RPSBLAST alignment for GI: 254780337 and conserved domain: PRK07904

>gnl|CDD|181162 PRK07904, PRK07904, short chain dehydrogenase; Provisional. Length = 253
 Score = 40.1 bits (94), Expect = 6e-04
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 9/164 (5%)

Query: 67  KKIDIFAFDLRDSNALELTKTYIAKRW--GKLDILIANAGILGSISPIWQIKEKSFADVI 124
             +++  FD  D+   +     I   +  G +D+ I   G+LG    +WQ + K+   + 
Sbjct: 60  SSVEVIDFDALDT---DSHPKVIDAAFAGGDVDVAIVAFGLLGDAEELWQNQRKAVQ-IA 115

Query: 125 SVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSK 184
            +N  A  ++       ++    G+ I +SS A  + R     Y ++KA ++       +
Sbjct: 116 EINYTAAVSVGVLLGEKMRAQGFGQIIAMSSVAGERVRRSNFVYGSTKAGLDGFYLGLGE 175

Query: 185 ETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKII 228
                 +RV+ + PG  RT M A A   E P TV   + VAK+ 
Sbjct: 176 ALREYGVRVLVVRPGQVRTRMSAHA--KEAPLTV-DKEDVAKLA 216