RPSBLAST alignment for GI: 254780337 and conserved domain: PRK07024

>gnl|CDD|180797 PRK07024, PRK07024, short chain dehydrogenase; Provisional. Length = 257
 Score = 78.8 bits (195), Expect = 1e-15
 Identities = 61/200 (30%), Positives = 94/200 (47%), Gaps = 14/200 (7%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDS 79
              +TG+S GIG   A E AR GA +    R    L+     L     ++ ++A D+RD+
Sbjct: 4   KVFITGASSGIGQALAREYARQGATLGLVARRTDALQAFAARLP-KAARVSVYAADVRDA 62

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKE--KSFADVISVNVMANWNIMRS 137
           +AL           G  D++IANAGI  S+  + + +E    F +V+  N      ++ +
Sbjct: 63  DALAAAAADFIAAHGLPDVVIANAGI--SVGTLTEEREDLAVFREVMDTNYFG---MVAT 117

Query: 138 FDPWL---KKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
           F P++   + +  G  + ++S A  +  P  GAYSASKAA      +   E     +RV+
Sbjct: 118 FQPFIAPMRAARRGTLVGIASVAGVRGLPGAGAYSASKAAAIKYLESLRVELRPAGVRVV 177

Query: 195 NIDPGPTRTSMRAK---AMP 211
            I PG  RT M A     MP
Sbjct: 178 TIAPGYIRTPMTAHNPYPMP 197