RPSBLAST alignment for GI: 254780337 and conserved domain: TIGR01832

>gnl|CDD|130891 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase. This model describes 2-deoxy-D-gluconate 3-dehydrogenase (also called 2-keto-3-deoxygluconate oxidoreductase), a member of the family of short-chain-alcohol dehydrogenases (pfam00106). This protein has been characterized in Erwinia chrysanthemi as an enzyme of pectin degradation. Length = 248
 Score = 74.0 bits (182), Expect = 3e-14
 Identities = 51/190 (26%), Positives = 102/190 (53%), Gaps = 12/190 (6%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L+ ++ALVTG++ G+G   A+ LA +GA ++  GR  S+  + +  ++ + ++      
Sbjct: 2   SLEGKVALVTGANTGLGQGIAVGLAEAGADIVGAGR--SEPSETQQQVEALGRRFLSLTA 59

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D  A++       + +G +DIL+ NAGI+       +  EK + DV++VN+ + + +
Sbjct: 60  DLSDIEAIKALVDSAVEEFGHIDILVNNAGIIRRADAE-EFSEKDWDDVMNVNLKSVFFL 118

Query: 135 MRSF-DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI----EALARTWSKETVNT 189
            ++    +LK+   G+ I ++S  +++      +Y+ASK  +    + LA  W+ + +N 
Sbjct: 119 TQAAAKHFLKQGRGGKIINIASMLSFQGGIRVPSYTASKHGVAGLTKLLANEWAAKGIN- 177

Query: 190 ALRVINIDPG 199
              V  I PG
Sbjct: 178 ---VNAIAPG 184