RPSBLAST alignment for GI: 254780337 and conserved domain: PRK05565

>gnl|CDD|180133 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional. Length = 247
 Score =  102 bits (256), Expect = 1e-22
 Identities = 64/236 (27%), Positives = 108/236 (45%), Gaps = 28/236 (11%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYV-IACGRSISQLEKLKNALQKINKKIDIFA 73
            L  ++A+VTG+S GIG   A  LA+ GA V IA   +    ++L   +++         
Sbjct: 2   KLMGKVAIVTGASGGIGRAIAELLAKEGAKVVIAYDINEEAAQELLEEIKEEGGDAIAVK 61

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+     +E     I +++GK+DIL+ NAGI  +   +  + ++ +  VI VN+     
Sbjct: 62  ADVSSEEDVENLVEQIVEKFGKIDILVNNAGI-SNFGLVTDMTDEEWDRVIDVNLTGVML 120

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG--------AYSASKAAIEALARTWSKE 185
           + R   P++ K   G  + +SS        +WG         YSASK A+ A  +  +KE
Sbjct: 121 LTRYALPYMIKRKSGVIVNISS--------IWGLIGASCEVLYSASKGAVNAFTKALAKE 172

Query: 186 TVNTALRVINIDPGPTRTSMRAKAMPAEDPNT---------VPHPQKVAKIISFLC 232
              + +RV  + PG   T M   +   ED            +  P+++AK++ FL 
Sbjct: 173 LAPSGIRVNAVAPGAIDTEM-WSSFSEEDKEGLAEEIPLGRLGKPEEIAKVVLFLA 227