAIQNMVDNVVEKYGRIDVLVNNAGITRD-ALLLKMKEEDWDAVINVNLKGVFNMT 117

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA--LRV 193
           ++  P + K   G  I  SS            YSA+KA I  + +TW+KE       +RV
Sbjct: 118 QAIAPIMLKQGKGSIINTSSVVGVYGNIGQTNYSATKAGIIGMTKTWAKELARKGAQIRV 177

Query: 194 INIDPGPTRTSMRAK-------AMPAEDP-NTVPHPQKVAKIISFLCATQ 235
             + PG  +T M  K       A+  + P   +   ++VA++  FL + +
Sbjct: 178 NAVAPGFIKTPMTEKVPERIINALNEKIPLKRMGEAEEVARVYLFLASDE 227


>gi|84686127|ref|ZP_01014023.1| 20-beta-hydroxysteroid dehydrogenase, putative [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666220|gb|EAQ12694.1| 20-beta-hydroxysteroid dehydrogenase, putative [Rhodobacterales
           bacterium HTCC2654]
          Length = 250

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 106/228 (46%), Gaps = 12/228 (5%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           +++  +  ++TG+SRGIG   A   A +GA V    RS   L  L    ++I        
Sbjct: 1   MDMTGKTVVITGASRGIGEAAARVFAEAGANVALLARSGDALTSLA---EEIGDNALALE 57

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+    A++        ++G +D+LI NAG++  I+ +       +  VI +NV   ++
Sbjct: 58  CDVASFEAVQTAVDEAIAQFGGVDVLINNAGVIEPIANMADSDPDDWGRVIDINVKGVYH 117

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
            MR+  P ++K+  G  + +SSGAA+     W  Y  SKAA+  L R   KE V   +R 
Sbjct: 118 GMRAVLPTMRKAGSGTVLTISSGAAHGALEAWSHYCTSKAAVHMLTRCLHKEEVGHGIRA 177

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPH--------PQKVAKIISFLCA 233
           I + PG   T M+ + + A   N V          P   AK + +LC 
Sbjct: 178 IGLSPGTVATEMQ-REIKASGVNPVSQLDWSDHIPPDWPAKCLLWLCG 224


>gi|307728787|ref|YP_003906011.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. CCGE1003]
 gi|307583322|gb|ADN56720.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. CCGE1003]
          Length = 246

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 112/235 (47%), Gaps = 20/235 (8%)

Query: 12  IHVN-LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID 70
           +H+N LD   A++TG + GIG   A      GA+V   GR    L+     L    + + 
Sbjct: 1   MHMNRLDGMTAVITGGATGIGRAAAKRFIEEGAFVFIFGRRQEALDAAVADLGPNARAVK 60

Query: 71  IFAFDLRDSNALELTKTYIAKRW--GKLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
               DL D     L + Y A +   G LDI+ ANAG  GS  P+ QI  +   ++   NV
Sbjct: 61  GSVCDLAD-----LKRLYAAVKAERGSLDIVFANAGA-GSQLPLGQITVEHIDEIFDTNV 114

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
             +   ++   P +  S  G  I+  S A     P + AYSASKAA+  LARTW+++   
Sbjct: 115 KGSIFTIQKALPLM--SRGGSIILTGSSAGTTGAPAFSAYSASKAAVRNLARTWAEDLKG 172

Query: 189 TALRVINIDPGPTRTSMRAKAMPAE--------DP-NTVPHPQKVAKIISFLCAT 234
           T +RV  + PGPT T +  +A+  E        +P   +  P ++  + +FL ++
Sbjct: 173 TGIRVNVLSPGPTATELAKEALGEEGMKLFASLNPLQRMADPAEIGAVAAFLASS 227


>gi|188501495|gb|ACD54626.1| short-chain dehydrogenase/reductase-like protein [Adineta vaga]
          Length = 250

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 114/234 (48%), Gaps = 23/234 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAF 74
           LD ++A +TG + GIG  TA      GAYV      ++Q EKL  A+Q+I N+ I     
Sbjct: 4   LDGKVAYITGGAEGIGLATAQRFVIEGAYVFIT--DLNQ-EKLDLAVQQIGNQNITAIRA 60

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+   +        I +  GKLDI+ ANAGI G++ P+  I E+ F  + +VNV     +
Sbjct: 61  DVSKLDDHHRVYNVIQREKGKLDIVFANAGIAGTM-PLGSITEEYFDHMFNVNVKG---V 116

Query: 135 MRSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + +    L   + G  IIL +S A  K  P    YSA+KA + + AR+WS +  +  +RV
Sbjct: 117 LFTVQEVLSILNDGSTIILNASIATIKGPPASSIYSATKAVLRSFARSWSVDLKHRHIRV 176

Query: 194 INIDPGPTRTSMRAKAMPAEDPNT--------------VPHPQKVAKIISFLCA 233
             I PGP  T+M       E+ +               V  P +VA+ + FL +
Sbjct: 177 NTISPGPIDTAMLWNMYDTEEKSKAFADRITTSTVLGRVGQPDEVARAVLFLAS 230


>gi|169630923|ref|YP_001704572.1| putative short-chain dehydrogenase/reductase [Mycobacterium
           abscessus ATCC 19977]
 gi|169242890|emb|CAM63918.1| Putative short-chain dehydrogenase/reductase [Mycobacterium
           abscessus]
          Length = 273

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 114/222 (51%), Gaps = 19/222 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIA----------CGRSISQLEKLKNALQKI 65
           L  ++A VTG++RG G   A+ LA++GA V+A           G   +  E LK  ++ +
Sbjct: 6   LAGKVAFVTGAARGQGRQHAVRLAQAGADVVAIDACAPVSEYAGYEAATPEDLKETVRLV 65

Query: 66  ---NKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFAD 122
               +KI     D+R+  AL+        ++G +DILIANAG+L S   +W++ ++ + D
Sbjct: 66  EAAGRKIIAEQADVRNGAALQSVVEEAVAQFGHIDILIANAGVL-SWGRLWEMSDQQWED 124

Query: 123 VISVNVMANWNIMRSFDP-WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALART 181
           +I  N+   W  +++  P  ++  + G  +I+SS +  K  P  GAY ASK  +  L ++
Sbjct: 125 IIDTNLTGTWKTVKAVVPTMIEAGNGGSIVIVSSVSGLKGTPGNGAYVASKFGLTGLTKS 184

Query: 182 WSKETVNTALRVINIDP-GPTRTSMRAKAMP---AEDPNTVP 219
            + E     +RV +I P G T   +   AM    AE PN +P
Sbjct: 185 LTIELAEYGIRVNSIHPYGVTTPMITGDAMMKILAEHPNYLP 226


>gi|299140418|ref|ZP_07033574.1| short-chain dehydrogenase/reductase SDR [Acidobacterium sp.
           MP5ACTX8]
 gi|298597602|gb|EFI53784.1| short-chain dehydrogenase/reductase SDR [Acidobacterium sp.
           MP5ACTX8]
          Length = 244

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 109/227 (48%), Gaps = 15/227 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++A+VTG S G+   +A      GAYV   GR   + E+L  A++ I + +     D
Sbjct: 4   LEGKVAVVTGGSSGLALASAKRFVEEGAYVFITGR---RQEQLDEAVKLIGRNVTGVRGD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
             + + L+     + +  GK+D+L A+AG  G   P+ +I E+ F     +N       +
Sbjct: 61  AANLDDLDRLFDTVKQAKGKIDVLYASAGT-GEALPLGEITEQHFDAAFGLNTRGTLFTV 119

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P    +  G  I+  S A+ K  P +G Y+ASKAA+ + ARTW  E     +RV  
Sbjct: 120 QKALPLF--NDGGSIIMTGSVASVKGFPGFGVYAASKAALRSFARTWLNELKGRKIRVNV 177

Query: 196 IDPGPTRTSMRAKAMPAEDP---------NTVPHPQKVAKIISFLCA 233
           + PGP  T M+ + +  E            T+  P+++A +  FL +
Sbjct: 178 LSPGPIATPMQEEVLTKEAKEMFESLIPRGTMGQPEEIATVALFLAS 224


>gi|226953457|ref|ZP_03823921.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter sp. ATCC
           27244]
 gi|294649554|ref|ZP_06726974.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226835799|gb|EEH68182.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter sp. ATCC
           27244]
 gi|292824541|gb|EFF83324.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 244

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 115/223 (51%), Gaps = 12/223 (5%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           ++ALVTG+SRGIG   A +L + G +V+    S S  +KL  +  +          D+R+
Sbjct: 6   KVALVTGASRGIGAAIAQQLIQDGFFVVGTATSESGAQKLTESFAEHGAGA---VLDVRN 62

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
             A++   + I +++G + +L+ NAGI    + + ++ E  + D++++++ A + + +  
Sbjct: 63  GEAIDALVSDIEQKYGSVLVLVNNAGITKD-NLLLRMSEDDWDDILNIHLKAVYRLSKRV 121

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
              + K+  GR I +SS  A+   P    YSA+KA IEA +R+ +KE  +  + V ++ P
Sbjct: 122 LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP 181

Query: 199 GPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCA 233
           G   T M        R K       N +  PQ +A  +SFL +
Sbjct: 182 GFIATEMTDQLSEEIRKKMTDQVALNRLGEPQDIANAVSFLAS 224


>gi|295703389|ref|YP_003596464.1| short chain dehydrogenase/reductase family oxidoreductase [Bacillus
           megaterium DSM 319]
 gi|294801048|gb|ADF38114.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Bacillus megaterium DSM 319]
          Length = 239

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 108/215 (50%), Gaps = 2/215 (0%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  ++AL+TG+ +GIG  TA+ELA+ G  +    R+ + L+ + + L+  + ++     
Sbjct: 4   SLKGKVALITGAGKGIGRSTAIELAKEGVNIGLIARTEADLKAVASELEAFDVQVAYATA 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+     +     ++  + G  DILI NAGI G      ++    +  +I VN+M  + +
Sbjct: 64  DVSSMEEVNAAVEHLHTKLGATDILINNAGI-GKFGSFLELDPAEWKQIIDVNLMGVYYV 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R+  P L + + G  I +SS A  K  P+  AYSASK  +  L  + + E     +RV 
Sbjct: 123 TRAVLPQLIEKNGGDIINISSTAGQKGAPVTSAYSASKFGVLGLTESLALEVRKHNIRVT 182

Query: 195 NIDPGPTRTSMRAKA-MPAEDPNTVPHPQKVAKII 228
            + P    T +  K  +   +P+ V  P+ +A+I+
Sbjct: 183 ALTPSTVATELAYKENLTDGNPDKVMQPEDLAEIM 217


>gi|91777017|ref|YP_546773.1| short-chain dehydrogenase/reductase SDR [Methylobacillus
           flagellatus KT]
 gi|91711004|gb|ABE50932.1| short-chain dehydrogenase/reductase SDR [Methylobacillus
           flagellatus KT]
          Length = 262

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 107/192 (55%), Gaps = 3/192 (1%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           + +NL+N+LALVT SS GIG   A  LAR GA VI  GRS + ++K  + +++   + D+
Sbjct: 1   MQLNLENKLALVTASSAGIGLAIARSLAREGAKVIINGRSQASVDKAISQIRQDVPQADL 60

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
               + D+  L  T+  IA+ + ++DIL+ N GI  ++   +   + ++  +  VNVM+ 
Sbjct: 61  VGL-VADNGTLAGTQATIAQ-FPQVDILVNNLGIYEAVG-FFDETDAAWQHLFEVNVMSG 117

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + R +   + +S  GR + +SS +     P    YSA+K     ++R+ ++ T  TA+
Sbjct: 118 VRLARHYLGKMLESKVGRIVFISSESGVTPAPEMAHYSATKTMQLGISRSLAELTKETAV 177

Query: 192 RVINIDPGPTRT 203
            V  + PGPTRT
Sbjct: 178 TVNAVLPGPTRT 189


>gi|220935004|ref|YP_002513903.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996314|gb|ACL72916.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 247

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 120/233 (51%), Gaps = 19/233 (8%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L+N +ALVTGSSRGIG   A+ LA  GA V+    S S  E +   L++   K    A
Sbjct: 1   MSLENEIALVTGSSRGIGKAIAMALAEQGATVVGTATSESGAEAITAYLREAGLKGRGMA 60

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            ++ D+ A+E     I+   G + IL+ NAGI    + + ++K++ + D+I  N+ A W 
Sbjct: 61  LNVTDAEAVEAAIKQISDDLGGISILVNNAGIT-RDNLMMRMKDEEWDDIIQTNLTAVWR 119

Query: 134 IMRSFDPWLKKSHCGR-----AIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
           + R     + K+  GR     +++ SSG A +       Y+A+KA +  L ++ ++E  +
Sbjct: 120 VTRGVLRGMMKARKGRIINVGSVVGSSGNAGQTN-----YAAAKAGLLGLGKSLAREVGS 174

Query: 189 TALRVINIDPGPTRTSM-------RAKAMPAEDP-NTVPHPQKVAKIISFLCA 233
             + V  + PG   T M       +  A+  + P   +  P+++A +++FL +
Sbjct: 175 RGITVNTVAPGFIDTDMTRGLPEAQRDALLGQIPLGRLGRPEEIASVVAFLAS 227


>gi|1717754|sp|P50164|TRN2_HYONI RecName: Full=Tropinone reductase 2; AltName: Full=Tropinone
           reductase II; Short=TR-II
 gi|425150|gb|AAB09776.1| tropinone reductase-II [Hyoscyamus niger]
 gi|6136877|dbj|BAA85845.1| tropinone reductase-II [Hyoscyamus niger]
          Length = 260

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 108/234 (46%), Gaps = 19/234 (8%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL+   ALVTG SRGIGY    ELA  GA V  C R+  +L++     +     ++    
Sbjct: 6   NLEGCTALVTGGSRGIGYGIVEELANLGASVYTCSRNQKELDECLTQWRSKGFNVEASVC 65

Query: 75  DLRD-SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           DL   S   E  KT      GKL+IL+ NAGI+           + ++ ++S+N  A ++
Sbjct: 66  DLSSRSEREEFMKTVSNHFHGKLNILVNNAGIV-IYKEAKDYTMEDYSHIMSINFEAAYH 124

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           +     P+LK S  G  + +SS +     P    Y A+K A++ L R  + E     +RV
Sbjct: 125 LSVLAHPFLKASERGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRV 184

Query: 194 INIDPGPTRTSMRAKAMPAEDPNT---------------VPHPQKVAKIISFLC 232
             + PG   TSM    M  +DP                 +  P+++A +++FLC
Sbjct: 185 NGVGPGVIATSM--VEMTIQDPEQKENLDKLIDRCALRRMGEPKELAAVVAFLC 236


>gi|298294039|ref|YP_003695978.1| short-chain dehydrogenase/reductase SDR [Starkeya novella DSM 506]
 gi|296930550|gb|ADH91359.1| short-chain dehydrogenase/reductase SDR [Starkeya novella DSM 506]
          Length = 250

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 75/251 (29%), Positives = 125/251 (49%), Gaps = 18/251 (7%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIAC---GRSISQLEKLKNALQKINKKID 70
           ++L  R+A+VTG +RGIGY TA  L +SGA V      GR +++      AL K++  I 
Sbjct: 4   IDLKGRVAIVTGGARGIGYATAERLLKSGATVALWDIDGRRLAEAASALFALGKVSTHI- 62

Query: 71  IFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
               +L +  ++        K  GK+DILI NAGI G    +W++  +S+  V+ VN++ 
Sbjct: 63  ---VELTEEISVNAATQATLKAHGKIDILINNAGITGGNGKLWELDTESWRRVVDVNLIG 119

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            +   ++  P L K+  GR + ++S A  +  P    YSASKA +  L ++  KE   + 
Sbjct: 120 PFLTCKAVVPELLKNGWGRIVNVASIAGKEGNPNASHYSASKAGVIGLTKSLGKELAGSN 179

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPN----TVP-----HPQKVAKIISFLCATQ-KIETG 240
           + V  + P   +T +  + M  E  +     +P     H  +VA +I++L +      TG
Sbjct: 180 ILVNCVTPAAAKTDIFDQ-MSQEHIDFMLSKIPMGRFLHVDEVAAMIAWLSSEDCAFSTG 238

Query: 241 KLFSVPQNRFV 251
            +F +   R V
Sbjct: 239 AVFDISGGRAV 249


>gi|300778130|ref|ZP_07087988.1| short chain dehydrogenase [Chryseobacterium gleum ATCC 35910]
 gi|300503640|gb|EFK34780.1| short chain dehydrogenase [Chryseobacterium gleum ATCC 35910]
          Length = 249

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 108/226 (47%), Gaps = 10/226 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYV-IACGRSISQLEKLKNALQKINKKIDIFAF 74
           L N+  L+TG+  GIG   AL  A  GA + I    S +   K K  ++ +N+K  IF  
Sbjct: 5   LKNKSVLITGADSGIGKAVALLFAMEGADIAIIYHSSDNDAGKTKAEIETLNRKCIIFKG 64

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ D    E T   +   +GK+DILI NAGI      I  ++EK+       N++    +
Sbjct: 65  DINDYEFCEATVKEVISVFGKIDILINNAGIQFPAERIEDLEEKNIRQTFDSNIVGMILL 124

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            +   P+LK+  C   I  +S +AY+  P    YSA+K AI +  R+ + +     +R+ 
Sbjct: 125 TKVVFPYLKEGSC--VINTTSVSAYQGHPELLDYSATKGAIVSFTRSLALQAKPKGIRIN 182

Query: 195 NIDPGPTRTSMRAKAMP--AEDPNTVPH-----PQKVAKIISFLCA 233
            + PGP  T +  +      E+PN  P      P+++A    FL +
Sbjct: 183 AVAPGPVATPLTEETFDEKEENPNKPPFERNATPEEIASSFLFLAS 228


>gi|322436614|ref|YP_004218826.1| short-chain dehydrogenase/reductase SDR [Acidobacterium sp.
           MP5ACTX9]
 gi|321164341|gb|ADW70046.1| short-chain dehydrogenase/reductase SDR [Acidobacterium sp.
           MP5ACTX9]
          Length = 257

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 99/193 (51%), Gaps = 3/193 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIF-- 72
           +L  +  L+TG+S GIG  TALE AR GA ++ C R + +L +L     +   + D+   
Sbjct: 3   SLRGKTVLITGASSGIGQATALEFARQGARLLLCARRLDRLTELTPQFTEAGAE-DVLNI 61

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D++D  A+  T   + + W  +DIL+ NAG+   ++ +++   +++ ++I  NV    
Sbjct: 62  RLDVQDREAVAKTLADLPENWRTIDILVNNAGLSRGLAKLYEDDPQNWEEMIDTNVKGLL 121

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            + R+  P + +   G+ I L S A ++       Y A+KAA   +      +T+   +R
Sbjct: 122 YVTRAIVPGMVERGSGQVINLGSTAGHQTYANGAVYCATKAAERVITEGLRIDTIGKGIR 181

Query: 193 VINIDPGPTRTSM 205
           V  +DPG T T+ 
Sbjct: 182 VTTVDPGMTETAF 194


>gi|329298871|ref|ZP_08256207.1| 3-oxoacyl-ACP reductase [Plautia stali symbiont]
          Length = 188

