RPSBLAST alignment for GI: 254780337 and conserved domain: TIGR01829

>gnl|CDD|162550 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase. (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. This family is downgraded to subfamily for this NodG. Other proteins designated NodG, as from Rhizobium, belong to related but distinct protein families. Length = 242
 Score = 66.7 bits (163), Expect = 5e-12
 Identities = 64/240 (26%), Positives = 102/240 (42%), Gaps = 46/240 (19%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIA-CGRSISQLEKLKNALQKINKKIDIFAFDLR 77
           R+ALVTG   GIG      LA+ G  V A CG +  + E        +     +   D+ 
Sbjct: 1   RIALVTGGMGGIGTAICQRLAKDGYRVAANCGPNEERAEAWLQEQGALGFDFRVVEGDVS 60

Query: 78  DSNALELTKTYIAK---RWGKLDILIANAGILGSISPIWQIKEKSFA--------DVISV 126
              +    K  +AK     G +D+L+ NAGI          ++ +F          VI  
Sbjct: 61  SFES---CKAAVAKVEAELGPIDVLVNNAGI---------TRDATFKKMTYEQWSAVIDT 108

Query: 127 NVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI----EALARTW 182
           N+ + +N+ +     +++   GR I +SS    K +     YSA+KA +    +ALA+  
Sbjct: 109 NLNSVFNVTQPVIDGMRERGWGRIINISSVNGQKGQFGQTNYSAAKAGMIGFTKALAQEG 168

Query: 183 SKE--TVNTALRVINIDPGPTRTSMRAKAMPAEDPN----TVP-----HPQKVAKIISFL 231
           + +  TVNT      I PG   T M   AM  +  N     +P      P+++A  ++FL
Sbjct: 169 ATKGVTVNT------ISPGYIATDM-VMAMREDVLNSIVAQIPVGRLGRPEEIAAAVAFL 221