RPSBLAST alignment for GI: 254780337 and conserved domain: PRK08277

>gnl|CDD|181348 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional. Length = 278
 Score = 77.2 bits (191), Expect = 3e-15
 Identities = 57/209 (27%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 11  EIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID 70
               +L  ++A++TG    +G   A ELAR+GA V    R+  + E +   ++    +  
Sbjct: 3   PNLFSLKGKVAVITGGGGVLGGAMAKELARAGAKVAILDRNQEKAEAVVAEIKAAGGEAL 62

Query: 71  IFAFDLRDSNALELTKTYIAKRWGKLDILIANAG-----------ILGSISP---IWQIK 116
               D+ D  +LE  +  I + +G  DILI  AG               I P    + + 
Sbjct: 63  AVKADVLDKESLEQARQQILEDFGPCDILINGAGGNHPKATTDNEFHELIEPTKTFFDLD 122

Query: 117 EKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG--AYSASKAA 174
           E+ F  V  +N++      + F   +     G  I +SS  A+   PL    AYSA+KAA
Sbjct: 123 EEGFEFVFDLNLLGTLLPTQVFAKDMVGRKGGNIINISSMNAF--TPLTKVPAYSAAKAA 180

Query: 175 IEA----LARTWSKETVNTALRVINIDPG 199
           I      LA  ++K      +RV  I PG
Sbjct: 181 ISNFTQWLAVHFAK----VGIRVNAIAPG 205