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 99/193 (51%), Gaps = 8/193 (4%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           + L+ ++ALVTG S GIG   A    + GA+V   GR  +QL     A+     +I+  A
Sbjct: 1   MKLEGKVALVTGGSSGIGLAIARRFVQEGAHVFITGRREAQLAA---AVTLTGGRIEAIA 57

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            DL  ++ +      +  R G+LDIL+ ++G+    S + +   + F     +NV A   
Sbjct: 58  GDLTSADDVARLFDTVQARAGRLDILVNSSGVAEPAS-LEETSAEHFDRTFGLNVRA--- 113

Query: 134 IMRSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           ++ +    +K    G AI+L  S A     P +GAYSASKAA+ A ARTWS E     +R
Sbjct: 114 MVFTVQHAVKHMIEGGAIVLVGSIAGGMANPGYGAYSASKAAVRAYARTWSSELAPRGIR 173

Query: 193 VINIDPGPTRTSM 205
           V  + PGPT T M
Sbjct: 174 VNTLSPGPTDTPM 186


>gi|301631383|ref|XP_002944777.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase-like [Xenopus
           (Silurana) tropicalis]
          Length = 252

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 116/245 (47%), Gaps = 17/245 (6%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
             ++++ LVTG++ GIGY TAL  AR GA+++  GR+I+  ++L  AL+ +  + +    
Sbjct: 4   QFEDQVVLVTGATAGIGYATALAFAREGAHLVVSGRNITAGDRLVTALRGLGAQAEFVRA 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           ++ D   +     +   R+G+LD+ + +AG+ G+   I +   + +A   + N +  +  
Sbjct: 64  EVSDEAEVRQLVDFCVSRFGRLDVAVNSAGLEGTGGSIMEQTVEGYAATFNANALGTFLC 123

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           ++     +     G  + LSS    +       Y ASK AIE L +  + E     +RV 
Sbjct: 124 LKHEMRVMSAQQSGAIVNLSSTMGSRGNARAPMYVASKHAIEGLTKAVALEACQYKVRVN 183

Query: 195 NIDPGPTRT-------------SMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETG 240
            + PGP  T             +M A ++PA     +  P +VA  I F+ +      TG
Sbjct: 184 AVAPGPIATDMLDRIAGGAQNIAMVAASIPA---GRIGQPDEVADAILFMASRHASYITG 240

Query: 241 KLFSV 245
           ++ +V
Sbjct: 241 QILAV 245


>gi|239940282|ref|ZP_04692219.1| putative short chain dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|239986763|ref|ZP_04707427.1| putative short chain dehydrogenase [Streptomyces roseosporus NRRL
           11379]
 gi|291443715|ref|ZP_06583105.1| dehydrogenase [Streptomyces roseosporus NRRL 15998]
 gi|291346662|gb|EFE73566.1| dehydrogenase [Streptomyces roseosporus NRRL 15998]
          Length = 240

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 117/231 (50%), Gaps = 11/231 (4%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAFDLRD 78
           +A++TG S+G+G   A  LA  G  ++   R+   LE+    L+ +   ++     D+ D
Sbjct: 3   VAMITGGSKGLGRALAGALAGEGWDLVLDARTAGVLEETARELRGRYGVRVAAVPGDVTD 62

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKE---KSFADVISVNVMANWNIM 135
           + A        A   G LD+L++NA +LG+  P+ ++     +     +  NV+A   ++
Sbjct: 63  A-AHRADLVAAAGSLGGLDLLVSNASVLGA-EPLVRLDALPLEGLRRALETNVVAALGLV 120

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P L+ S  G  +++SS AA +  P WG Y ASKAA++ LA    +E     LRV  
Sbjct: 121 QEALPLLRVSAAGAVVVISSDAAAEPYPTWGGYGASKAALDQLAAVLGEE--EPGLRVWA 178

Query: 196 IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
           +DPG   T + A A+P ED +  P P+ VA   +FL   ++   G  ++ P
Sbjct: 179 VDPGDMATDLYAAAVP-EDADPRPSPESVAP--AFLRLVRERPVGGRYAAP 226


>gi|77359840|ref|YP_339415.1| 2O-beta-hydroxysteroid dehydrogenase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76874751|emb|CAI85972.1| 2O-beta-hydroxysteroid dehydrogenase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 262

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 118/231 (51%), Gaps = 14/231 (6%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L N++ALVTG++RGIG      L  SGA VIA      +L ++    Q++  K+     
Sbjct: 6   HLTNKVALVTGAARGIGRAICQALVDSGATVIATDILTEELNQMA---QELGDKVTPMTH 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ D    +   +   ++  K+DIL+ NAGIL   + +   + + F  +I +N+   +  
Sbjct: 63  DVTDELQWQSIVSATLEKHQKIDILVNNAGIL-LFATLETTEPQQFRKLIDINITGTFLG 121

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           + S  P +KK+  G  + +SS ++       GAY+ASK A+  L RT + E     +RV 
Sbjct: 122 LHSVIPCMKKAGSGAIVNISSASSILPNNGTGAYAASKYAVRGLTRTAALELGPFGIRVN 181

Query: 195 NIDPGPTRTSM-RAKAMPAEDPNT----VP-----HPQKVAKIISFLCATQ 235
           ++ PG   T M   + + +E+ N     +P      P++VA +++FL + Q
Sbjct: 182 SVHPGAVNTPMTNPQGLSSEELNPRYKFIPQQRGCQPEEVANMVNFLVSDQ 232


>gi|163732023|ref|ZP_02139469.1| oxidoreductase, putative [Roseobacter litoralis Och 149]
 gi|161394321|gb|EDQ18644.1| oxidoreductase, putative [Roseobacter litoralis Och 149]
          Length = 211

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 5/197 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            + AL+TG+SRG+GY  A  LA +  ++IA  ++   LE+L + +Q       +   D+ 
Sbjct: 2   TKTALITGASRGLGYALAEALAPT-HHIIAVAKTTGALEELDDHIQAKGGTSTLAPMDIT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +++A+      I  RWG LD+ +  A     ++P   I  K  A  I+ NV A   ++  
Sbjct: 61  NTDAMATLCRGIFDRWGSLDLWLHAAIHAAPLTPTSHIDSKDLAKSIAANVTATATLISF 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L     G+A+      A      +G+Y ASKAA  ALAR+W  E+  T  +V  + 
Sbjct: 121 VSPLLGAD--GQAVFFDDPCA--GEKFFGSYGASKAAQIALARSWQAESATTGPKVHILT 176

Query: 198 PGPTRTSMRAKAMPAED 214
           P P  T+ R +  P E+
Sbjct: 177 PPPMPTATRGRFYPGEN 193


>gi|330819193|ref|YP_004348055.1| putative short-chain dehydrogenases/reductase family protein
           [Burkholderia gladioli BSR3]
 gi|327371188|gb|AEA62543.1| putative short-chain dehydrogenases/reductase family protein
           [Burkholderia gladioli BSR3]
          Length = 251

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 116/234 (49%), Gaps = 23/234 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++ALVTG + GIG  TA +LA  GA VI  GR  ++L++   A+  + + +     D
Sbjct: 5   LEGKVALVTGGTSGIGLATAKDLAAQGARVIITGRRQAELDQ---AVAALGQGVRGVRSD 61

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +  S  L+     I    G+LD+L  NAG  GS++ + +I E+ F D    NV A    +
Sbjct: 62  VTRSADLDALFETIRATEGRLDVLFTNAG-GGSMAALGEISEQHFDDTFERNVKAVVFTV 120

Query: 136 RSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P + +   G +IIL  S A       +  Y ASKAA+ ALAR+W  +     +RV 
Sbjct: 121 QKALPLMPQ---GASIILNGSIAGSTGTQAFSIYGASKAAVRALARSWVLDLKERGIRVN 177

Query: 195 NIDPGPTRT----SMRAKAMPAED------PNTVP-----HPQKVAKIISFLCA 233
            + PG TRT     +       +D       + VP      P ++AK++SFL +
Sbjct: 178 VVSPGSTRTIGLAELGGDTQEGQDGLLAYLASLVPIGRLADPSEIAKVVSFLAS 231


>gi|295700492|ref|YP_003608385.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. CCGE1002]
 gi|295439705|gb|ADG18874.1| short-chain dehydrogenase/reductase SDR [Burkholderia sp. CCGE1002]
          Length = 254

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 94/189 (49%), Gaps = 5/189 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LDN++ALVTG++ GIG  TA   A  GA+V   GR  ++L+     +++   K      D
Sbjct: 5   LDNKIALVTGATSGIGLATAQRFAAEGAHVYLTGRRQAELDAAVKGIREAGGKATGARVD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
                 L+     I +  G LD+L ANAG  GS+ P   I E+ F D  + NV      +
Sbjct: 65  STKLAELDALYAQIKEEQGHLDVLFANAGG-GSMLPFGNITEEHFDDTFNRNVKGVLFTV 123

Query: 136 RSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P L K   G ++IL+ S A       +  YSASKAA+ + AR W  +     +RV 
Sbjct: 124 QKALPLLAK---GASVILTGSTAGSAGTAAFSVYSASKAAVRSFARNWILDLKERQIRVN 180

Query: 195 NIDPGPTRT 203
            I PG TRT
Sbjct: 181 TISPGATRT 189


>gi|52425010|ref|YP_088147.1| gluconate 5-dehydrogenase [Mannheimia succiniciproducens MBEL55E]
 gi|52307062|gb|AAU37562.1| FabG protein [Mannheimia succiniciproducens MBEL55E]
          Length = 272

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 99/201 (49%), Gaps = 2/201 (0%)

Query: 5   ESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK 64
           E +  SE+  +L N+  L+TGS+RGIG   A  LA  GA +I  G  +   EK+      
Sbjct: 15  EEQKMSEL-FSLKNKRILITGSTRGIGNLLANGLAEHGAEIIIHGTRLETAEKIAADFNT 73

Query: 65  INKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVI 124
              K    AFD+ DS A + T  YI K  G +D+LI NAGI     P  +  EK + DVI
Sbjct: 74  KGFKAYAVAFDVTDSKAAQDTIDYIEKEIGPIDVLINNAGIQRRY-PFCEFPEKDYDDVI 132

Query: 125 SVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSK 184
           SVN  A + I ++   ++ K   G+ I + S  +   R     Y+ASK A++ L R    
Sbjct: 133 SVNQKAVFIISQAVARYMVKRQRGKIINIGSMQSELGRDTITPYAASKGAVKMLTRGMCV 192

Query: 185 ETVNTALRVINIDPGPTRTSM 205
           E     ++V  I PG   T +
Sbjct: 193 ELARYNIQVNGIAPGYFATEL 213


>gi|302541505|ref|ZP_07293847.1| short-chain dehydrogenase/reductase family oxidoreductase
           [Streptomyces hygroscopicus ATCC 53653]
 gi|302459123|gb|EFL22216.1| short-chain dehydrogenase/reductase family oxidoreductase
           [Streptomyces himastatinicus ATCC 53653]
          Length = 252

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 96/196 (48%), Gaps = 3/196 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           + ALVTG+  G+G   AL  A  GA V+A GR+ + L +    ++    +      D+ D
Sbjct: 7   KTALVTGAGSGLGRAIALAFAAEGASVVAAGRTEATLAETVRLIEAAGGRAAAVTADVTD 66

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
           S  L         R+G LDI + NAGIL    P+ ++ E+ +  V+  NV   W  M+  
Sbjct: 67  SGQLRDLVRETVDRFGGLDIAVNNAGILRGKGPVGEVSEEDWDAVLRTNVTGVWLAMKHQ 126

Query: 139 DPWLKKSHCGRAIILSSGAAYKCR-PLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
              +K++  G  + +SS      R P  GAYS SKAA+ AL R  + + ++  +R+  + 
Sbjct: 127 IAHMKENGGGAIVNVSSNLGAHLRVPGTGAYSTSKAAVSALTRAAALDHIHQGVRINAVS 186

Query: 198 PGPTRTSMRAKAMPAE 213
           PG +   M    +P E
Sbjct: 187 PGASDGPM--SLLPGE 200


>gi|301630902|ref|XP_002944555.1| PREDICTED: uncharacterized oxidoreductase ykvO-like [Xenopus
           (Silurana) tropicalis]
          Length = 249

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 93/188 (49%), Gaps = 6/188 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++A+VTG + GIG  +A+  A  GA V+  GR   + E+L  AL  I         D
Sbjct: 4   LNGKIAVVTGGNSGIGLASAIRFAAEGAQVVIVGR---RQEELDKALVLIGHDAVAIQGD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + +   L+     I    G +D+L ANAG LG + PI  I E+SF     VNV      +
Sbjct: 61  ISNLQDLDRVFAQIKTDKGHIDVLFANAG-LGDLEPIGSITEESFDRTFGVNVKGTLFTV 119

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++  P +  S  G  ++  S  A      +  YSASK A+   AR+W+ +   T +RV  
Sbjct: 120 QNALPLM--SAGGSIVLTGSTTASMGTAAFSVYSASKGALRNFARSWALDLQGTGIRVNV 177

Query: 196 IDPGPTRT 203
           + PGPT T
Sbjct: 178 LSPGPTTT 185


>gi|85710263|ref|ZP_01041328.1| Short-chain dehydrogenase/reductase SDR [Erythrobacter sp. NAP1]
 gi|85688973|gb|EAQ28977.1| Short-chain dehydrogenase/reductase SDR [Erythrobacter sp. NAP1]
          Length = 280

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 110/237 (46%), Gaps = 11/237 (4%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L+ +  ++TG+S GIG   A  +A SGA ++   R   +L ++   L+    +++    
Sbjct: 27  ELNGKTVIITGASSGIGEACAGLMAASGARLVLLARREDRLNEIARRLRSEGAEVETHVC 86

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+   + ++       +R+ ++DIL+ NAG +  I  I  +    +A  I+ NV+  +N 
Sbjct: 87  DVAVRSDVDAAIARAIERFERIDILVNNAGTITPIGHIGDVDPDLWAQAINTNVIGVFNA 146

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R+  P + + H G  I +SSGA       W  Y ASKAA   L     +E     +  +
Sbjct: 147 IRAVLPHMLEQHSGTVINMSSGAVNSALEGWSHYCASKAAARKLTEVGHREYAERGVTFV 206

Query: 195 NIDPGPTRTSM----RAKAM-PAE--DPNTVPHPQKVAKIISFLCATQKIETGKLFS 244
            + PG   T M    R   M P    DP+    P+  A+ I FLC     + G+ F+
Sbjct: 207 GLSPGTVATPMMDQIRQSGMNPVSKLDPSDHISPEAAARAILFLCG----DGGRQFA 259


>gi|319786451|ref|YP_004145926.1| short-chain dehydrogenase/reductase SDR [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317464963|gb|ADV26695.1| short-chain dehydrogenase/reductase SDR [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 252

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 110/232 (47%), Gaps = 3/232 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  R+ LV G+  G+G  +A   A +GA V+  GR + +L ++ +A+     +  ++  D
Sbjct: 14  LSGRVVLVAGAHGGLGSVSARACAEAGATVVLLGRKLPRLNRVYDAVAAAGPEPLLYPLD 73

Query: 76  LRDSNALELTK--TYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           L  +   +  +  T I    G+LD ++  A     ++P+       FA  + VN+ A W 
Sbjct: 74  LEGAGPDDYAELATRIGAELGRLDGILHCAAEFRGLTPLEHQDPAQFARALHVNLTAPWW 133

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++++  P L++S     ++     A   +  WG Y  ++  + AL R  + E  N  +R+
Sbjct: 134 LVQACLPLLRQSADPAVVVAVDDLARVGQAYWGGYGVAQHGLHALVRMLAAELANDPVRI 193

Query: 194 INIDPGPTRTSMRAKAMPAEDPNTVPHPQKVA-KIISFLCATQKIETGKLFS 244
             + PGP RT +R++A   +  + +  PQ  A + +  L A      G+L +
Sbjct: 194 CALQPGPMRTPLRSRAYADDVASDLRDPQDYAVRCVQLLSAEGAAFRGQLVT 245


>gi|170935854|emb|CAQ19732.1| tropinone reductase II [Solanum dulcamara]
          Length = 261

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 115/238 (48%), Gaps = 27/238 (11%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL+   ALVTG SRGIGY    ELA  GA V  C R+  +L +  +  +    K++    
Sbjct: 7   NLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNECLSQWRSKGFKVEASVC 66

Query: 75  DLRD-SNALELTKTYIAKRWGKLDILIANAGILGSISPIW-QIKEKSFAD---VISVNVM 129
           DL   S   E  KT      GKL+IL+ NAGI+     I+ + K+ +  D   ++S+N  
Sbjct: 67  DLSSRSEREEFIKTVANHFDGKLNILVNNAGIV-----IYKEAKDYTMEDYSLIMSINFE 121

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           A +++     P+LK S  G  + +SS +     P    Y A+K A++ LAR  + E    
Sbjct: 122 AAYHLSVLAHPFLKASERGNVVFISSISGAAALPYEAVYGATKGAMDQLARCLAFEWAKD 181

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDP---------------NTVPHPQKVAKIISFLC 232
            +RV  + PG   +SM    M  +DP               + +  P+++A +++FLC
Sbjct: 182 NIRVNGVAPGVIASSM--VEMTIQDPEQKENLDKLIDRCALHRMGEPKELAAVVAFLC 237


>gi|319952311|ref|YP_004163578.1| short-chain dehydrogenase/reductase sdr [Cellulophaga algicola DSM
           14237]
 gi|319420971|gb|ADV48080.1| short-chain dehydrogenase/reductase SDR [Cellulophaga algicola DSM
           14237]
          Length = 226

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 107/228 (46%), Gaps = 15/228 (6%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           ++TGSSRGIG+  A   A  G  V+A  R+    +K   AL   N  I  F FDL  S  
Sbjct: 5   IITGSSRGIGFEMAKLFANDGHQVLALSRN----DKPILALNHPN--ITTFPFDLSSSRD 58

Query: 82  LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW 141
           LE+   +I   W ++D+LI NAG+L +  P  +I ++ F  V  VNV    ++ ++  P 
Sbjct: 59  LEILHDFITTTWEQVDVLINNAGMLLN-KPFLEISDQEFEAVYRVNVFGVASVTKTVLPR 117

Query: 142 LKKSHCGRAIILSSGAAYKCR---PLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
           + KS  G  + +SS    +     P   AYS+SKAA+  L   W++E          +  
Sbjct: 118 MHKS--GHVVTISSMGGVQGSLKFPGLAAYSSSKAAVITLTELWAEEFKEKGPSFNVLAL 175

Query: 199 GPTRTSMRAKAMPA-EDPNTVPHPQKVAKIISFLCATQKIETGKLFSV 245
           G  +T M  +A P  + PNT    +    I  F     K   GKL  V
Sbjct: 176 GAVQTEMLEEAFPGYQAPNTA--LEMATYIKEFSLTGNKFYNGKLLQV 221


>gi|86607395|ref|YP_476158.1| short chain dehydrogenase [Synechococcus sp. JA-3-3Ab]
 gi|86555937|gb|ABD00895.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Synechococcus sp. JA-3-3Ab]
          Length = 241

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 103/211 (48%), Gaps = 1/211 (0%)

