RPSBLAST alignment for GI: 254780337 and conserved domain: PRK07063

>gnl|CDD|180819 PRK07063, PRK07063, short chain dehydrogenase; Provisional. Length = 260
 Score = 53.1 bits (128), Expect = 7e-08
 Identities = 49/186 (26%), Positives = 85/186 (45%), Gaps = 3/186 (1%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF- 74
           L  ++ALVTG+++GIG   A   AR GA V       +  E+   A+ +      + A  
Sbjct: 5   LAGKVALVTGAAQGIGAAIARAFAREGAAVALADLDAALAERAAAAIARDVAGARVLAVP 64

Query: 75  -DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133
            D+ D+ ++        + +G LD+L+ NAGI     P+  + ++ +    +V++   WN
Sbjct: 65  ADVTDAASVAAAVAAAEEAFGPLDVLVNNAGINVFADPL-AMTDEDWRRCFAVDLDGAWN 123

Query: 134 IMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRV 193
             R+  P + +   G  + ++S  A+K  P    Y  +K  +  L R    E     +RV
Sbjct: 124 GCRAVLPGMVERGRGSIVNIASTHAFKIIPGCFPYPVAKHGLLGLTRALGIEYAARNVRV 183

Query: 194 INIDPG 199
             I PG
Sbjct: 184 NAIAPG 189