RPSBLAST alignment for GI: 254780337 and conserved domain: PLN02780

>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase. Length = 320
 Score = 54.9 bits (132), Expect = 2e-08
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 13/182 (7%)

Query: 21  ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDI------FAF 74
           ALVTG + GIG   A +LAR G  ++   R+  +L+ + +++Q    K  I      F+ 
Sbjct: 56  ALVTGPTDGIGKGFAFQLARKGLNLVLVARNPDKLKDVSDSIQSKYSKTQIKTVVVDFSG 115

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIW-QIKEKSFADVISVNVMANWN 133
           D+ D     + +T      G   +LI N G+    +  + ++ E+   ++I VNV     
Sbjct: 116 DI-DEGVKRIKETIEGLDVG---VLINNVGVSYPYARFFHEVDEELLKNLIKVNVEGTTK 171

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAA--YKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
           + ++  P + K   G  I + SGAA      PL+  Y+A+KA I+  +R    E   + +
Sbjct: 172 VTQAVLPGMLKRKKGAIINIGSGAAIVIPSDPLYAVYAATKAYIDQFSRCLYVEYKKSGI 231

Query: 192 RV 193
            V
Sbjct: 232 DV 233