Query: 21  ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSN 80
           AL+TG+SRGIG   AL LAR G  V    RS   L  ++  +Q    K ++F  DL D  
Sbjct: 11  ALITGASRGIGKAVALALARQGVAVALVARSHPDLLGVQAEIQAKGGKAEVFPIDLADLR 70

Query: 81  ALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDP 140
           AL      +  ++G  D+L+ NAGI   + P+  +    +  VI +N+ A +   ++  P
Sbjct: 71  ALPQRLQALLDQFGVCDVLVNNAGI-AHVGPLATLSLSDWQRVIDLNLTAAFLCAQAVLP 129

Query: 141 WLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGP 200
            +++  CG  + + S A  +  P WGAY ASK  +   ++  + E     +RV ++  G 
Sbjct: 130 AMRRQRCGTIVNIISIAGKRAFPNWGAYCASKFGLLGFSQALAAEERQHGIRVTSLCLGA 189

Query: 201 TRTSMRAKAMPAEDPNTVPHPQKVAKIISFL 231
             T +        D + +  P+ VA +I+ +
Sbjct: 190 VDTPLWDTVQVDFDRSKMLSPEWVADLIAHI 220


>gi|227509829|ref|ZP_03939878.1| dehydrogenase [Lactobacillus brevis subsp. gravesensis ATCC 27305]
 gi|227190753|gb|EEI70820.1| dehydrogenase [Lactobacillus brevis subsp. gravesensis ATCC 27305]
          Length = 249

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 116/252 (46%), Gaps = 32/252 (12%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           L+TG+ +GIG+ TALEL + G +V+   R + + ++  + L K     D+   D+ D   
Sbjct: 8   LITGADKGIGFQTALELGKRGHHVLVGARDVGRGKEAVDRLTKSGITADLLEIDVTDRTT 67

Query: 82  LELTKTYIAKRWGKLDILIANAGI-LGSISPIWQIKEKSFADVISVNVMANWNIMRSFDP 140
           ++   + +  ++G LD+LI NAG+ L    P  ++  +   +  +VN     +++++F P
Sbjct: 68  IQAAASQVMTKFGYLDVLINNAGVALDQHQPASELSTEVMQNDFNVNFFGAVDVIQAFLP 127

Query: 141 WLKKSHCGRAIILSSG------AAYKCRPLWG----AYSASKAAIEALARTWSKETVNTA 190
            LKK+   + I +SS       A       +G     Y ASKAA+      ++KE  +T 
Sbjct: 128 LLKKADTAKIINVSSNMGSLGLATNPASQFYGINSLGYQASKAALNFATICFAKELADTT 187

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG-----KLFSV 245
           + V +++PG T T    + +    P                   Q ++TG     KL S 
Sbjct: 188 ITVNSVNPGWTATEFGGRDLKQSMP----------------TGMQSVKTGAAQIVKLASD 231

Query: 246 PQNRFVNYLTPN 257
           P+N+     T N
Sbjct: 232 PENKITMTFTEN 243


>gi|257069751|ref|YP_003156006.1| short-chain alcohol dehydrogenase-like protein [Brachybacterium
           faecium DSM 4810]
 gi|256560569|gb|ACU86416.1| dehydrogenase of unknown specificity, short-chain alcohol
           dehydrogenase like [Brachybacterium faecium DSM 4810]
          Length = 235

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 117/242 (48%), Gaps = 25/242 (10%)

Query: 19  RLALVTGSSRGIGYYTALELARSG---AYVIACGRSISQLEKLKNALQK---INKKIDIF 72
           + ALVTG+SRGIG  T      +      ++   R  S  ++    L+    + +KI   
Sbjct: 3   KTALVTGASRGIGLETVRRFIHNSEDITTIVMFARKSSDFDEAVEELRASSPVGRKIVTR 62

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+ D ++L      + +  G +DIL+ NAG    + P+ Q +   F   ++VNV A +
Sbjct: 63  YVDVGDRDSLHENLESVHEEVGNIDILVNNAGYTNPV-PLQQAEIDDFEKTMNVNVYAPF 121

Query: 133 NIMRSFDPWL-KKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            I++    WL    +  + I+ ++S A    R  W  YSASKAA+  +++   +E     
Sbjct: 122 LIVK----WLLNHGNVFKLIVNIASTAGMNGRSGWLTYSASKAAVINMSQVMREELAIYG 177

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRF 250
            RV+ + PG T T++R    P EDP+T+  P+ VA++I            + F+ P  RF
Sbjct: 178 TRVVCLSPGRTATALRRTLAPEEDPSTIMQPEHVARVI------------ETFTSPVGRF 225

Query: 251 VN 252
           ++
Sbjct: 226 ID 227


>gi|37526723|ref|NP_930067.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36786155|emb|CAE15207.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 244

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 121/247 (48%), Gaps = 15/247 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD ++ALVTG+SRGIG  TA  LA  GAY+I    S    E +   L +  K    F  +
Sbjct: 3   LDGKIALVTGASRGIGRATAELLAERGAYIIGTATSDKGAEVISAYLGEKGKG---FVLN 59

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D  ++E   + I    G LDIL+ NAGI G  + + +IK+  +  VI  N+ + + + 
Sbjct: 60  VTDPESIEQLMSTIRTEHGGLDILVNNAGITGD-NLVMRIKDDEWQHVIDTNLSSVFRMT 118

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++   ++ K   GR I + S           +Y+A+KA +   ++T ++E ++  + V  
Sbjct: 119 KAAMRFMIKKRYGRIISIGSVVGSMGNAGQASYAAAKAGLVGFSKTLAREVISRGITVNV 178

Query: 196 IDPGPTRTSMRAKAMPAED----PNTVP-----HPQKVAKIISFLCATQKIE-TGKLFSV 245
           + PG   T M  +A+P E      N +P       +++A  ++F  + +    TG+   V
Sbjct: 179 VAPGLIETDM-LRALPEEQLANFSNDIPAKRLGDVKEIASAVAFFASDEAAYITGETLHV 237

Query: 246 PQNRFVN 252
               ++N
Sbjct: 238 NGGMYMN 244


>gi|312128998|ref|YP_003996338.1| short-chain dehydrogenase/reductase sdr [Leadbetterella byssophila
           DSM 17132]
 gi|311905544|gb|ADQ15985.1| short-chain dehydrogenase/reductase SDR [Leadbetterella byssophila
           DSM 17132]
          Length = 246

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 119/232 (51%), Gaps = 17/232 (7%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVI---ACGRSISQLEKLKNALQKINKKIDIF 72
           L+N++ LVTG+SRGIG   A  LA +GA VI   A G+    ++++ +++++        
Sbjct: 4   LNNKVILVTGASRGIGAEVAQRLATAGAKVIVNYAGGKD--AVDQVVSSIKEQGGDAIAL 61

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+ +++A++         +G++D+L+ NAGI+ +   I    ++ F+    +NV   +
Sbjct: 62  QADVSNADAVKQLFDNAINHYGRIDVLVNNAGIMIT-KLIKDTTDEDFSRQFDINVKGVF 120

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           N +R     L  +  G  I  S+       P +G Y A+K+A+E L R ++KE  +  + 
Sbjct: 121 NTLREASTRL--ADNGSIINFSTSVNRLMLPTYGTYVATKSAVEQLTRVFAKEVGSRGIN 178

Query: 193 VINIDPGPTRTSM--RAKAMPAEDP-------NTVPHPQKVAKIISFLCATQ 235
           V ++ PGPT T +    K+    D        N +  PQ +AK+I FL + +
Sbjct: 179 VNSVSPGPTNTELFTNGKSQEVIDRLASFSAFNRIGEPQDIAKVIVFLASDE 230


>gi|254464125|ref|ZP_05077536.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Rhodobacterales bacterium Y4I]
 gi|206685033|gb|EDZ45515.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Rhodobacterales bacterium Y4I]
          Length = 215

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 102/199 (51%), Gaps = 5/199 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           + +++AL+TG+SRG+G   A  LA +  +++A  R+   LE+L + ++       +   D
Sbjct: 1   MTDKIALITGASRGLGSALAEALAPTH-HIVAVARTTGALEELDDRIKAAGGSATLAPMD 59

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +    A+      I  RWGKLD+ +  A    ++ P   +  K +   +++N  A   ++
Sbjct: 60  ITVPEAMATLCRGIHDRWGKLDLWLHTAIHATALCPAPSVAAKDWTKAVAINATATSVLI 119

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
               P L ++  GRA+      A +    +G Y A+KAA  ALAR+W  ET  T  +V  
Sbjct: 120 PYVAPLLGRT--GRAVFFDDPKAGE--KFYGTYGATKAAQMALARSWQAETERTGPKVHI 175

Query: 196 IDPGPTRTSMRAKAMPAED 214
           ++P P  T++RA+  P ED
Sbjct: 176 LEPQPMATALRARFHPGED 194


>gi|152998164|ref|YP_001342999.1| short-chain dehydrogenase/reductase SDR [Marinomonas sp. MWYL1]
 gi|150839088|gb|ABR73064.1| short-chain dehydrogenase/reductase SDR [Marinomonas sp. MWYL1]
          Length = 252

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 112/215 (52%), Gaps = 5/215 (2%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACG--RSISQLEKLKNALQKINKKIDIF 72
           +L N++ LVTG+SRGIG   A  LA  GA V+ C   R    L + K+A++K+ +K  +F
Sbjct: 3   DLTNKVVLVTGASRGIGRALAEGLAEHGADVVICDLPREEKGLNEAKSAIEKLGRKCWVF 62

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+ D +A+E       ++ G +D+L+ NAGIL   S +  + E  +    +VN     
Sbjct: 63  GADITDKSAVENMVAQATEQAGHIDVLVNNAGIL-KPSLLEDLSEGDWDAHFAVNGKGLL 121

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
            +  +  P +++   GR I ++S AA +  P  G Y+A+KA    L R +++ET    + 
Sbjct: 122 FVTNAVLPQMRQRKNGRIINIASIAARQGVPTQGHYAATKATAVTLTRVYAQETGMDGIT 181

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKI 227
           V  I PG   T M    + +E+   + H + VA +
Sbjct: 182 VNAICPGIILTEMGKNNLGSEE--AINHWKDVAAL 214


>gi|329927126|ref|ZP_08281471.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Paenibacillus sp. HGF5]
 gi|328938669|gb|EGG35049.1| oxidoreductase, short chain dehydrogenase/reductase family protein
           [Paenibacillus sp. HGF5]
          Length = 270

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 109/207 (52%), Gaps = 7/207 (3%)

Query: 5   ESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK 64
           E ++N    + L++++ +VTG+S GIG   A +L+  GAYV+ C RS  +L+++     +
Sbjct: 7   EERDN---EIMLNHKVVVVTGASSGIGALIAEKLSAQGAYVVLCARSADRLQEVG---AR 60

Query: 65  INKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVI 124
           ++   ++   D+++S  +      + +R G++D+LI NAG  G    I  + ++ F D++
Sbjct: 61  LSGPHELATMDVQNSEQVSSVMEAVFQRHGRIDVLINNAG-YGKFESIMDMPQEEFQDMM 119

Query: 125 SVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSK 184
            VN M      ++  P + K   G+ + ++S A         AYSA+K A+   + +  +
Sbjct: 120 DVNYMGIVRCTQAVLPGMLKQGDGQIVNIASMAGKIGTAKSTAYSATKHAVLGFSNSLRQ 179

Query: 185 ETVNTALRVINIDPGPTRTSMRAKAMP 211
           E  NT + V  ++PGP  T   + A P
Sbjct: 180 ELRNTGITVSTVNPGPIDTPFFSLADP 206


>gi|261409204|ref|YP_003245445.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp.
           Y412MC10]
 gi|261285667|gb|ACX67638.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp.
           Y412MC10]
          Length = 270

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 109/207 (52%), Gaps = 7/207 (3%)

Query: 5   ESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK 64
           E ++N    + L++++ +VTG+S GIG   A +L+  GAYV+ C RS  +L+++     +
Sbjct: 7   EERDN---EIMLNHKVVVVTGASSGIGALIAEKLSAQGAYVVLCARSADRLQEVG---AR 60

Query: 65  INKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVI 124
           ++   ++   D+++S+ +      +  R G++D+LI NAG  G    I  + ++ F D++
Sbjct: 61  LSGPHELATMDVQNSDQVSSVMEAVFHRHGRIDVLINNAG-YGKFESIMDMPQEEFQDMM 119

Query: 125 SVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSK 184
            VN M      ++  P + K   G+ + ++S A         AYSA+K A+   + +  +
Sbjct: 120 DVNYMGIVRCTQAVLPGMLKQGDGQIVNIASMAGKIGTAKSTAYSATKHAVLGFSNSLRQ 179

Query: 185 ETVNTALRVINIDPGPTRTSMRAKAMP 211
           E  NT + V  ++PGP  T   + A P
Sbjct: 180 ELRNTGITVSTVNPGPIDTPFFSLADP 206


>gi|319793036|ref|YP_004154676.1| short-chain dehydrogenase/reductase sdr [Variovorax paradoxus EPS]
 gi|315595499|gb|ADU36565.1| short-chain dehydrogenase/reductase SDR [Variovorax paradoxus EPS]
          Length = 251

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 118/238 (49%), Gaps = 26/238 (10%)

Query: 13  HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIF 72
            + L++++ALVTG + GIG  TA      GA+V   GR  ++L+    A++ I + +   
Sbjct: 3   QLKLNDKIALVTGGTSGIGLATAQRFVAEGAHVFITGRRQAELDA---AVKTIGRNVTGV 59

Query: 73  AFDLRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
             D+  S   +L K Y  I ++ G+LD+L ANAG  GS+ P+ QI E+ F      NV  
Sbjct: 60  LGDV--SKLADLDKLYATIKEQKGRLDVLFANAG-GGSLLPLGQITEEHFDKTFGTNVRG 116

Query: 131 NWNIMRSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
               ++   P + K   G +I+L +S  + K  P +  YSA+KAA+ + AR W+ +  + 
Sbjct: 117 LLFTVQKALPLMAK---GSSIVLNASITSIKGNPAFSVYSATKAAVRSFARGWAVDLKDA 173

Query: 190 ALRVINIDPG--PT-------RTSMRAKAMPAEDPNTVP-----HPQKVAKIISFLCA 233
            +RV  + PG  PT        T  + K         +P      P ++AK + FL +
Sbjct: 174 GIRVNAVSPGVVPTPAYELLGLTPEQVKGFIEGQAQNIPLGRVGTPDEIAKAVVFLAS 231


>gi|111026295|ref|YP_708578.1| carveol dehydrogenase [Rhodococcus jostii RHA1]
 gi|110825138|gb|ABH00420.1| carveol dehydrogenase [Rhodococcus jostii RHA1]
          Length = 289

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 99/199 (49%), Gaps = 12/199 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACG-----------RSISQLEKLKNALQK 64
           +D ++ALVTG++RG+G   A+ LA  GA ++A              S   L+     ++ 
Sbjct: 4   MDGKVALVTGAARGMGRAHAIRLAEEGANILAIDCPPDTGLPYPTGSSDDLQITVKEVEA 63

Query: 65  INKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVI 124
           + ++I     D+R  ++L+       K +G LD+ +ANAGI  ++ P   I E  F  V+
Sbjct: 64  LGRRIIAHEGDVRKQSSLDKLVADGVKAFGGLDVAVANAGIW-TVHPFHDIPEDEFTAVL 122

Query: 125 SVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSK 184
            VN+   W  +++  P + +   G  I+ SSG   +  P +  Y ASK  +  LA++ + 
Sbjct: 123 DVNITGVWRTLKAVSPAITERGGGSIIVTSSGNGVEGSPHYAHYVASKHGVIGLAKSAAL 182

Query: 185 ETVNTALRVINIDPGPTRT 203
           E     +RV  + PGPT T
Sbjct: 183 EFGQYGIRVNILLPGPTDT 201


>gi|115358591|ref|YP_775729.1| short-chain dehydrogenase/reductase SDR [Burkholderia ambifaria
           AMMD]
 gi|115283879|gb|ABI89395.1| short-chain dehydrogenase/reductase SDR [Burkholderia ambifaria
           AMMD]
          Length = 249

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/193 (32%), Positives = 100/193 (51%), Gaps = 6/193 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++A+VTG++ GIG+  A      GA V+  GR  S +E+   A+ ++ +       D
Sbjct: 4   LAGKVAVVTGANSGIGFAIASRFTEEGASVVIVGRRASAVEE---AVARLGENATGVTGD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L D    E   + +A+R+GK DI +ANAG +  I+P  Q+  + +    + N  A +  +
Sbjct: 61  LSDLTTHERVASLVAERFGKADIYVANAG-MNVITPSDQVSVEEYDRQFATNTRAAFFGV 119

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P L  +  G  +++SS A+ K       Y+ SKAA+EA AR W+ E     +RV  
Sbjct: 120 QKIAPLLNNN--GSIVLISSIASSKVLDGHAVYAGSKAALEAFARNWALEFKERRIRVNV 177

Query: 196 IDPGPTRTSMRAK 208
           I PGPT T +  K
Sbjct: 178 ISPGPTDTPILGK 190


>gi|281423146|ref|ZP_06254059.1| NADP-dependent L-serine/L-allo-threonine dehydrogenase YdfG
           [Prevotella oris F0302]
 gi|281402482|gb|EFB33313.1| NADP-dependent L-serine/L-allo-threonine dehydrogenase YdfG
           [Prevotella oris F0302]
          Length = 253

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 93/190 (48%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           ++ ++AL+TG++ GIG   A   A  G  +I  GR+  +L ++   LQK    +   AFD
Sbjct: 1   MEKKIALITGATSGIGAACARRFAHEGYDLILAGRNQEKLHEISLQLQKEGTDVLTLAFD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D  A     + +  RW ++D+LI NAG+   +   ++     +  +I  N+     + 
Sbjct: 61  ITDREAAMQAVSQLNDRWSQIDVLINNAGLALGLEKEYEGNMDEWDTMIDTNIKGLLTMT 120

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R F P + +  CG  I + S A          Y A+KAA++AL+     +  +T +RV N
Sbjct: 121 RLFVPKMIERQCGHVINIGSVAGDAAYAGGNVYCATKAAVKALSDGLRIDVAHTPIRVTN 180

Query: 196 IDPGPTRTSM 205
           I PG   T+ 
Sbjct: 181 IKPGLVETNF 190


>gi|30795086|ref|NP_851536.1| glucose dehydrogenase [Streptomyces rochei]
 gi|30698459|dbj|BAC76572.1| probable glucose dehydrogenase [Streptomyces rochei]
          Length = 249

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 98/204 (48%), Gaps = 8/204 (3%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            LD + A+VTG + GIG  +A   A  GA+V   GR   + E L  AL +I         
Sbjct: 3   QLDGKTAVVTGGNSGIGLASAKRFAAEGAHVFITGR---RQEALDAALAEIGPNATAVRS 59

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ D   ++     +A +  ++D+L ANAG  G  S + Q+ E+ F      NV      
Sbjct: 60  DISDPADIDRLYAAVADQGRRVDVLFANAG-GGEFSTLEQVTEQHFDTTFDTNVRGTLFT 118

