RPSBLAST alignment for GI: 254780337 and conserved domain: PRK08085

>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional. Length = 254
 Score = 85.2 bits (211), Expect = 2e-17
 Identities = 56/190 (29%), Positives = 91/190 (47%), Gaps = 1/190 (0%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75
           L  +  L+TGS++GIG+  A  LA  GA +I    +  + E     L++   K     F+
Sbjct: 7   LAGKNILITGSAQGIGFLLATGLAEYGAEIIINDITAERAELAVAKLRQEGIKAHAAPFN 66

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           +     +E    +I K  G +D+LI NAGI     P  +  E+ + DVI+VN  A + + 
Sbjct: 67  VTHKQEVEAAIEHIEKDIGPIDVLINNAGIQRR-HPFTEFPEQEWNDVIAVNQTAVFLVS 125

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++   ++ K   G+ I + S  +   R     Y+ASK A++ L R    E     ++V  
Sbjct: 126 QAVARYMVKRQAGKIINICSMQSELGRDTITPYAASKGAVKMLTRGMCVELARHNIQVNG 185

Query: 196 IDPGPTRTSM 205
           I PG  +T M
Sbjct: 186 IAPGYFKTEM 195