RPSBLAST alignment for GI: 254780337 and conserved domain: PRK06101

>gnl|CDD|180399 PRK06101, PRK06101, short chain dehydrogenase; Provisional. Length = 240
 Score = 78.4 bits (193), Expect = 2e-15
 Identities = 68/219 (31%), Positives = 100/219 (45%), Gaps = 21/219 (9%)

Query: 22  LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81
           L+TG++ GIG   AL+ A+ G  VIACGR+ S L++L       +  I   AFD+ D   
Sbjct: 5   LITGATSGIGKQLALDYAKQGWQVIACGRNQSVLDELHTQ----SANIFTLAFDVTDH-- 58

Query: 82  LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW 141
              TK  +++     ++ I NAG    +    ++     A V +VNV+   N +    P 
Sbjct: 59  -PGTKAALSQLPFIPELWIFNAGDCEYMDD-GKVDATLMARVFNVNVLGVANCIEGIQPH 116

Query: 142 LKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPT 201
           L   H  R +I+ S A+    P   AY ASKAA+   ART   +     + V+ + PG  
Sbjct: 117 LSCGH--RVVIVGSIASELALPRAEAYGASKAAVAYFARTLQLDLRPKGIEVVTVFPGFV 174

Query: 202 RTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETG 240
            T       P  D NT   P     II+   A+Q+I   
Sbjct: 175 AT-------PLTDKNTFAMPM----IITVEQASQEIRAQ 202