Query: 135 MRSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++   P L     G ++IL+ S AA      +G Y+ASKAAI + +RTW+ E  +  +RV
Sbjct: 119 VQKALPLLND---GASVILTGSTAATSGGEAFGVYAASKAAIRSFSRTWANELRHREIRV 175

Query: 194 INIDPGPTRTSMRAKAMPAEDPNT 217
             + PGP  T   A   P  D  T
Sbjct: 176 NTLVPGPIETPGNAGLAPDADEAT 199


>gi|145595321|ref|YP_001159618.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Salinispora tropica
           CNB-440]
 gi|145304658|gb|ABP55240.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Salinispora tropica
           CNB-440]
          Length = 246

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 113/235 (48%), Gaps = 11/235 (4%)

Query: 21  ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLE-KLKNALQKINKKIDIFAFDLRDS 79
           ALVTG SRGIG   AL LA  G  V  C  S S+   K +  +      +   A D+ D 
Sbjct: 7   ALVTGVSRGIGRAIALRLAAQGYAVAGCYSSDSEAAAKTQAEVAAFGVPVYTAACDVADP 66

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
            A++       +R G ++ L+ NAGI    SP+    E+ +  V+S N+   WN+ R+  
Sbjct: 67  AAVDEFVGAAEERVGPINCLVNNAGITRD-SPLVLATEQDWQAVLSTNLTGTWNLCRAMT 125

Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199
               K   G  + +SS A         AY+ASKA I  L+R+ +KE     +RV  + PG
Sbjct: 126 FRFMKRRAGAVVNMSSVAGVYGNAGQTAYAASKAGIVGLSRSLAKEVAGYGVRVNVVAPG 185

Query: 200 PTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCATQK-IETGKLFSV 245
              T M        R +A+     +    P++VA++++FLC+ +    TG++F V
Sbjct: 186 FIETDMTDALAGKLRDQALSQIPLSRFGRPEEVAELVAFLCSDRAGYITGQVFQV 240


>gi|254510162|ref|ZP_05122229.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Rhodobacteraceae bacterium KLH11]
 gi|221533873|gb|EEE36861.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Rhodobacteraceae bacterium KLH11]
          Length = 214

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 98/197 (49%), Gaps = 5/197 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
            ++ALVTG+SRG+G   A  L     +++A  R+   LE+L + +Q       +   D+ 
Sbjct: 5   TKIALVTGASRGLGAALAEALVPD-YHIVAVARTTGGLEELDDRIQAKGGSATLAPMDIS 63

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D NA+      I  RWGK+D+ +  A    +++P   +  K +    ++N  A   ++  
Sbjct: 64  DPNAMATLCRGIHDRWGKVDLWLHTAIHTSALTPAHFVDPKEWTKSTTINATATSVLIPY 123

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L ++  G A+      A      +G Y A+KAA  ALAR+W+ ET  T  R+  + 
Sbjct: 124 VAPLLGEA--GHAVFFDDPKA--GEKFYGIYGATKAAQMALARSWAAETARTGPRISIVA 179

Query: 198 PGPTRTSMRAKAMPAED 214
           P P  T++RA+  P ED
Sbjct: 180 PAPMPTAVRARFHPGED 196


>gi|94314209|ref|YP_587418.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Cupriavidus
           metallidurans CH34]
 gi|93358061|gb|ABF12149.1| 3-oxoacyl-(acyl-carrier-protein) reductase (3-ketoacyl- acyl
           carrier protein reductase) [Cupriavidus metallidurans
           CH34]
          Length = 274

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 119/242 (49%), Gaps = 13/242 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           + + + L+TG++ GIG  TAL  A  GA ++  GR+ +  + L + L+++  + D  A D
Sbjct: 27  MSHPVVLITGATAGIGRATALAFAAKGARLVCSGRNAAAGDALISELREMGAEADFLAAD 86

Query: 76  L-RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           + R+ + + L  ++  +R+G LDI + +AG  G+   I +   +S+A     NV+  +  
Sbjct: 87  VSREDDVMRLV-SHAVERFGCLDIAVNSAGTEGTPGSIVEQTVQSYATTFDANVLGTFLC 145

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           M+     +     G  + LSS    +  P    Y ASK AIE L ++ + + +   +RV 
Sbjct: 146 MKHELKAMIGQQRGVVVNLSSTMGSRGNPRNPMYVASKHAIEGLTKSAALDVIQANVRVN 205

Query: 195 NIDPGPTRTSMRAKAMPAED-----PNTVPH-----PQKVAKIISFLCATQKIE-TGKLF 243
            + PGP  T+M  +     D       T+P      P++VA  I FL + Q    TG++ 
Sbjct: 206 AVAPGPIETAMLGRIAGGADRLASVAATIPAGRVGTPEEVADAILFLASDQSTYITGQIL 265

Query: 244 SV 245
            V
Sbjct: 266 HV 267


>gi|325102910|ref|YP_004272564.1| short-chain dehydrogenase/reductase SDR [Pedobacter saltans DSM
           12145]
 gi|324971758|gb|ADY50742.1| short-chain dehydrogenase/reductase SDR [Pedobacter saltans DSM
           12145]
          Length = 244

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 98/196 (50%), Gaps = 9/196 (4%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIF--AFDLRDS 79
           ++TG+S G+G+  A+ELA  G  VIA  RS  +L  L   +  +N +   F   FD+ + 
Sbjct: 16  IITGASSGVGFEAAIELAIKGHEVIALARSQEKLTNLHQIVYSLNPEAKFFPIVFDIVND 75

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
               L + +I +RWGK +ILI NAG L S  P  +  E    ++   NV+ ++ I +   
Sbjct: 76  EYAGLVQ-FIQQRWGKFNILINNAGSLIS-KPFKETTEFDMIEMFQSNVLGHFRITQELL 133

Query: 140 PWLKKSHCGRAIILSSGAAYKCR---PLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
           P+++K   G  + + S   Y      P   AYSASKAA+       ++E  +  ++V  +
Sbjct: 134 PFIEKQ--GHILNIGSMGGYMGSAKFPGLIAYSASKAALHNFTECLAQELTDEGIKVNCL 191

Query: 197 DPGPTRTSMRAKAMPA 212
             G  +T M  KA P 
Sbjct: 192 ALGSAQTEMLEKAFPG 207


>gi|311747240|ref|ZP_07721025.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Algoriphagus sp. PR1]
 gi|126578951|gb|EAZ83115.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Algoriphagus sp. PR1]
          Length = 255

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 102/190 (53%), Gaps = 2/190 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +LD ++AL+TG+SRGIG   A   A +GA V+   R    L+K  N L     +    A 
Sbjct: 8   SLDGKVALITGASRGIGLSIAEFFAAAGAKVVLSSRKQEALDKEANRLNSKGYEATGIAC 67

Query: 75  DLRDSNAL-ELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           ++ + + L EL K  + + +G+LDIL+ NAG      PI +   ++F  ++ VNV A + 
Sbjct: 68  NVGNVDELSELVKKTV-EIYGQLDILVNNAGTNPVFGPIHETSLEAFDKIMDVNVKAAFA 126

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           +     P L+KS  G  I +SS       P  G YS SKAA+ +L + ++KE  ++ +RV
Sbjct: 127 LCNLCFPHLRKSSSGSVINISSIGGISPEPGLGVYSISKAALISLTKVFAKEWGDSKIRV 186

Query: 194 INIDPGPTRT 203
             I PG  +T
Sbjct: 187 NAICPGLIKT 196


>gi|90417910|ref|ZP_01225822.1| possible short-chain dehydrogenase/reductase SDR [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337582|gb|EAS51233.1| possible short-chain dehydrogenase/reductase SDR [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 248

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 118/248 (47%), Gaps = 14/248 (5%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++LD R A++TG +RGIGY TA  +  SG  V+      + ++K   A+  +  +    A
Sbjct: 4   IDLDGRTAIITGGARGIGYATAERILESGGSVVLWDIDGAAVDK---AVADLGARASGTA 60

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            +L D  A+           GK+DIL+ NAGI G     W +    +   I VN++A + 
Sbjct: 61  VELTDEAAVAAATRQAMDAAGKIDILVNNAGITGGNGKTWDLAPDVWRKTIEVNLIAPYI 120

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
             R+  P + ++  GR I ++S A  +  P    YSASKA +  L ++  KE   T + V
Sbjct: 121 TSRAIVPLMMEAGYGRIINVASIAGKEGNPNASHYSASKAGLIGLTKSLGKELAGTGVLV 180

Query: 194 INIDPGPTRTSMRAKAMPAEDPN----TVP-----HPQKVAKIISFLCATQ-KIETGKLF 243
             I P   RTS+  + M  E  +     +P      P +VA +I++L +      TG +F
Sbjct: 181 NCITPAAARTSIFDQ-MSQEHIDFMLSKIPLQRFLEPAEVAAMIAWLASEDCSFTTGAVF 239

Query: 244 SVPQNRFV 251
            +   R V
Sbjct: 240 DISGGRAV 247


>gi|86357392|ref|YP_469284.1| oxidoreductase protein [Rhizobium etli CFN 42]
 gi|86281494|gb|ABC90557.1| probable oxidoreductase protein [Rhizobium etli CFN 42]
          Length = 258

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 101/200 (50%), Gaps = 8/200 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L N++AL+TG + GIG  TA      GA V+  GR     E L  A + +   +     D
Sbjct: 3   LRNKVALITGGNSGIGLATAKVFIDEGARVVITGR---NPETLAAAEKALGAGVLALKVD 59

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D+ A E      A ++GK +I+ ANAGI G  +P+     + F  +IS N+ A +  +
Sbjct: 60  VTDAAATEGAFADAAAKFGKFNIVFANAGI-GGATPLGDTSPEQFNQIISTNLTAVFFTV 118

Query: 136 RSFDPWLKKSHCGRAIILSSGA-AYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +S  P L     G ++IL+    A    P W AY+A+KAA+ A+ R  + E     +RV 
Sbjct: 119 QSALPHLVD---GSSVILNGSVHAVLGAPGWSAYAATKAAVRAMTRNMASELAPRGIRVN 175

Query: 195 NIDPGPTRTSMRAKAMPAED 214
            + PG T+T + +   P +D
Sbjct: 176 QVTPGGTKTPIWSPMAPTQD 195


>gi|299137969|ref|ZP_07031149.1| short-chain dehydrogenase/reductase SDR [Acidobacterium sp.
           MP5ACTX8]
 gi|298599899|gb|EFI56057.1| short-chain dehydrogenase/reductase SDR [Acidobacterium sp.
           MP5ACTX8]
          Length = 258

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 101/194 (52%), Gaps = 3/194 (1%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           ++L N++ L+TG+S GIG  TA+E A+ GA ++ C R    L  ++ +L        +F+
Sbjct: 3   ISLKNKVVLITGASAGIGAATAMEFAKLGARLLLCARRRDLLHTMEPSLLAAGAA-SVFS 61

Query: 74  F--DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
           F  D++  NA+E+    +   W ++DIL+ NAG+   ++ +++   +++ ++I  NV   
Sbjct: 62  FELDVQSRNAVEMAFQTLPDSWSEIDILVNNAGLSRGLNKLYEDDIQNWEEMIDTNVKGL 121

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             + R   P + +   G  I L S A +   P  G Y A+KAA   ++     +   T +
Sbjct: 122 LYVTRIVVPGMVQRGSGHVINLGSIAGHMAYPNGGVYCATKAAERFISDGLRLDLNGTPV 181

Query: 192 RVINIDPGPTRTSM 205
           RV +IDPG   T  
Sbjct: 182 RVTSIDPGMVETDF 195


>gi|297163210|gb|ADI12922.1| short-chain dehydrogenase/reductase SDR [Streptomyces
           bingchenggensis BCW-1]
          Length = 246

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 112/234 (47%), Gaps = 23/234 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ + ALVTG S GIG  +A+ LA  GA+V   GR  ++L+    A++ I         D
Sbjct: 4   LEGKTALVTGGSTGIGLASAVRLAAEGAHVFITGRRKTELDA---AVEVIGSAATAVTGD 60

Query: 76  LRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           +  SN  +L + Y  I  +   LDIL ANA +  S+ P+ Q+ E+ F  +  +NV     
Sbjct: 61  I--SNLADLDRLYETIRSQERGLDILFANASV-ASLVPLAQVTEEHFDTLFGINVRGTLF 117

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKC-RPLWGAYSASKAAIEALARTWSKETVNTALR 192
            ++   P L     G ++IL+            G Y+A+KAA  + +RTW+ E     +R
Sbjct: 118 TVQKALPLLND---GASVILNGSTNVDVGDQALGVYAATKAATRSFSRTWANELKGRGIR 174

Query: 193 VINIDPGPTRTSMRAKAMPAED------PNTVP-----HPQKVAKIISFLCATQ 235
           V  I PGPT T   +   PA +         VP      P ++A  ++FL + Q
Sbjct: 175 VNTITPGPTDTPALSGLTPAPERFKQQLATRVPLGRLGRPAEIAAAVTFLASEQ 228


>gi|325261457|ref|ZP_08128195.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Clostridium sp. D5]
 gi|324032911|gb|EGB94188.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Clostridium sp. D5]
          Length = 257

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 114/230 (49%), Gaps = 20/230 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVI-----ACGRSISQLEKLKNALQKINKKID 70
           L+ ++A+VTG+SRGIG   AL+LA  GA V+     + GR+     ++K  ++K   + +
Sbjct: 13  LEGKVAVVTGASRGIGRAVALKLASQGAVVVINYNGSAGRA----AEVKEEIEKTGGQAE 68

Query: 71  IFAFDLRDSNALE-LTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
               D+ D  A E   K  IAK +G+LDIL+ NAGI      + ++ E+ F  V+  N+ 
Sbjct: 69  TMQCDVSDFGACENFIKEVIAK-FGRLDILVNNAGIT-RDGLLIRMSEEDFDAVLDTNLK 126

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
             +N +R     + K   GR I LSS +          YSASKA +  L +  ++E  + 
Sbjct: 127 GTFNCIRFASRQMMKQRSGRIINLSSVSGVMGNAGQANYSASKAGMIGLTKAAARELASR 186

Query: 190 ALRVINIDPGPTRTSMRA-------KAMPAEDP-NTVPHPQKVAKIISFL 231
            + V  + PG   T M A       +   A+ P  +   P+ +A+ + FL
Sbjct: 187 GVTVNAVAPGFINTEMTAELSEKVKEGAAAQIPLGSFGEPEDIAEAVGFL 236


>gi|304312395|ref|YP_003811993.1| short chain dehydrogenase [gamma proteobacterium HdN1]
 gi|301798128|emb|CBL46350.1| short chain dehydrogenase [gamma proteobacterium HdN1]
          Length = 661

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 117/229 (51%), Gaps = 4/229 (1%)

Query: 2   IDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNA 61
           +D E+  +  +   +  ++ +VTG S GIG  TA  LA +G  VI   R++ +L++  +A
Sbjct: 361 LDPENFIDRTLEGCVKGKVVIVTGGSSGIGLATAKRLAEAGGKVILAARTVEKLQEAHDA 420

Query: 62  LQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAG--ILGSISPIWQIKEKS 119
           ++    +  ++  D+ D +  +     + K +G++DIL+ NAG  I  SIS  +  +   
Sbjct: 421 IRASGGEAFMYTVDIADVDDCDRFSQQVLKDFGQVDILVNNAGRSIRRSISLSYD-RFHD 479

Query: 120 FADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALA 179
           +   + +N      +M +F P ++K H G+ I +SS       P + AY ASKAA++A +
Sbjct: 480 YTRTMQLNYFGALRLMMNFLPEMEKRHSGQIINISSIGVLTNAPRFSAYVASKAALDAFS 539

Query: 180 RTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKII 228
           R  + E  +  ++   I+    RT M A     E+  T+  P++ A +I
Sbjct: 540 RCAASEYSDVGVKFTTINMPLVRTPMIAPTKIYENVPTIS-PEEAADMI 587


>gi|168206276|ref|ZP_02632281.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens E
           str. JGS1987]
 gi|169343858|ref|ZP_02864855.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens C
           str. JGS1495]
 gi|169297978|gb|EDS80069.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens C
           str. JGS1495]
 gi|170662301|gb|EDT14984.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens E
           str. JGS1987]
          Length = 253

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 108/228 (47%), Gaps = 11/228 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF- 74
           + N++ +VTG +RGIG+ T  +    GA V  CG     ++K    L  IN   D   F 
Sbjct: 8   IKNKVVIVTGGTRGIGFATVKKFLDHGAKVALCGSRKETVDKALEELNHINPNYDAIGFY 67

Query: 75  -DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            +L DSN ++     + ++WG +DILI NAG+  + S I+   ++ F+ +I +NV A +N
Sbjct: 68  PNLLDSNEVKEMVDKVLEKWGTIDILINNAGVSDNKS-IYTQSDEDFSKIIDINVKAIFN 126

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
             ++    +K    G  +  SS  +   +     Y  SK A+  L ++ ++E     +RV
Sbjct: 127 CTKAVSEIMKNKKYGVILNTSSVVSLYGQKTGVGYPTSKFAVNGLTKSLARELGKDGIRV 186

Query: 194 INIDPGPTRTSMRA---KAMPAEDPNTVP-----HPQKVAKIISFLCA 233
             + PG   T M A   K +  +    VP      P+ +A    FL +
Sbjct: 187 NAVAPGIIATDMVAALDKKLVEQIAQNVPLGRVGEPEDIANAFLFLAS 234


>gi|284029673|ref|YP_003379604.1| short-chain dehydrogenase/reductase SDR [Kribbella flavida DSM
           17836]
 gi|283808966|gb|ADB30805.1| short-chain dehydrogenase/reductase SDR [Kribbella flavida DSM
           17836]
          Length = 264

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 104/194 (53%), Gaps = 7/194 (3%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           + ++L  R ALV+GSS+GIG   A ELAR+GA V+  GR   + E+   A+ +     ++
Sbjct: 1   MRIDLTGRRALVSGSSQGIGQAIATELARAGASVVVNGRDQDRTERAAEAIAREVPSAEL 60

Query: 72  F--AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
              A DL  ++  E  +    +R G+LDIL+ N GI G+  P+ +I++  +     VNV+
Sbjct: 61  LPVAADLASADGAEALR----ERAGELDILVNNLGIFGA-KPVLEIEDDEWRRYFEVNVL 115

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           +   ++R + P + +   GR + ++S +A         Y  +K A+ A+ R ++K    T
Sbjct: 116 SAVRLIRMYLPGMTERGFGRVMNIASDSAVVTPLEMVHYGVTKTALLAVTRGFAKAAAGT 175

Query: 190 ALRVINIDPGPTRT 203
            + V ++  GPT T
Sbjct: 176 GVTVNSVMAGPTHT 189


>gi|126438245|ref|YP_001073936.1| short-chain dehydrogenase/reductase SDR [Mycobacterium sp. JLS]
 gi|126238045|gb|ABO01446.1| short-chain dehydrogenase/reductase SDR [Mycobacterium sp. JLS]
          Length = 239

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 110/230 (47%), Gaps = 21/230 (9%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           + LD ++ALVTG + GIG  +A  LA  GA V+  GR     E+   A+ +I   +    
Sbjct: 1   MELDKQIALVTGGTSGIGLASARLLAAEGAEVVVSGR---DAERGAQAVAEIGGAVRFVQ 57

