RPSBLAST alignment for GI: 254780337 and conserved domain: PRK07109

>gnl|CDD|180844 PRK07109, PRK07109, short chain dehydrogenase; Provisional. Length = 334
 Score = 67.3 bits (165), Expect = 3e-12
 Identities = 40/161 (24%), Positives = 69/161 (42%), Gaps = 1/161 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           +  ++ ++TG+S G+G  TA   AR GA V+   R    LE L   ++    +      D
Sbjct: 6   IGRQVVVITGASAGVGRATARAFARRGAKVVLLARGEEGLEALAAEIRAAGGEALAVVAD 65

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D+ A++       +  G +D  + NA +     P   +  + F  V  V  +   +  
Sbjct: 66  VADAEAVQAAADRAEEELGPIDTWVNNAMV-TVFGPFEDVTPEEFRRVTEVTYLGVVHGT 124

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE 176
            +    ++    G  I + S  AY+  PL  AY A+K AI 
Sbjct: 125 LAALRHMRPRDRGAIIQVGSALAYRSIPLQSAYCAAKHAIR 165