RPSBLAST alignment for GI: 254780337 and conserved domain: PRK07576

>gnl|CDD|181043 PRK07576, PRK07576, short chain dehydrogenase; Provisional. Length = 264
 Score = 75.4 bits (186), Expect = 1e-14
 Identities = 53/195 (27%), Positives = 96/195 (49%), Gaps = 20/195 (10%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI---NKKIDI 71
           +   +  +V G + GI    A   AR+GA V    RS    EK+  A+ ++     +   
Sbjct: 6   DFAGKNVVVVGGTSGINLGIAQAFARAGANVAVASRSQ---EKVDAAVAQLQQAGPEGLG 62

Query: 72  FAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSI-SPIWQIKEKSFADVISVNVMA 130
            + D+RD  A+E     IA  +G +D+L++ A   G+  +P   +    F  V+ ++++ 
Sbjct: 63  VSADVRDYAAVEAAFAQIADEFGPIDVLVSGAA--GNFPAPAAGMSANGFKTVVDIDLLG 120

Query: 131 NWNIMRSFDPWLKKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALART----WSKE 185
            +N++++  P L++   G +II +S+  A+   P+     A+KA ++ L RT    W  E
Sbjct: 121 TFNVLKAAYPLLRRP--GASIIQISAPQAFVPMPMQAHVCAAKAGVDMLTRTLALEWGPE 178

Query: 186 TVNTALRVINIDPGP 200
            +    RV +I PGP
Sbjct: 179 GI----RVNSIVPGP 189