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ D  +++     +A++ G +DIL+ NAG+    +P       SF  +   NV   + 
Sbjct: 58  ADMSDPQSVK----DLAEQAGDVDILVNNAGVF-PAAPTLDQDLASFETMFDTNVRGAYF 112

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++      +     G  + ++S A  K  P   AY A+KAA+ +L RTW+ E     +RV
Sbjct: 113 LVAEVARGMVARGRGAIVNITSPAGDKGFPGTSAYGATKAALASLTRTWAAEFGANGVRV 172

Query: 194 INIDPGPTRTSMRAK----------AMPAEDPNTVPHPQKVAKIISFLCA 233
            ++ PGPTRT   A           A+P         P++VA+ + FL +
Sbjct: 173 NSVSPGPTRTPGTADMGDFIDDVAGALPL---GRTARPEEVAQAVLFLTS 219


>gi|86360875|ref|YP_472762.1| 3-oxoacyl-[acyl-carrier-protein] reductase protein [Rhizobium etli
           CFN 42]
 gi|86284977|gb|ABC94035.1| probable 3-oxoacyl-[acyl-carrier-protein] reductase protein
           [Rhizobium etli CFN 42]
          Length = 246

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 107/228 (46%), Gaps = 13/228 (5%)

Query: 18  NRLALVTGSSRGIGYYTALELARSG-AYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
            R+A+VTG+S+GIG   AL LA+ G A V+    S+   + +   ++    K      D+
Sbjct: 6   QRVAIVTGASKGIGRAIALRLAQDGVAVVVNYASSLQAADAVVADIELAGGKALAVQVDI 65

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
               A     T   +R+G  DIL+ NAGI+  ++PI    + SF   I++N+   +  +R
Sbjct: 66  SGPAAAADLFTAAEERFGGTDILVNNAGII-KLAPIADSDDASFEQQIAINLTGTFRAVR 124

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
                L+    GR I  SS       P +G Y+ASKAA+EA+    SKE     + V  +
Sbjct: 125 EAARRLRDG--GRIINFSSSVVGAYGPSYGVYAASKAAVEAITHVASKELGRRGITVNAV 182

Query: 197 DPGPTRTSMRAKAMPAE----DPNTVP-----HPQKVAKIISFLCATQ 235
            PGP  T +     P E       T+P      P  +A ++SFL   +
Sbjct: 183 APGPVETELFMSGKPDELVQRIVGTIPLGRLGQPDDIASVVSFLAGPE 230


>gi|310779010|ref|YP_003967343.1| short-chain dehydrogenase/reductase SDR [Ilyobacter polytropus DSM
           2926]
 gi|309748333|gb|ADO82995.1| short-chain dehydrogenase/reductase SDR [Ilyobacter polytropus DSM
           2926]
          Length = 258

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 102/189 (53%), Gaps = 2/189 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQK-INKKIDIFAFDLR 77
           ++  +TG++ GIG  TA+  A+ GA +I  GR+I  L+++K  L +  + K+ +  FD+R
Sbjct: 7   KMVFITGATSGIGRATAMAYAKMGANLILAGRNIEILKEIKAKLHEWYDIKVYVLKFDVR 66

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D   ++     + + + K+DILI NAG+   ++ I +    SF  ++  NV     I R 
Sbjct: 67  DLEKIKDEVNNLPEEFKKIDILINNAGLALGLNKIHESSFDSFDTIMDTNVKGLLYITRI 126

Query: 138 FDPW-LKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
             P+ L+ S  G  + ++S AA       G Y ASKAA++ L+     + V+T +RV  I
Sbjct: 127 VVPYMLEHSPEGHIVNIASTAAQAAYSGGGVYCASKAAVKMLSDGMRIDLVDTPVRVTTI 186

Query: 197 DPGPTRTSM 205
           +PG   T+ 
Sbjct: 187 NPGMVETNF 195


>gi|170054906|ref|XP_001863343.1| 3-hydroxybutyrate dehydrogenase type 2 [Culex quinquefasciatus]
 gi|167875030|gb|EDS38413.1| 3-hydroxybutyrate dehydrogenase type 2 [Culex quinquefasciatus]
          Length = 256

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 121/240 (50%), Gaps = 27/240 (11%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           +N D ++ L+TG+S GIG  TA  LA+ GA ++  GR++  L K+  A + +N K  +  
Sbjct: 1   MNFDGKVVLITGASSGIGEGTAKYLAKLGANLVLTGRNVDNLNKVGAACESVNNKKPLLL 60

Query: 74  FDLRDSNALELTKTYIAK---RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
             + D   +E  K  I +   ++GKLD+L+ NAGI+G+ S I     + + ++++ NV A
Sbjct: 61  --VADVTKVEDNKKVIEEIISKYGKLDVLVNNAGIIGNGS-IEDTSLEQYDEIMNTNVRA 117

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            +++     P L +S  G  + LSS A  +  P   AY  SKAAI+   +  + E     
Sbjct: 118 VYHLTMLAVPHLVQSK-GNIVNLSSVAGNRSFPGILAYGMSKAAIDQFTKCTALELAPKQ 176

Query: 191 LRVINIDPGPTRTSMRAKAMPAED-----------------PNTVPHPQKVAKIISFLCA 233
           +RV  ++PG   T +  +   +E+                 P T   P++VA  I+FL +
Sbjct: 177 VRVNAVNPGVIVTDIHKRGGMSEETYAAFLEKCKQTHALGRPGT---PEEVAATIAFLAS 233


>gi|146311692|ref|YP_001176766.1| short-chain dehydrogenase/reductase SDR [Enterobacter sp. 638]
 gi|145318568|gb|ABP60715.1| short-chain dehydrogenase/reductase SDR [Enterobacter sp. 638]
          Length = 249

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 108/232 (46%), Gaps = 21/232 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++ALVTG S GIG  T  ELA  GA V   GR   + ++L +A+  +         D
Sbjct: 5   LSGKIALVTGGSTGIGLATVQELAAQGAKVYLTGR---RQQELDDAVALVGASATGIQAD 61

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
               + L+     IA+  G+LDIL ANAG  G + P+  I E+ F  +   NV      +
Sbjct: 62  ASRLDDLDKVYAQIAEESGRLDILFANAGG-GDMLPLGAITEEHFDRIFGTNVRGVLFTV 120

Query: 136 RSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P L     G +IIL+ S  + K    +  YSASKAA+   AR+W+ +     +RV 
Sbjct: 121 QKALPLLS---AGSSIILTASTVSVKGTANFSVYSASKAAVRNFARSWALDLQGRGIRVN 177

Query: 195 NIDPGPTRTSMRAKAMPAEDPN--------TVP-----HPQKVAKIISFLCA 233
            + PGP +T      +P E            VP      P +V K ++FL +
Sbjct: 178 VVSPGPVKTPGLGGLVPEEQRQGLYDGLAAQVPLGRIGEPAEVGKAVAFLAS 229


>gi|310639985|ref|YP_003944743.1| oxidoreductase ykvo [Paenibacillus polymyxa SC2]
 gi|309244935|gb|ADO54502.1| Uncharacterized oxidoreductase ykvO [Paenibacillus polymyxa SC2]
          Length = 248

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 95/189 (50%), Gaps = 7/189 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
            D ++A+VTG + GIG  +A +  + GAYV   GR   +L++   A+++I K +     D
Sbjct: 4   FDGKVAVVTGGTSGIGLASAQQFVKEGAYVFITGRRQRELDE---AVKQIGKNVTGVRGD 60

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN-WNI 134
           +  S  L++    + +  G LDIL ANAG LGS  P+ +I E  +     VNV    + +
Sbjct: 61  ISKSEDLDILFETVKREKGHLDILFANAG-LGSFLPLGEITEAQYYKTFDVNVKGTIFTV 119

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            ++   +  K   G  I+  S A     P +  Y ASKAAI  L R+W  +   T +R+ 
Sbjct: 120 QKALALFPNKR--GSIILTGSTAGSTGMPAFSIYGASKAAIRQLVRSWILDMRGTEIRIN 177

Query: 195 NIDPGPTRT 203
            + PG   T
Sbjct: 178 ILSPGTIVT 186


>gi|91782302|ref|YP_557508.1| putative short-chain dehydrogenase [Burkholderia xenovorans LB400]
 gi|91686256|gb|ABE29456.1| Putative short-chain dehydrogenase [Burkholderia xenovorans LB400]
          Length = 256

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 113/227 (49%), Gaps = 8/227 (3%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
            + R+ALVTG+ RGIG   A EL   GA V      ++  E +  AL    +    FA D
Sbjct: 13  FEGRVALVTGAGRGIGAAIARELHVGGARVAVTDLDVASAEAVAKALDTHGETAFAFALD 72

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +R+          +  RWGKLDI++ NAG     +P+ +I  + F +++++N+ + +   
Sbjct: 73  VREKRDFGHALDAVLGRWGKLDIVVNNAG-YAKRTPLDEITPEEFDEIVNINMRSVFLSC 131

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA-YSASKAAIEALARTWSKETVNTALRVI 194
           ++F   +K +  GR + ++S A++    +  A YSA+K     L R ++++   T + V 
Sbjct: 132 QTFSKHMKSAGYGRIVNVTSLASHNGGTVASAHYSAAKGGAMTLTRYFARQLAGTGVTVN 191

Query: 195 NIDPGPTRTSM-RAKAMPAEDPNTVP-----HPQKVAKIISFLCATQ 235
            + PGP  ++  R   +  E    VP      P+++A  ++ L + +
Sbjct: 192 AVSPGPVSSAKERLAHLRDEISKQVPVGRFAEPEEIAAAVALLASER 238


>gi|114571201|ref|YP_757881.1| short-chain dehydrogenase/reductase SDR [Maricaulis maris MCS10]
 gi|114341663|gb|ABI66943.1| short-chain dehydrogenase/reductase SDR [Maricaulis maris MCS10]
          Length = 276

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 99/193 (51%), Gaps = 5/193 (2%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  + A++TG++ GIG  +A+  A++GA V+AC R  + +EK    +     K   F  
Sbjct: 5   SLAGKTAIITGAASGIGRASAILFAQAGASVLACDRD-AAVEKTAETIAAGGGKAHAFTM 63

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D      ++         +G+LDI  ANAGI G +   ++   +++ADV+ VN++  +  
Sbjct: 64  DAGSEADVKAAVAEAVAAFGRLDIAFANAGITGGLPEFFETTAETWADVLRVNLIGPFLA 123

Query: 135 MRSFDPWLKKSHCGRAIILSS--GAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           ++   P + KS  G  I  +S  G  Y   P+  AYSASKA +  L +   +  V T +R
Sbjct: 124 IKHAAPEIMKSSGGSIICTASVAGLRYGAGPV--AYSASKAGVINLVQNACQSLVGTNVR 181

Query: 193 VINIDPGPTRTSM 205
           V  I PG T T M
Sbjct: 182 VNAICPGLTETGM 194


>gi|227540571|ref|ZP_03970620.1| possible serine 3-dehydrogenase [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227239653|gb|EEI89668.1| possible serine 3-dehydrogenase [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 254

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 97/189 (51%), Gaps = 2/189 (1%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL--QKINKKIDIFAFDL 76
           ++A +TG+S GIG   A  LA+ G  ++ C R I +LE+LK  +  Q  +  I IF  D+
Sbjct: 3   KIAFITGASSGIGAACAEVLAKEGYNLLLCARRIERLEELKQHISAQYPDCNIYIFKLDV 62

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
           R++  ++L+   + + W  +D+LI NAG+   + PI       +  +I  N+     + R
Sbjct: 63  RNAEEVQLSVNNLPEEWKNIDVLINNAGLSQGLDPIQNGDIGDWDRMIDTNIKGLLYVTR 122

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
           +  P+++    G  + L S A  +  P    Y A+K A++AL +    + ++  ++V  I
Sbjct: 123 TVVPFMEARKKGHIVNLGSIAGKEVYPNGNVYCATKHAVDALNKAMRIDLLSKGIKVTGI 182

Query: 197 DPGPTRTSM 205
           +PG   T  
Sbjct: 183 NPGMVETEF 191


>gi|212691659|ref|ZP_03299787.1| hypothetical protein BACDOR_01154 [Bacteroides dorei DSM 17855]
 gi|265753189|ref|ZP_06088758.1| FabG protein [Bacteroides sp. 3_1_33FAA]
 gi|212665848|gb|EEB26420.1| hypothetical protein BACDOR_01154 [Bacteroides dorei DSM 17855]
 gi|263236375|gb|EEZ21870.1| FabG protein [Bacteroides sp. 3_1_33FAA]
          Length = 249

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 119/240 (49%), Gaps = 24/240 (10%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++ +L+N++ALVTG+  GIG   A  LA  GA V+  GR+ + L +        + KI  
Sbjct: 1   MYKSLNNKVALVTGAGTGIGRAIAQRLADEGANVLIVGRTETTLVE----TAAYSDKISY 56

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            A DL   + +      + +R+G+LDIL+ NAG    ++P   +K   +  V ++NV A 
Sbjct: 57  LAIDLESEDGIRTIIRTVGERYGRLDILVNNAG-WAPVTPFATMKIDEYDKVFAINVRAV 115

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL--WGAYSASKAAIEALARTWSKETVNT 189
             + ++  P +K +   +  IL+        P+     Y+ASKAA+  + R W+KE    
Sbjct: 116 VMLTQACLPMIKAA---KGNILNVTTTMTTNPIATMANYAASKAAVYTMTRAWAKELAKD 172

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDP---------NTVP-----HPQKVAKIISFLCATQ 235
            +RV ++  GP  T +  K   +++           +VP      P++VA +++FL + +
Sbjct: 173 GVRVNSLGVGPIETPIYGKTELSDEAAKAHKDMVTKSVPLGRMGQPEEVAAVVAFLTSDE 232


>gi|224129782|ref|XP_002328801.1| predicted protein [Populus trichocarpa]
 gi|222839099|gb|EEE77450.1| predicted protein [Populus trichocarpa]
          Length = 221

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 102/201 (50%), Gaps = 8/201 (3%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           ++TG  +G+G   ALEL + G  VI C RS   L  L++  Q  + K  +   D++ +++
Sbjct: 1   MITGVGKGLGRALALELDKRGHIVIGCSRSQDNLNSLQS--QFSSDKHLLLDADVKSNSS 58

Query: 82  LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW 141
           +E     + ++ G  DI++ NAG +     IW++ E+ F  VI  NV    N++R F P 
Sbjct: 59  VEELARVVVEKKGVPDIIVNNAGTINQNKKIWEVSEEEFDSVIDTNVKGIANMLRHFIPL 118

Query: 142 LKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT 201
           +  +  G  + +SSG       L   Y ASK A+E L+R+ +KE +   + ++ ++PG  
Sbjct: 119 MIPNKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKE-LPEGMAIVALNPGVI 177

Query: 202 RTSMRAKAMPA-----EDPNT 217
            T M            +DP+T
Sbjct: 178 HTDMLTSCFGTSASLYQDPDT 198


>gi|300726412|ref|ZP_07059862.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Prevotella bryantii B14]
 gi|299776312|gb|EFI72872.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Prevotella bryantii B14]
          Length = 252

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 96/187 (51%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           ++AL+TG++ GIG   A + A  G  +I   RS  +LE +K  L+ +  ++   AFD+++
Sbjct: 3   KIALITGATSGIGRACAFKFAEGGYNLIITARSADKLEIVKRDLEDLGAEVLGLAFDVQN 62

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSF 138
             A +    Y+ + W  +D+LI NAG+   + P ++   + + ++I  N+     + R  
Sbjct: 63  REASKKAYNYLPQEWRDIDVLINNAGMARGLEPEYKGSFEDWDEMIDTNIKGLLTMTRLV 122

Query: 139 DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDP 198
            P + + + G  I + S A          Y A+KAA++AL      +  NTA+RV NI P
Sbjct: 123 VPGMVERNHGHVINIGSVAGDAAYAGGNVYCATKAAVKALTDGLRIDLANTAVRVTNIKP 182

Query: 199 GPTRTSM 205
           G   T+ 
Sbjct: 183 GLVETNF 189


>gi|239618180|ref|YP_002941502.1| short-chain dehydrogenase/reductase SDR [Kosmotoga olearia TBF
           19.5.1]
 gi|239507011|gb|ACR80498.1| short-chain dehydrogenase/reductase SDR [Kosmotoga olearia TBF
           19.5.1]
          Length = 256

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 118/230 (51%), Gaps = 15/230 (6%)

Query: 21  ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI-NKKIDIFAFDLRDS 79
           ALVTG+S GIG   A ELA+ G  ++   R   +LEKL + L  I    ++ F  DL D 
Sbjct: 3   ALVTGASSGIGKVFAEELAKRGYDLVLVARRKERLEKLAHDLSSIYGVAVEPFVADLTDF 62

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
           + L      + +R+  +D+LI NAG  G ISP  +I  +    ++ +N+ A + + + F 
Sbjct: 63  DKLR----ELVERFSDIDLLINNAG-FGLISPFVEIDTEKGLKMVDLNIRALYYLTKEFS 117

Query: 140 PWLKKSHCGRAII--LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             + K +   A I  ++S AA++  P +  Y+A+KA + +L   +SKE +   ++++ + 
Sbjct: 118 KKMVKRNGNEAGIINIASTAAFQPVPGFATYAATKAFVLSLTEAFSKE-LEGRVKIMVVC 176

Query: 198 PGPTRTS-MRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246
           PGPT+T       +P      +  P+KV K      + +  E GK   +P
Sbjct: 177 PGPTKTEFFNVAGLPNMRAKFIMTPEKVVK-----GSLRAFEKGKRTYIP 221


>gi|118589595|ref|ZP_01547000.1| short-chain dehydrogenase/reductase SDR [Stappia aggregata IAM
           12614]
 gi|118437681|gb|EAV44317.1| short-chain dehydrogenase/reductase SDR [Stappia aggregata IAM
           12614]
          Length = 270

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 93/192 (48%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  ++ALVTG+SRGIG   A  LA+ GA V+   RS   +E++   ++   +       
Sbjct: 20  DLTGQVALVTGASRGIGEAAARSLAKYGAKVVLAARSDKDIERIAGEIRAEGQDATAVVC 79

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+ D + +          +G LDIL+ NAG++  I+ I       +  VI +NV   +  
Sbjct: 80  DVADYDDVVKAVQTAVDTYGGLDILVNNAGVIEPIARIEDSDPAEWGKVIDINVKGVYYG 139

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           + +    +     G  + +SSGAA      W  Y ASKAA  +L R   KE  +  LR++
Sbjct: 140 LHAAAKHMLAKGAGTVVNISSGAAVSALEGWSHYCASKAAALSLTRCADKEFGDKGLRIV 199

Query: 195 NIDPGPTRTSMR 206
            + PG   T M+
Sbjct: 200 GLSPGTVATQMQ 211


>gi|317128771|ref|YP_004095053.1| short-chain dehydrogenase/reductase SDR [Bacillus cellulosilyticus
           DSM 2522]
 gi|315473719|gb|ADU30322.1| short-chain dehydrogenase/reductase SDR [Bacillus cellulosilyticus
           DSM 2522]
          Length = 279

