RPSBLAST alignment for GI: 254780337 and conserved domain: PRK06500

>gnl|CDD|180593 PRK06500, PRK06500, short chain dehydrogenase; Provisional. Length = 249
 Score = 95.8 bits (239), Expect = 9e-21
 Identities = 67/233 (28%), Positives = 108/233 (46%), Gaps = 22/233 (9%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  + AL+TG + GIG  TA +    GA V   GR  + LE  +  L +    I   A D
Sbjct: 4   LQGKTALITGGTSGIGLETARQFLAEGARVAITGRDPASLEAARAELGESALVIRADAGD 63

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +    AL      +A+ +G+LD +  NAG+    +P+    E  F    + NV   + ++
Sbjct: 64  VAAQKALAQA---LAEAFGRLDAVFINAGV-AKFAPLEDWDEAMFDRSFNTNVKGPYFLI 119

Query: 136 RSFDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           ++  P L       +I+L  S  A+   P    Y+ASKAA+ +LA+T S E +   +RV 
Sbjct: 120 QALLPLLAN---PASIVLNGSINAHIGMPNSSVYAASKAALLSLAKTLSGELLPRGIRVN 176

Query: 195 NIDPGPTRTSMRAKA-MPAED--------PNTVP-----HPQKVAKIISFLCA 233
            + PGP +T +  K  +P              VP      P+++AK + +L +
Sbjct: 177 AVSPGPVQTPLYGKLGLPEATLDAVAAQIQALVPLGRFGTPEEIAKAVLYLAS 229