RPSBLAST alignment for GI: 254780337 and conserved domain: PRK07201

>gnl|CDD|180879 PRK07201, PRK07201, short chain dehydrogenase; Provisional. Length = 657
 Score = 83.1 bits (206), Expect = 7e-17
 Identities = 64/223 (28%), Positives = 105/223 (47%), Gaps = 20/223 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  ++ L+TG+S GIG  TA+++A +GA V    R+   L++L   ++        +  D
Sbjct: 369 LVGKVVLITGASSGIGRATAIKVAEAGATVFLVARNGEALDELVAEIRAKGGTAHAYTCD 428

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAG--ILGSISPIWQIKEKS---FAD---VISVN 127
           L DS A++ T   I    G +D L+ NAG  I  S+       E S   F D    ++VN
Sbjct: 429 LTDSAAVDHTVKDILAEHGHVDYLVNNAGRSIRRSV-------ENSTDRFHDYERTMAVN 481

Query: 128 VMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187
                 ++    P +++   G  + +SS       P + AY ASKAA++A +   + ET+
Sbjct: 482 YFGAVRLILGLLPHMRERRFGHVVNVSSIGVQTNAPRFSAYVASKAALDAFSDVAASETL 541

Query: 188 NTALRVINIDPGPTRTSMRAKAMPAEDPNTVP--HPQKVAKII 228
           +  +    I     RT M A   P +  N VP   P++ A ++
Sbjct: 542 SDGITFTTIHMPLVRTPMIA---PTKRYNNVPTISPEEAADMV 581