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 105/208 (50%), Gaps = 9/208 (4%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKK--IDIFAFD 75
           N++ L+TG+S G GY+ +LELA  G  V++  RS++  ++LK    K+  K  +D+   D
Sbjct: 2   NKVVLITGTSSGFGYFISLELASKGYQVVSTMRSLNNSQQLKEEANKVGCKNNMDVVKMD 61

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGI-LGSISPIWQIK--EKSFADVISVNVMANW 132
           +   + +     YI + +GK+DILI NAG  LG IS    +K  E+ FA     N+    
Sbjct: 62  VTIESDIRDVVQYIKENYGKIDILINNAGYCLGGISEFITVKEWERQFA----TNLFGVI 117

Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192
           ++  +F P ++K   G+ I + S +     P    Y++SK A+E  + +   E +   + 
Sbjct: 118 SVTNAFLPIMRKQRSGKIINIGSISGRIGLPGLSPYASSKFALEGYSESLRLELLPFNIS 177

Query: 193 VINIDPGPTRTSMRAKAMPAEDPNTVPH 220
           V  I+ G   T +  KAM   D     H
Sbjct: 178 VSIIEAGSYNTKIWEKAMKNIDTKVTHH 205


>gi|291546561|emb|CBL19669.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Ruminococcus sp. SR1/5]
          Length = 246

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 101/190 (53%), Gaps = 2/190 (1%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSG-AYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           + ++A+VTG +RGIG   ALELA++G   VI    S  +  + K  ++    + DI   +
Sbjct: 3   EKKIAVVTGGARGIGKAIALELAKAGNLVVINYNGSEEKARETKAEIEAAGGQADILQCN 62

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D +A E     +A+++G++DIL+ NAG+      + ++ E+ F+ V+ +N+   +N +
Sbjct: 63  VADFDACEAFFKAVAEKYGRVDILVNNAGVTKD-GLLMKMSEEDFSRVVDINLKGTFNCI 121

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R     + K   GR I LSS    +       Y+ASKA I  L ++ +KE  +  + V  
Sbjct: 122 RHVSRMMLKQRSGRIISLSSVVGLRGNAGQANYAASKAGIIGLTKSAAKELASRGITVNA 181

Query: 196 IDPGPTRTSM 205
           I PG  +T M
Sbjct: 182 IAPGFIKTDM 191


>gi|110799443|ref|YP_695600.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens ATCC
           13124]
 gi|110674090|gb|ABG83077.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens ATCC
           13124]
          Length = 253

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 107/226 (47%), Gaps = 11/226 (4%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF--D 75
           N++ +VTG +RGIG+ T  +    GA V  CG     ++K    L  IN   D   F  +
Sbjct: 10  NKVVIVTGGTRGIGFATVKKFLDHGAKVALCGSRKETVDKALEELNHINPNYDAIGFYPN 69

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L DSN ++     + ++WG +DILI NAG+  + S I+   ++ F+ +I +NV A +N  
Sbjct: 70  LLDSNEVKEMVDKVLEKWGTIDILINNAGVSDNKS-IYTQSDEDFSKIIDINVKAIFNCT 128

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++    +K    G  +  SS  +   +     Y  SK A+  L ++ ++E     +RV  
Sbjct: 129 KAVSEIMKNKKYGVILNTSSVVSLYGQKTGVGYPTSKFAVNGLTKSLARELGKDGIRVNA 188

Query: 196 IDPGPTRTSMRA---KAMPAEDPNTVP-----HPQKVAKIISFLCA 233
           + PG   T M A   K +  +    VP      P+ +A    FL +
Sbjct: 189 VAPGIIATDMVAALDKKLVDQIAQNVPLGRVGEPEDIANAFLFLAS 234


>gi|226365290|ref|YP_002783073.1| oxidoreductase [Rhodococcus opacus B4]
 gi|226243780|dbj|BAH54128.1| oxidoreductase [Rhodococcus opacus B4]
          Length = 271

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 121/266 (45%), Gaps = 32/266 (12%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIAC------------GRSISQLEKLKNALQ 63
            DN++  VTG++RG G   A+  A  GA +IA             G +   L +    ++
Sbjct: 7   FDNKVVFVTGAARGQGRAEAVRFASEGADIIAIDACAEFASTPYPGATQEDLAETVRLVE 66

Query: 64  KINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGIL-GSISPIWQIKEKSFAD 122
              ++I     D+RD + L         R G+LD++IANAGI  G++S  W+I  + + +
Sbjct: 67  ATGRRIVSATADVRDFDGLSRALADGIDRLGRLDVVIANAGICSGALS--WEITAEQWQE 124

Query: 123 VISVNVMANWNIMRSFDPWLKKSHCGRAIILSSG-AAYKCRPLWGAYSASKAAIEALART 181
            + VN+   ++  ++  P+L +   G A++ +S  +  K  P  G Y A+K  I  LA+T
Sbjct: 125 TVDVNLTGTFHTAKAAIPYLIEQGEGGAVVFTSSVSGLKGTPFTGHYVATKHGITGLAKT 184

Query: 182 WSKETVNTALRVINIDPGPTRTSMRAKAMPA---------------EDPNTVPHPQKVAK 226
            + E     +RV  + P    T M+ + +                   P T+  P+ VA 
Sbjct: 185 MANELGEHRIRVNTVHPAGVDTGMKMRDLHPLIARYASTLGSIYQNSLPYTITQPEDVAA 244

Query: 227 IISFLCATQ-KIETGKLFSVPQNRFV 251
           +++++C+ + K  TG    V     +
Sbjct: 245 VVAWVCSDEAKYITGAQIPVDMGNLI 270


>gi|326794928|ref|YP_004312748.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Marinomonas
           mediterranea MMB-1]
 gi|326545692|gb|ADZ90912.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Marinomonas
           mediterranea MMB-1]
          Length = 252

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 116/246 (47%), Gaps = 13/246 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+NR+A++TG++  IG    L+L   GA ++     +    KLK+ +  +     +   D
Sbjct: 5   LENRVAVITGAAGSIGREVCLKLNMEGAKLVLVDIDVESCNKLKDEIHNLGGNCIVVIGD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L         +      + ++DILI NAG    + PIW+++   +   I  N+ + + + 
Sbjct: 65  LCSDGTPNRIRDSALNAFQRIDILINNAGSGSEMKPIWEMEFSDWERDIKQNLSSQFLMC 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++  P + K   GR I +SS A  +   L G Y+A+KA + A+ +   KE   T + V  
Sbjct: 125 KAIIPQMLKQSYGRIINVSSSAGMEGHALSGGYAAAKAGVIAMTKVLGKELAKTGVIVNT 184

Query: 196 IDPGPTRTSMRAKAMPAEDPNT-----VP-----HPQKVAKIISFLCATQKIE--TGKLF 243
           I P    T M  K    ED        +P      P +VA++I+FL A++K+   TG +F
Sbjct: 185 IAPAVIETKMLQKEWFNEDVKNSLLERIPMGRLGQPSEVAEMINFL-ASEKVSFTTGAVF 243

Query: 244 SVPQNR 249
            +   R
Sbjct: 244 DLSGGR 249


>gi|238025414|ref|YP_002909646.1| short-chain dehydrogenase/reductase SDR [Burkholderia glumae BGR1]
 gi|237880079|gb|ACR32411.1| Short-chain dehydrogenase/reductase SDR [Burkholderia glumae BGR1]
          Length = 254

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 95/189 (50%), Gaps = 5/189 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LDN++ALVTG++ GIG  TA   A  GA V   GR  ++LE    +++           D
Sbjct: 5   LDNKIALVTGATSGIGLATAQRFAAEGAQVYLTGRREAELEAAVASIRAAGGTATGLRVD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
               + L+     I +  G+LD+L ANAG  GS+ P+ +I E  F D    NV A    +
Sbjct: 65  STRLDQLDALYARIREEQGRLDVLFANAGG-GSMLPLGEITEAHFDDTFDRNVKAVLFTV 123

Query: 136 RSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P L     G ++IL+ S A       +  YSASKAA+ A AR+W  +     +RV 
Sbjct: 124 QKALPLLAD---GASVILTGSTAGSSGTAAFSVYSASKAAVRAFARSWILDLKPRRIRVN 180

Query: 195 NIDPGPTRT 203
            + PG TRT
Sbjct: 181 TLSPGSTRT 189


>gi|168209506|ref|ZP_02635131.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens B
           str. ATCC 3626]
 gi|170712408|gb|EDT24590.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens B
           str. ATCC 3626]
          Length = 253

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 107/226 (47%), Gaps = 11/226 (4%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF--D 75
           N++ +VTG +RGIG+ T  +    GA V  CG     ++K    L  IN   D   F  +
Sbjct: 10  NKVVIVTGGTRGIGFATVKKFLDHGAKVALCGSRKETVDKALEELNHINPNYDAIGFYPN 69

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L DSN ++     + ++WG +DILI NAG+  + S I+   ++ F+ +I +NV A +N  
Sbjct: 70  LLDSNEVKEMVDKVLEKWGTIDILINNAGVSDNKS-IYTQSDEDFSKIIDINVKAIFNCT 128

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++    +K    G  +  SS  +   +     Y  SK A+  L ++ ++E     +RV  
Sbjct: 129 KAVSEIMKNKKYGVILNTSSVVSLYGQKTGVGYPTSKFAVNGLTKSLARELGRDGIRVNA 188

Query: 196 IDPGPTRTSMRA---KAMPAEDPNTVP-----HPQKVAKIISFLCA 233
           + PG   T M A   K +  +    VP      P+ +A    FL +
Sbjct: 189 VAPGIIATDMVAALDKKLVDQIAQNVPLGRVGEPEDIANAFLFLAS 234


>gi|108758622|ref|YP_634450.1| short chain dehydrogenase/reductase family oxidoreductase
           [Myxococcus xanthus DK 1622]
 gi|108462502|gb|ABF87687.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Myxococcus xanthus DK 1622]
          Length = 242

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 99/206 (48%), Gaps = 2/206 (0%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           L+TG+SRG+G      LAR GA V+   R  +++  +  AL+    +    A D+ D  A
Sbjct: 9   LITGASRGLGLALMNGLARRGARVVGVARHAAEMGAVAEALRWEGLEAHALACDVGDKEA 68

Query: 82  LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKE--KSFADVISVNVMANWNIMRSFD 139
           +           G LD+L+ NA  LG       +    +    V+ VNV+  + + ++  
Sbjct: 69  IYPMVGAATALVGPLDVLVHNASTLGPTPLPLLLDTACEDLQRVLEVNVVGPFRLTKAVA 128

Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199
             +     G  + ++S AA    P WGAY  SKAA+E L R W+ E   T +R +++DPG
Sbjct: 129 GNMSVRGKGLVMHITSDAAVSAYPRWGAYGVSKAALEHLGRVWAAELEGTGVRFVSVDPG 188

Query: 200 PTRTSMRAKAMPAEDPNTVPHPQKVA 225
              T M   A+P  D + +  P+ VA
Sbjct: 189 EMDTRMYRDAVPDGDYSQLSRPEAVA 214


>gi|253578547|ref|ZP_04855819.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850865|gb|EES78823.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 246

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 118/242 (48%), Gaps = 13/242 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           L N++AL+TG+ RGIG   A+ LA+ GA  VI    S  + +++K  +++   K  I+  
Sbjct: 2   LKNKIALITGAGRGIGRAIAIALAKEGAEVVINYNGSEERAKEVKQTIEENGGKASIYKC 61

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           ++ D  A E     I K +G LDIL+ NAGI      I ++KE+ F  V++VN+   +N 
Sbjct: 62  NVSDFAACEAMIKDIVKEYGHLDILVNNAGITKD-GLIMKMKEEDFDSVLNVNLKGTFNT 120

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R     + K   G+ I +SS +          Y+ASKA +  L +T ++E  +  + V 
Sbjct: 121 IRHSARQMLKQRSGKIINISSVSGILGNVGQANYAASKAGVIGLTKTMARELGSRGITVN 180

Query: 195 NIDPGPTRTSM--------RAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE--TGKLFS 244
            I PG   T M        R  A           P+ +A    FL A+ K +  TG++ S
Sbjct: 181 AIAPGFVDTEMTEVLSEEIRENACKQIILGRFGKPEDIANTAVFL-ASDKADYITGQVIS 239

Query: 245 VP 246
           V 
Sbjct: 240 VD 241


>gi|168216001|ref|ZP_02641626.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens NCTC
           8239]
 gi|182381960|gb|EDT79439.1| 7-alpha-hydroxysteroid dehydrogenase [Clostridium perfringens NCTC
           8239]
          Length = 253

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 107/226 (47%), Gaps = 11/226 (4%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF--D 75
           N++ +VTG +RGIG+ T  +    GA V  CG     ++K    L  IN   D   F  +
Sbjct: 10  NKVVIVTGGTRGIGFATVKKFLDHGAKVALCGSRKETVDKALEELNHINPNYDAIGFYPN 69

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L DSN ++     + ++WG +DILI NAG+  + S I+   ++ F+ +I +NV A +N  
Sbjct: 70  LLDSNEVKEMVDKVLEKWGTIDILINNAGVSDNKS-IYTQSDEDFSKIIDINVKAIFNCT 128

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++    +K    G  +  SS  +   +     Y  SK A+  L ++ ++E     +RV  
Sbjct: 129 KAVSKIMKNKKYGVILNTSSVVSLYGQKTGVGYPTSKFAVNGLTKSLARELGKDGIRVNA 188

Query: 196 IDPGPTRTSMRA---KAMPAEDPNTVP-----HPQKVAKIISFLCA 233
           + PG   T M A   K +  +    VP      P+ +A    FL +
Sbjct: 189 VAPGIIATDMVAALDKKLVDQIAQNVPLGRVGEPEDIANAFLFLAS 234


>gi|56420219|ref|YP_147537.1| 3-oxoacyl-[acyl-carrier protein] reductase [Geobacillus
           kaustophilus HTA426]
 gi|56380061|dbj|BAD75969.1| 3-oxoacyl-[acyl-carrier protein] reductase (3-ketoacyl-[acyl
           carrier protein] reductase) [Geobacillus kaustophilus
           HTA426]
          Length = 256

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 122/236 (51%), Gaps = 20/236 (8%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN--KKIDIFAFD 75
           N +A++TG   GIG  TA+ LA+ GA V+  GR+  +LE+    + ++      D FA D
Sbjct: 5   NTVAVITGGGSGIGRATAVRLAQEGATVVLVGRTAVKLEETVQDITRLGVPGVADRFAAD 64

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIW-QIKEKSFADVISVNVMANWNI 134
           + D   +     Y+  R+G L +L+ NAGI  S    W ++ E+ + DV  VN+ + + +
Sbjct: 65  VTDHEQVRALAAYVQNRYGDLHVLVNNAGI--STHTKWLELTEQEWDDVQRVNMKSVFLV 122

Query: 135 MRSFDPWL----KKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
            ++  P +    K+    RAI+ ++S + ++       YSA+KA +  L ++ + E    
Sbjct: 123 SQTLAPLMIEGAKRERANRAIVNVASLSGHQAGAEIPHYSAAKAGVINLTKSLALELAPY 182

Query: 190 ALRVINIDPGPTRTSMRAKAMPAE------DPNT----VPHPQKVAKIISFLCATQ 235
            +RV ++ PG   T +  + +  E      + NT    V  P+++A +I+FL +++
Sbjct: 183 GIRVNSVSPGFVETPLTERGLQNERFVKAIERNTALGRVGAPEEIANVIAFLASSE 238


>gi|41407547|ref|NP_960383.1| hypothetical protein MAP1449c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41395900|gb|AAS03766.1| hypothetical protein MAP_1449c [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 268

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 96/194 (49%), Gaps = 3/194 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACG--RSISQLEKLKNALQKINKKIDIF 72
            L  R+ LVTG+ RGIG       A  GA VIA     +   L +   A+Q+   +    
Sbjct: 3   GLSGRVVLVTGAGRGIGRSHCQRFAEEGADVIAVDVPAAAPDLAQTAAAVQQRGVRAATA 62

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+ D  AL         R G+LD+L+ NAGI  + +P W+I  +++   + VN+   W
Sbjct: 63  LADVSDFAALAAAVDEAVGRLGRLDVLVGNAGIHPAAAPAWEITPQNWQQTLDVNLTGVW 122

Query: 133 NIMRSFDPWLKKS-HCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + +++  P + ++   G  +I+SS +  +  P    YSASK A+  LART + E     +
Sbjct: 123 HTVKAGVPHMSRTARGGSIVIISSTSGIRGTPGAAPYSASKHAVVGLARTLANELGPQGI 182

Query: 192 RVINIDPGPTRTSM 205
           RV  + PG   T+M
Sbjct: 183 RVNTVHPGAVATAM 196


>gi|53712951|ref|YP_098943.1| putative short-chain dehydrogenase [Bacteroides fragilis YCH46]
 gi|60681163|ref|YP_211307.1| putative short-chain dehydrogenase [Bacteroides fragilis NCTC 9343]
 gi|253563071|ref|ZP_04840528.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|265763048|ref|ZP_06091616.1| 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase [Bacteroides sp.
           2_1_16]
 gi|52215816|dbj|BAD48409.1| putative short-chain dehydrogenase [Bacteroides fragilis YCH46]
 gi|60492597|emb|CAH07369.1| putative short-chain dehydrogenase [Bacteroides fragilis NCTC 9343]
 gi|251946847|gb|EES87129.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263255656|gb|EEZ27002.1| 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase [Bacteroides sp.
           2_1_16]
 gi|301162652|emb|CBW22199.1| putative short-chain dehydrogenase [Bacteroides fragilis 638R]
          Length = 256

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 100/191 (52%), Gaps = 1/191 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ-KINKKIDIFAF 74
           +  ++  +TG+S GIG   A + A  G+ +I   R++++LE+LK  L+ K   +I +  F
Sbjct: 1   MKGKIVFITGASSGIGEGCARKFASQGSDLILNARNVAKLEELKVELEAKYGVRICLLPF 60

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+RD NA  +    + + W ++D+L+ NAG++  +   ++     +  VI  N+ A   +
Sbjct: 61  DVRDRNAATMALASLPEEWKRIDVLVNNAGLVIGVDKEFEGNLDEWDIVIDTNIKALLAM 120

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R   P + +   G  I + S A     P    Y A+KAA++AL+     + V+T LRV 
Sbjct: 121 TRIVVPGMVERGHGHIINIGSIAGDAAYPGGSVYCATKAAVKALSDGLRIDLVDTPLRVT 180

Query: 195 NIDPGPTRTSM 205
           NI PG   T+ 
Sbjct: 181 NIKPGMVETNF 191


>gi|295134877|ref|YP_003585553.1| short-chain dehydrogenase/reductase SDR [Zunongwangia profunda
           SM-A87]
 gi|294982892|gb|ADF53357.1| short-chain dehydrogenase/reductase SDR [Zunongwangia profunda
           SM-A87]
          Length = 247

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/198 (32%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           N  A+VTG + G+G+ TA +L   G      GR+    EK   A ++I +    F  DL 
Sbjct: 4   NLTAIVTGGNAGLGFATAKKLCNEGITTYVIGRN---KEKTLKACEEIGEYAKPFILDLT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D + +    T IAK  G++DIL+ NAGI        +++   F +++  NV + + I R 
Sbjct: 61  DLDKIPAAITEIAKEAGRIDILVNNAGI-NMKKEFLEVENDEFQNILHTNVTSVFAISRE 119

