RPSBLAST alignment for GI: 254780337 and conserved domain: PRK06113

>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated. Length = 255
 Score = 60.2 bits (146), Expect = 4e-10
 Identities = 55/227 (24%), Positives = 98/227 (43%), Gaps = 11/227 (4%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           LD + A++TG+  GIG   A+  A +GA V+    +      + + +Q++  +      D
Sbjct: 9   LDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCD 68

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +     L     +   + GK+DIL+ NAG  G     + +    F     +NV + +++ 
Sbjct: 69  ITSEQELSALADFALSKLGKVDILVNNAG--GGGPKPFDMPMADFRRAYELNVFSFFHLS 126

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           +   P ++K+  G  + ++S AA        +Y++SKAA   L R  + +     +RV  
Sbjct: 127 QLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNG 186

Query: 196 IDPGPTRTSMRA--------KAMPAEDP-NTVPHPQKVAKIISFLCA 233
           I PG   T            + M    P   +  PQ +A    FLC+
Sbjct: 187 IAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCS 233