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
               +K++  G  I +SS AA    P   AYSASK A+E + R  + +     +RV  + 
Sbjct: 120 VAKVMKENGKGSIINISSMAAQYGIPHVIAYSASKTAVEGMTRAMAVDLAKFGIRVNCVA 179

Query: 198 PGPTRTSMRAKAMPAEDP 215
           PG  +T+M +KA+ + DP
Sbjct: 180 PGFIKTNMSSKALDS-DP 196


>gi|295399778|ref|ZP_06809759.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111710|ref|YP_003990026.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Geobacillus sp.
           Y4.1MC1]
 gi|294978181|gb|EFG53778.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216811|gb|ADP75415.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Geobacillus sp.
           Y4.1MC1]
          Length = 246

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 121/228 (53%), Gaps = 12/228 (5%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF- 74
           L  ++ALVTG+SRGIG   ALELAR GA  IA   + S+ +  +   +  N   + FA  
Sbjct: 2   LQGKVALVTGASRGIGRAIALELARQGAK-IAVNYAGSEAKANEVVGEIKNMGGEAFAIQ 60

Query: 75  -DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ D+ A+E     + +R+ ++DIL+ NAGI    + + ++KE+ + DVI++N+   +N
Sbjct: 61  ADVADAQAVEQMVKTVLERFERIDILVNNAGITRD-NLLMRMKEEEWDDVININLKGVFN 119

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
             ++    + K   GR + ++S       P    Y A+KA +  L +T ++E  +  + V
Sbjct: 120 CTKAVTRPMMKQRYGRIVNIASVVGVMGNPGQANYVAAKAGVIGLTKTAARELASRNITV 179

Query: 194 INIDPGPTRTSMR---AKAMPAEDPNTVP-----HPQKVAKIISFLCA 233
             + PG   T M    ++ + +E    +P      P+ VAK+++FL +
Sbjct: 180 NAVAPGFITTDMTERLSEEIKSEMLKQIPLARFGEPEDVAKVVAFLVS 227


>gi|254500592|ref|ZP_05112743.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Labrenzia alexandrii DFL-11]
 gi|222436663|gb|EEE43342.1| oxidoreductase, short chain dehydrogenase/reductase family
           [Labrenzia alexandrii DFL-11]
          Length = 253

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 105/225 (46%), Gaps = 7/225 (3%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  ++ALVTG+SRGIG   A  LA+ GA V+   RS   + K+   +     +      
Sbjct: 3   DLKGQVALVTGASRGIGEAGARNLAKYGAKVVLAARSSGSITKIAEEICSDGGEAVAVTC 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           D+     +E         +G +DIL+ NAGI+  IS I     +++  VI +NV   ++ 
Sbjct: 63  DVAVYADVEKAVQTAIDTFGGIDILVNNAGIIEPISRIESSDPEAWGQVIDINVKGVYHG 122

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +R+  P +     G  + +SSGAA      W  Y +SKAA  +L R   KE     +RV+
Sbjct: 123 IRAVAPHMLAKGSGTIVNISSGAAVSALEGWSQYCSSKAAALSLTRCSDKEFGEKGVRVV 182

Query: 195 NIDPGPTRTSMRAKAMPAE-------DPNTVPHPQKVAKIISFLC 232
            + PG   T M+     +        DP+     + V + I +LC
Sbjct: 183 GLSPGTVATKMQVDIKASGINPVSQLDPSVHIPAEWVGETICWLC 227


>gi|332519339|ref|ZP_08395806.1| short-chain dehydrogenase/reductase SDR [Lacinutrix algicola
           5H-3-7-4]
 gi|332045187|gb|EGI81380.1| short-chain dehydrogenase/reductase SDR [Lacinutrix algicola
           5H-3-7-4]
          Length = 252

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 105/220 (47%), Gaps = 8/220 (3%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           N+ AL+TG++ GIG  TA E A+ G  +I CGR   +LE +K AL+K + ++ I  FD+R
Sbjct: 4   NKTALITGATSGIGRATAHEFAKHGIKLIVCGRRQERLETIKKALRK-HTEVHILNFDVR 62

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D  A+      + + +  +DILI NAG    + PI +     +  ++ +NV     + ++
Sbjct: 63  DKKAVFTAIESLPENFKNIDILINNAGNAHGLDPIHEGNIDDWDAMMDINVKGLLYVSKA 122

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P + +   G  I + S A  +  P    Y ASK A+ A+      +     ++V  I+
Sbjct: 123 IIPQMTERKSGHIINIGSSAGKEVYPKGNVYCASKHAVIAITEGMRIDLNPYGIKVGAIN 182

Query: 198 PGPTRTS---MRAKAMPAED----PNTVPHPQKVAKIISF 230
           PG   T    +R K     D          P+ VA +I F
Sbjct: 183 PGLVETEFSQVRFKGETLADNVYKGYKALQPEDVADVIYF 222


>gi|299138726|ref|ZP_07031904.1| short-chain dehydrogenase/reductase SDR [Acidobacterium sp.
           MP5ACTX8]
 gi|298599362|gb|EFI55522.1| short-chain dehydrogenase/reductase SDR [Acidobacterium sp.
           MP5ACTX8]
          Length = 250

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 116/233 (49%), Gaps = 22/233 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++A+VTG S GIG   A +L   GAYV   GR  S+L+    A++ I   +     D
Sbjct: 5   LEGKIAIVTGGSAGIGLAAAQQLVLEGAYVFITGRRQSELDI---AVKAIGANVTGIQAD 61

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
               + L+     I ++ G++DI+ ANAG  G  +P+  I E+ F  + + NV      +
Sbjct: 62  SSSLSDLDKVYAQIKQQKGRVDIVFANAG-GGDFAPLGAISEEHFDRIFNANVRGLVFTV 120

Query: 136 RSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P +     G +IIL +S  + K    +  YSASKAA+ + ARTW+ +  +  +RV 
Sbjct: 121 QKALPLMPD---GGSIILNASITSIKGTGAFSVYSASKAAVRSFARTWTVDLKDRKIRVN 177

Query: 195 NIDPGPTRT---------SMRAKAMPAEDPNTVP-----HPQKVAKIISFLCA 233
            + PGP  T         + + K + A   +TVP      P ++ K ++FL +
Sbjct: 178 AVSPGPIETPGLGGLAPDAEQRKGLFAHLASTVPLGRIGQPSEIGKAVTFLAS 230


>gi|187921293|ref|YP_001890325.1| short-chain dehydrogenase/reductase SDR [Burkholderia phytofirmans
           PsJN]
 gi|187719731|gb|ACD20954.1| short-chain dehydrogenase/reductase SDR [Burkholderia phytofirmans
           PsJN]
          Length = 249

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 115/244 (47%), Gaps = 11/244 (4%)

Query: 17  DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDL 76
           D+ + LVTG+  GIG  TA+  A+  A ++  GR I +  KL   L+    +++    D+
Sbjct: 3   DSPVVLVTGALSGIGRATAIAFAKEKARLVISGRRIEEGRKLAEQLRSSGAEVEFVQADV 62

Query: 77  RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMR 136
           R  + ++     +  R+G+LDI + +AG  G  +PI +     +A V   NV+  W  ++
Sbjct: 63  RFEDQVQGLVDRVISRFGRLDIAVNSAGYEGDPAPIVEQNIDQYAFVFDTNVLGTWLALK 122

Query: 137 SFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINI 196
                +     G  + +SS    +  P    Y ASK A+E L ++ + ET    +RV  +
Sbjct: 123 HEIRVMAAQGGGSIVNVSSTMGIRGAPHNALYVASKHAVEGLTKSAALETAAINIRVNAV 182

Query: 197 DPGPTRTSMRAKAMPAEDPN-----TVP-----HPQKVAKIISFLCATQ-KIETGKLFSV 245
            PGP +T M  +   +E        +VP      P+++A  I F+ + +    TG++  V
Sbjct: 183 APGPIQTEMLDRITGSESGKAAMLASVPLKRAGTPEEIADAIVFVASDKASFMTGEVLRV 242

Query: 246 PQNR 249
              R
Sbjct: 243 NGGR 246


>gi|255573868|ref|XP_002527853.1| short-chain dehydrogenase, putative [Ricinus communis]
 gi|223532777|gb|EEF34556.1| short-chain dehydrogenase, putative [Ricinus communis]
          Length = 252

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 100/192 (52%), Gaps = 2/192 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFA 73
           N   +  ++TG S+G+G   ALELA+ G  VI C R+  +L  L++ L    N    +  
Sbjct: 22  NAGGKKVMITGVSKGLGRALALELAKRGHTVIGCSRAQDKLNSLQSELPSDHNNHHLLLN 81

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+  ++++E     I ++ G  DI++ NAG +   + IW++  + F  VI  NV    N
Sbjct: 82  ADVSSNSSVEELAKAIMEKKGVPDIIVNNAGTINKNNKIWEVPVEEFDTVIDTNVKGIAN 141

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           ++R F P +  +  G  + +SSG       L   Y ASK A+E ++R+ +KE +   + V
Sbjct: 142 VLRHFIPLMLPNKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGMSRSVAKE-LPDGMAV 200

Query: 194 INIDPGPTRTSM 205
           + ++PG   T M
Sbjct: 201 VALNPGVIHTEM 212


>gi|254469029|ref|ZP_05082435.1| retinol dehydrogenase 11 [beta proteobacterium KB13]
 gi|207087839|gb|EDZ65122.1| retinol dehydrogenase 11 [beta proteobacterium KB13]
          Length = 243

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 112/209 (53%), Gaps = 14/209 (6%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRD 78
           ++A ++G++RGIG+ TA +LA  G  VI   R +++ E  +N L  +  ++D+  +D +D
Sbjct: 3   KVAFISGANRGIGFETAKKLAEQGIKVILGSRDLNKGEIAQNELAALGAEVDLVQYDAKD 62

Query: 79  SNALELTKTYIAKRWGKLDILIANAGILGS----ISPIWQIKEKSFADVISVNVMANWNI 134
            +A +    YI++++ KLDILI NAG+L +    ++    + +    +   VN+ +  ++
Sbjct: 63  MDAPQHVYQYISEKYHKLDILINNAGVLLTGNLFVTNSSTVSDDDVKETFQVNLFSVISL 122

Query: 135 MRSFDPWLKKSHCGRAI----ILSSGAAYKCR--PLWG----AYSASKAAIEALARTWSK 184
            ++  P +KKS  GR +    ILSS   +  +  P+      AY+ASK A+ A     + 
Sbjct: 123 TQALLPLIKKSDAGRIVNVSTILSSLTLHSAKDSPIQPAKEFAYNASKTALNAYTVHLAS 182

Query: 185 ETVNTALRVINIDPGPTRTSMRAKAMPAE 213
           E  +T ++V +  PG  +T +     P +
Sbjct: 183 ELKDTNIKVNSGHPGWVKTELGGPKAPMD 211


>gi|254461327|ref|ZP_05074743.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Rhodobacterales bacterium HTCC2083]
 gi|206677916|gb|EDZ42403.1| oxidoreductase, short-chain dehydrogenase/reductase family
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 214

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 105/208 (50%), Gaps = 5/208 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +++ALVTG+SRG+G+  A  LA++  +V+A  R+   LE L + +Q    +  +   D+ 
Sbjct: 2   SKIALVTGASRGLGFALAEALAKTH-HVVAVARTTGALEDLDDKIQACGGQATLAPMDIT 60

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +  A+      I  RWG +D+    A     ++P   I  K +A  I++N  +   ++  
Sbjct: 61  NEGAMAQLCRSIYDRWGSIDLWAHTAVHAAPLTPAAHIDAKDWAKSIAINATSMGLLIPY 120

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P L ++    A+        +     G+Y+ASKAA   LA+ W++ET  T  RV+   
Sbjct: 121 VSPLLGEAST--AVFFDDQTIGE--KFHGSYAASKAAQMYLAKAWARETETTGPRVLIET 176

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVA 225
           P    T+ R++  P ED + + HP+ VA
Sbjct: 177 PPAMSTATRSRFHPGEDRSALAHPRDVA 204


>gi|209526644|ref|ZP_03275168.1| short-chain dehydrogenase/reductase SDR [Arthrospira maxima CS-328]
 gi|209492880|gb|EDZ93211.1| short-chain dehydrogenase/reductase SDR [Arthrospira maxima CS-328]
          Length = 227

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 104/230 (45%), Gaps = 6/230 (2%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           +++ L+TG SRG+G          G  V+ C RS   ++ L    QK  K  +    ++ 
Sbjct: 2   SKIILITGVSRGLGRVLTESFIDLGHTVLGCARSREPIDLLT---QKYGKPHNFQVVNVE 58

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           +  A+E    ++ K +   DI+I NA I+  ++P+W++    F  VI VN+    N++R 
Sbjct: 59  EPQAVENWINHLFKNYPAPDIVINNAAIINPLAPLWEVPPHEFNQVIDVNIKGVANVIRY 118

Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197
             P + K   G  I LSSG      P    Y  SK AIE L +  ++E +   L  I + 
Sbjct: 119 LVPAMMKRGTGIIINLSSGWGRSTSPQVAPYCTSKWAIEGLTQALAQE-LPPGLAAIPMS 177

Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQK-VAKIISFLCATQKIETGKLFSVP 246
           PG   T M       ED      PQ+ V K + F+      + G   +VP
Sbjct: 178 PGIIHTDMLEICY-GEDAAAFTSPQEWVKKAVPFILGLSPKQNGVPVTVP 226


>gi|163793887|ref|ZP_02187861.1| dehydrogenase [alpha proteobacterium BAL199]
 gi|159180998|gb|EDP65515.1| dehydrogenase [alpha proteobacterium BAL199]
          Length = 253

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 125/247 (50%), Gaps = 18/247 (7%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L+ R A+VTG+SRGIG   A  LARSG  V+   R+  + E     ++      +  A 
Sbjct: 3   ELNGRTAVVTGASRGIGLAIAQLLARSGVSVVLAARTTGETEAGAAGIRAAGGVAEAVAC 62

Query: 75  DL---RDS-NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130
           D+   RD   A+E  +    + +G++DIL+ NAG++  I+ +     ++++ V+ VN+  
Sbjct: 63  DVSRYRDVVGAIERCR----QGFGRVDILVNNAGLIDPIARLGDSDPEAWSTVVDVNLKG 118

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            ++ +R+  P ++    G  + +SSGAA      W  Y ++KAA+ +L R    E  +  
Sbjct: 119 VYHGLRAVLPVMEDQGGGVVVNISSGAASGALEGWSHYCSTKAAVLSLTRCADLEYRDKG 178

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPH--------PQKVAKIISFLCATQKIE-TGK 241
           +RV+ + PG   T M+ +++ A   N V          P+  A+ +++LC T   +  G 
Sbjct: 179 VRVVGLSPGTVATGMQ-RSIKASGINPVSQLDWEDHISPEWAAQAVAYLCTTAAADLAGT 237

Query: 242 LFSVPQN 248
            FS+  +
Sbjct: 238 DFSLKSD 244


>gi|223935006|ref|ZP_03626925.1| short-chain dehydrogenase/reductase SDR [bacterium Ellin514]
 gi|223896459|gb|EEF62901.1| short-chain dehydrogenase/reductase SDR [bacterium Ellin514]
          Length = 248

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 116/229 (50%), Gaps = 14/229 (6%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAF 74
           L  + ALVTG+SRGIG  TAL LA++GA V+     SI + E +   ++    + +  A 
Sbjct: 4   LSGKTALVTGASRGIGRATALALAKAGAQVVVHYSNSIKEAEAVIKEIRSGGGRAEKIAA 63

Query: 75  DLRDSNALE-LTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           DLR ++  + L K   A    +LDIL+ANAGI  S +       + F ++ +VNV A + 
Sbjct: 64  DLRAADGPDKLAKQVRALIGDRLDILVANAGIAKS-ATFEDTTIEDFDELFAVNVRAPFF 122

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           +++   P + K      I+LSS AA+       AY+A+K AI  L + ++    +  +RV
Sbjct: 123 LVQQLLPTMHKGSS--VILLSSLAAHAAVGTLAAYAATKGAISTLVKHFAAALGDRGIRV 180

Query: 194 INIDPGPTRTSMRAKAMPAEDPN---------TVPHPQKVAKIISFLCA 233
             + PG   T M + A   E  +          V  P+ +A +I+FL +
Sbjct: 181 NAVAPGVVATDMSSFAKTDEGRDFTESMQALKRVAQPEDIADVIAFLAS 229


>gi|158318207|ref|YP_001510715.1| short-chain dehydrogenase/reductase SDR [Frankia sp. EAN1pec]
 gi|158113612|gb|ABW15809.1| short-chain dehydrogenase/reductase SDR [Frankia sp. EAN1pec]
          Length = 254

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 120/242 (49%), Gaps = 9/242 (3%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
            L  R A+VTG+S GIG+  AL+LA +GA V+A GR  + L +L          + +FA 
Sbjct: 15  RLTGRAAVVTGASSGIGHAIALDLAAAGASVLATGRDGAALSQLARTAAAGRVDLRVFAT 74

Query: 75  DLRDSNALE-LTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
           ++ D++  E L +T  A+  G++ +L+ +AG+  S  P+         D  +VN+ A + 
Sbjct: 75  EITDADGRERLVETARAE-LGEISVLVHSAGVYHS-GPMTMASLADLDDQYAVNLRAPYA 132

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + +   P L ++  G  I ++S       P  G Y+A+K A+ A+A +   E      RV
Sbjct: 133 LTQLLLPDLTRT-LGDIIFVNSTQGLSASPEVGQYAATKHALRAIADSLRGELGPKGPRV 191

Query: 194 INIDPGPTRTSMRAKAMPAE----DPNTVPHPQKVAK-IISFLCATQKIETGKLFSVPQN 248
             I PG T T+M+ K    E    DP  +  P+ VA  ++S +   +++E   +   P  
Sbjct: 192 CTILPGRTATAMQRKIFETEGRDWDPEALMQPEDVAAMVLSVVELPRRVEVTDIVMRPAQ 251

Query: 249 RF 250
           + 
Sbjct: 252 KV 253


>gi|223940019|ref|ZP_03631884.1| short-chain dehydrogenase/reductase SDR [bacterium Ellin514]
 gi|223891286|gb|EEF57782.1| short-chain dehydrogenase/reductase SDR [bacterium Ellin514]
          Length = 255

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 106/232 (45%), Gaps = 20/232 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++A+VTG + GIG  TA   A  GAYV   GR  ++LE    A ++I   +     D
Sbjct: 10  LAGKVAVVTGGNSGIGLATAKRFAAEGAYVFITGRRQNELEA---AAKEIGNNVTAVQGD 66

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +     L+     + K  G +DIL ANAG LG  +P+  I E+ F    + NV      +
Sbjct: 67  ISKLADLDRLYATVKKEKGHIDILFANAG-LGEFAPLGSITEEHFDKTFNTNVKGTLFTV 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +     L+    G  I+ +S  A      +  YSA+KAAI + AR W  +     +RV  
Sbjct: 126 QKALSLLRDG--GSVILNASTTASTGNEAFSVYSATKAAIRSFARCWILDLKQRKIRVNA 183

Query: 196 IDPGPTRTSMRAKAMPAEDPN---------TVP-----HPQKVAKIISFLCA 233
           I PGP  T   +     E+ +         +VP      P +VAK+ SFL +
Sbjct: 184 ISPGPINTPGLSGLTQTEEQDRQFKNAMIASVPLGRLGDPDEVAKVASFLAS 235


>gi|260597817|ref|YP_003210388.1| oxidoreductase YkvO [Cronobacter turicensis z3032]
 gi|260216994|emb|CBA30656.1| Uncharacterized oxidoreductase ykvO [Cronobacter turicensis z3032]
          Length = 288

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 113/239 (47%), Gaps = 22/239 (9%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           ++    +++ +VTG + GIG  TA   +  GA+V   GR  + LE   NALQ++   +  
Sbjct: 39  MNARFSHKVVIVTGGTSGIGLATAKAFSDEGAHVFITGRRQAALE---NALQQLGDNVTG 95

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
              D+     ++     + +R   +D+++ANAG  G ++P+  I E  + +    NV   
Sbjct: 96  VRGDMSQLADIDRLYEAVQQRHSHIDVIVANAG-GGELAPLGAISEAHYHETFDTNVKGV 154

Query: 132 WNIMRSFDPWLKKSHCGRAIILS-SGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
              ++   P L+    G A++L+ S A     P +  YSASKAA+ + AR W  +  +  
Sbjct: 155 LFTVQKALPLLRD---GAAVVLTASTAGSSGTPAFSVYSASKAAVRSFARNWILDLKDRH 211

Query: 191 LRVINIDPGPTRTS----MRAKAMPAEDPNT----------VPHPQKVAKIISFLCATQ 235
           +RV  I PGP  T+    +      AED             V  P+++AK + FL + +
Sbjct: 212 IRVNAISPGPVNTAGLNELFGGGDQAEDVKNELTAQIPLGRVGQPEEIAKAVLFLASDE 270


>gi|227512765|ref|ZP_03942814.1| dehydrogenase [Lactobacillus buchneri ATCC 11577]
 gi|227083965|gb|EEI19277.1| dehydrogenase [Lactobacillus buchneri ATCC 11577]
          Length = 249

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 115/252 (45%), Gaps = 32/252 (12%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           L+TG+ +GIG+ TALEL + G +V+   R + + ++  + L K     D+   D+ D   
Sbjct: 8   LITGADKGIGFQTALELGKRGHHVLVGARDVDRGKEAVDRLTKNGITADLLKIDVTDRTT 67

Query: 82  LELTKTYIAKRWGKLDILIANAGI-LGSISPIWQIKEKSFADVISVNVMANWNIMRSFDP 140
           ++   + +  ++G LD+LI NAG+ L    P  ++  +   +   VN     +++++F P
Sbjct: 68  IQAAASQVMTKFGYLDVLINNAGVALDQHQPASKLSTEVMQNDFKVNFFGAVDVIQAFLP 127

Query: 141 WLKKSHCGRAIILSSG------AAYKCRPLWG----AYSASKAAIEALARTWSKETVNTA 190
            LKK+   + I +SS       A       +G     Y ASKAA+      ++KE  +T 
Sbjct: 128 LLKKADTAKIINVSSNMGSLGLATNSASQFYGVNSLGYQASKAALNFATICFAKELADTT 187

Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG-----KLFSV 245
           + V +++PG T T    + +    P                   Q ++TG     KL S 
Sbjct: 188 ITVNSVNPGWTATEFGGRDLKQSIP----------------SGMQSVKTGAAQIVKLASD 231

Query: 246 PQNRFVNYLTPN 257
           P+N+     T N
Sbjct: 232 PENKITMTFTEN 243


>gi|300690039|ref|YP_003751034.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Ralstonia solanacearum
           PSI07]
 gi|299077099|emb|CBJ49720.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Ralstonia solanacearum
           PSI07]
          Length = 262

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 105/194 (54%), Gaps = 7/194 (3%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQL-EKLKNALQKI-NKKI 69
           + ++L N+LALVTGS++GIG+  A+ LA  GA +I  GR+ + + E +   L ++    +
Sbjct: 1   MDLHLQNKLALVTGSTKGIGHAIAVALAAEGARIILNGRTDASVAEAVSRLLAEVPGAHV 60

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           + FA DL D    +     +A R+ ++DIL+ N GI     P   I +  +    +VNVM
Sbjct: 61  EAFAGDLSDPAQAQ----ALAARFPQVDILVNNLGIFDP-KPFEDIDDAEWLRFFNVNVM 115

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           +   + R++ P +K  + GR + +SS +  +       Y  +K A+  L+R  ++    T
Sbjct: 116 SGVRLSRTYLPGMKAQNWGRIVFISSESGVQIPAEMIHYGVTKTALLGLSRGLAELCAGT 175

Query: 190 ALRVINIDPGPTRT 203
           A+ V  + PGPTR+
Sbjct: 176 AVTVNAVLPGPTRS 189


>gi|167462529|ref|ZP_02327618.1| short-chain dehydrogenase/reductase SDR [Paenibacillus larvae
           subsp. larvae BRL-230010]
          Length = 263

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 116/237 (48%), Gaps = 19/237 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++A+VTGS+RGIG   A  +A+ GA+V+   RS    E  K  L++   K   F  D
Sbjct: 4   LEGKIAIVTGSARGIGKGIATVMAKYGAHVLLFNRSEKVFETAKR-LREQGLKATEFQVD 62

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D   L+        + GK+DIL+ NAG++  ++   + +++      S+N+   WN+ 
Sbjct: 63  VTDREGLKRAAAEAHNKLGKIDILVNNAGVI-RLANFTETEDEIRDFHFSININGVWNMS 121

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYK-CRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P++K+  CG+ + +SS   Y    P   AY+ +K+AI    R+ + E     + V 
Sbjct: 122 QVVLPYMKERKCGKIVNISSVTGYMVADPGEVAYATTKSAIIGFTRSLAAEVAAYNINVN 181

Query: 195 NIDPGPTRTSMRAKAMPAEDP-----------NTVP-----HPQKVAKIISFLCATQ 235
            I PG   T M  +     +P           N+VP      P++V ++ SFL + +
Sbjct: 182 AICPGYIETPMTEQIGKESNPDNPEAVIQGIANSVPLKRLGKPEEVGELASFLASEE 238


>gi|319650488|ref|ZP_08004628.1| 3-ketoacyl-(Acyl-carrier-protein) reductase [Bacillus sp.
           2_A_57_CT2]
 gi|317397669|gb|EFV78367.1| 3-ketoacyl-(Acyl-carrier-protein) reductase [Bacillus sp.
           2_A_57_CT2]
          Length = 238

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 109/223 (48%), Gaps = 5/223 (2%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  + AL+TG+ RGIG   A+ LA+ G  +   GR+I  LEK+ + L + +  +   A D
Sbjct: 4   LKGKTALITGAGRGIGRAAAIALAKEGVNIGLLGRTIENLEKMADELSQYDVNVSAAAAD 63

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D  A+     +I    G +DILI NAGI        ++    +  +I VN+M  +N+ 
Sbjct: 64  VADLEAVTHAVEHIKSDLGSVDILINNAGI-AKFGGFLELSPDEWESIIQVNLMGVYNVT 122

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           R+  P + +   G  I ++S A  K  P+  AYSASK A+  L  +   E     +RV  
Sbjct: 123 RAVLPEMIEQKSGDIINIASTAGQKGAPVTSAYSASKFAVLGLTESLMLEVRKHNIRVSA 182

Query: 196 IDPGPTRTSMRAKA-MPAEDPNTVPHPQKVAKIISFLCATQKI 237
           + P    T +  +  +   +P  V  P+ +A+   F+ A  K+
Sbjct: 183 LTPSTVATDLAIETNLTDGNPEKVMQPEDLAE---FMVAQLKL 222


>gi|146340657|ref|YP_001205705.1| putative 3-oxoacyl-[acyl-carrier-protein] reductase [Bradyrhizobium
           sp. ORS278]
 gi|146193463|emb|CAL77479.1| putative 3-oxoacyl-[acyl-carrier-protein] reductase, related to
           short chain alcohol dehydrogenases [Bradyrhizobium sp.
           ORS278]
          Length = 268

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 106/203 (52%), Gaps = 9/203 (4%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           + LD ++ALVTG+  GIG  TAL LAR G++++  GR+ ++L +          + +   
Sbjct: 1   MTLDGKVALVTGAGSGIGRATALALARRGSHLVLFGRTRAKLAETAALAASHGVRTETLG 60

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADV---ISVNVMA 130
            ++ D  A   T     +R+G+LD+L+ NAG + +     +++    AD+   I V+++A
Sbjct: 61  GNVSDEAACASTLALARERFGRLDVLVNNAGNVRA----GRLEATDVADIRAMIEVDLLA 116

Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
                R+  P L+ S  G  + ++SG A    P +  Y+A+KA +        +E ++  
Sbjct: 117 PILWTRTALPLLRASGDGAIVNVASGIALVGAPFYATYAAAKAGLARFGEALHRELLDEG 176

Query: 191 LRVINIDPGPTRTSMRA--KAMP 211
           +RV+ + PG T T M A  KA P
Sbjct: 177 VRVLTVYPGATETPMMASNKAGP 199


>gi|241627382|ref|XP_002409851.1| reductase, putative [Ixodes scapularis]
 gi|215503258|gb|EEC12752.1| reductase, putative [Ixodes scapularis]
          Length = 244

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 128/246 (52%), Gaps = 21/246 (8%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI 71
           + ++   + A+VTG+SRGIG + A EL++ GA VIA  R+ ++LEKLKN +  +      
Sbjct: 1   MELSFKGKRAVVTGASRGIGNFIARELSKYGATVIAVARTTTELEKLKNEVPNVIP---- 56

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131
            + DL +    E TK  ++   G +D+L+ NA I   + P+ +I  ++F    + NV A 
Sbjct: 57  VSVDLSN---WEATKAALS-NVGPIDLLVNNAAI-AILEPVGEINPETFDKTFATNVKAA 111

Query: 132 WNIMRSFDPWLKKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190
            N+ +     +K+ +   AI+ +SS A          YSASKAA++ L R  + E  +  
Sbjct: 112 INVSQICVKSMKERNVAGAIVNISSQAGIAALADHAVYSASKAALDQLTRVMALELGSYK 171

Query: 191 LRVINIDPGPTRTSM---------RAKAMPAEDP-NTVPHPQKVAKIISFLCATQ-KIET 239
           +RV +++P  T T M         +A AM A+ P      PQ+V+  + +L + +  + T
Sbjct: 172 IRVNSVNPTVTNTPMSMVGWSDPNKAGAMKAKIPLGRFAEPQEVSDAVLYLLSDRSSMIT 231

Query: 240 GKLFSV 245
           G +  V
Sbjct: 232 GTILPV 237


>gi|120553031|ref|YP_957382.1| 3-hydroxybutyrate dehydrogenase [Marinobacter aquaeolei VT8]
 gi|120322880|gb|ABM17195.1| short-chain dehydrogenase/reductase SDR [Marinobacter aquaeolei
           VT8]
          Length = 259

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 99/200 (49%), Gaps = 1/200 (0%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           + L+NR+AL+TG+ RGIG   A    R GA V     ++   +    A+++         
Sbjct: 1   MRLENRIALITGAGRGIGRAIAEAYGREGAKVAVADLTLQAAQDTVTAIEQAGGTAIALE 60

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ D +A+++   Y+ K+WG LDI IANAGI   I P+ ++    +  V++V++   + 
Sbjct: 61  MDVTDEDAVDVNVNYVVKQWGGLDIAIANAGIQ-HIDPVHKLAYSDWRKVMNVHLDGAFL 119

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
           + R+    +  S  G  + + S  + +  PL   Y A+K  +  L R  +KE     +R 
Sbjct: 120 VTRAALRHMYASGGGTMLYMGSVHSLEASPLKAPYVAAKHGMLGLCRAVAKEGAEHGVRS 179

Query: 194 INIDPGPTRTSMRAKAMPAE 213
             I PG  RT +  K +P +
Sbjct: 180 NIICPGFVRTPLVDKQIPEQ 199


>gi|300702655|ref|YP_003744255.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Ralstonia solanacearum
           CFBP2957]
 gi|299070316|emb|CBJ41608.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Ralstonia solanacearum
           CFBP2957]
          Length = 262

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 103/194 (53%), Gaps = 7/194 (3%)

Query: 12  IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQL-EKLKNALQKI-NKKI 69
           + + L N+LALVTGS++GIG+  A+ LA  GA VI  GR+ + + E +   L ++    +
Sbjct: 1   MDLRLQNKLALVTGSTKGIGHAIAVALAAEGARVILNGRTDASVAEAVSRLLTEVPGAHV 60

Query: 70  DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129
           + FA DL D    E     +  R+ ++DIL+ N GI     P   I +  +    +VNVM
Sbjct: 61  EAFAGDLSDPAQAE----ALVARFPRVDILVNNLGIFDP-KPFEDIDDAEWLRFFNVNVM 115

Query: 130 ANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNT 189
           +   + R++ P +K  + GR + +SS +  +       Y  +K A+  L+R  ++    T
Sbjct: 116 SGVRLSRAYLPGMKAQNWGRIVFISSESGVQIPAEMVHYGVTKTALLGLSRGLAELCAGT 175

Query: 190 ALRVINIDPGPTRT 203
           A+ V  + PGPTR+
Sbjct: 176 AVTVNAVLPGPTRS 189


>gi|288917039|ref|ZP_06411410.1| short-chain dehydrogenase/reductase SDR [Frankia sp. EUN1f]
 gi|288351579|gb|EFC85785.1| short-chain dehydrogenase/reductase SDR [Frankia sp. EUN1f]
          Length = 272

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 103/211 (48%), Gaps = 17/211 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIAC-------------GRSISQLEKLKNAL 62
           +D ++  +TG++RG+G   A+ LA  GA +IA              G +   L++    +
Sbjct: 5   MDGKVVFITGAARGMGRAHAVRLAEEGADIIAVDICESIPTVTQYPGATPEDLKETVALV 64

Query: 63  QKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIW-QIKEKSFA 121
           +   ++I     D+RD   L+        + G+LD ++ANAGI   I+  W +  E+ F 
Sbjct: 65  EARGRRIVAEHADVRDLGRLQEVVKAGVSQLGRLDGVVANAGI--GINAAWDKFTEQQFR 122

Query: 122 DVISVNVMANWNIMRSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALAR 180
           DVI +N++  WN + +  P L ++  G +I+L SS    K  P    YSA+K  +  L +
Sbjct: 123 DVIDINLVGVWNTVMASAPLLVEAGEGGSIVLISSAGGLKGCPFNLPYSAAKFGVTGLGK 182

Query: 181 TWSKETVNTALRVINIDPGPTRTSMRAKAMP 211
           T + E     +RV  + PGP  T M    MP
Sbjct: 183 TLAAELGKHRIRVNTVHPGPVDTEMARHIMP 213


>gi|322381634|ref|ZP_08055601.1| 3-oxoacyl-acyl-carrier-protein reductase-like
           protein/3-ketoacyl-acyl carrier protein reductase-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321154410|gb|EFX46719.1| 3-oxoacyl-acyl-carrier-protein reductase-like
           protein/3-ketoacyl-acyl carrier protein reductase-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 275

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 116/237 (48%), Gaps = 19/237 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L+ ++A+VTGS+RGIG   A  +A+ GA+V+   RS    E  K  L++   K   F  D
Sbjct: 16  LEGKIAIVTGSARGIGKGIATVMAKYGAHVLLFNRSEKVFETAKR-LREQGLKATEFQVD 74

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D   L+        + GK+DIL+ NAG++  ++   + +++      S+N+   WN+ 
Sbjct: 75  VTDREGLKRAAAEAHNKLGKIDILVNNAGVI-RLANFTETEDEIRDFHFSININGVWNMS 133

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYK-CRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           +   P++K+  CG+ + +SS   Y    P   AY+ +K+AI    R+ + E     + V 
Sbjct: 134 QVVLPYMKERKCGKIVNISSVTGYMVADPGEVAYATTKSAIIGFTRSLAAEVAAYNINVN 193

Query: 195 NIDPGPTRTSMRAKAMPAEDP-----------NTVP-----HPQKVAKIISFLCATQ 235
            I PG   T M  +     +P           N+VP      P++V ++ SFL + +
Sbjct: 194 AICPGYIETPMTEQIGKESNPDNPEAVIQGIANSVPLKRLGKPEEVGELASFLASEE 250


>gi|118465102|ref|YP_882205.1| carveol dehydrogenase [Mycobacterium avium 104]
 gi|118166389|gb|ABK67286.1| carveol dehydrogenase [Mycobacterium avium 104]
          Length = 268

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 96/194 (49%), Gaps = 3/194 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACG--RSISQLEKLKNALQKINKKIDIF 72
            L  R+ LVTG+ RGIG       A  GA VIA     +   L +   A+Q+   +    
Sbjct: 3   GLRGRVVLVTGAGRGIGRSHCQRFAEEGADVIAVDVPAAAPDLAQTAAAVQQRGVRAATA 62

Query: 73  AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
             D+ D  AL         R G+LD+L+ NAGI  + +P W+I  +++   + VN+   W
Sbjct: 63  LADVSDFAALAAAVDEAVGRLGRLDVLVGNAGIHPAAAPAWEITPQNWQQTLDVNLTGVW 122

Query: 133 NIMRSFDPWLKKS-HCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + +++  P + ++   G  +I+SS +  +  P    YSASK A+  LART + E     +
Sbjct: 123 HTVKAGVPHMSRTARGGSIVIISSTSGIRGTPGAAPYSASKHAVVGLARTLANELGPQGI 182

Query: 192 RVINIDPGPTRTSM 205
           RV  + PG   T+M
Sbjct: 183 RVNTVHPGAVATAM 196


>gi|182625168|ref|ZP_02952944.1| bile acid 7-dehydroxylase 1/3 (Cholate 7-alpha-dehydroxylase 1/3)
           (Bile acid-inducible protein 1/3) [Clostridium
           perfringens D str. JGS1721]
 gi|177909627|gb|EDT72061.1| bile acid 7-dehydroxylase 1/3 (Cholate 7-alpha-dehydroxylase 1/3)
           (Bile acid-inducible protein 1/3) [Clostridium
           perfringens D str. JGS1721]
          Length = 253

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 107/226 (47%), Gaps = 11/226 (4%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF--D 75
           N++ +VTG +RGIG+ T  +    GA V  CG     ++K    L  IN   D   F  +
Sbjct: 10  NKVVIVTGGTRGIGFSTVKKFLDHGAKVALCGSRKETVDKALEELNYINPNYDAIGFYPN 69

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           L DSN ++     + ++WG +DILI NAG+  + S I+   ++ F+ +I +NV A +N  
Sbjct: 70  LLDSNEVKEMVDKVLEKWGTIDILINNAGVSDNKS-IYTQSDEDFSKIIDINVKAIFNCT 128

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++    +K    G  +  SS  +   +     Y  SK A+  L ++ ++E     +RV  
Sbjct: 129 KAVSEIMKNKKYGVILNTSSVVSLYGQKTGVGYPTSKFAVNGLTKSLARELGKDGIRVNA 188

Query: 196