RPSBLAST alignment for GI: 254780337 and conserved domain: PRK08628

>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional. Length = 258
 Score = 67.7 bits (166), Expect = 3e-12
 Identities = 58/234 (24%), Positives = 98/234 (41%), Gaps = 16/234 (6%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           NL +++ +VTG + GIG   +L LA  GA  +  GRS    E     L+ +  + +    
Sbjct: 4   NLKDKVVIVTGGASGIGAAISLRLAEEGAIPVIFGRSAPDDE-FAEELRALQPRAEFVQV 62

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           DL D             ++G++D L+ NAG+   +    +   ++F   +  N++  + +
Sbjct: 63  DLTDDAQCRDAVEQTVAKFGRIDGLVNNAGVNDGVG--LEAGREAFVASLERNLIHYYVM 120

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
                P LK S  G  + +SS  A   +     Y+A+K A  AL R W+       +RV 
Sbjct: 121 AHYCLPHLKASR-GAIVNISSKTALTGQGGTSGYAAAKGAQLALTREWAVALAKDGVRVN 179

Query: 195 NIDPGPTRTSMRAKAMPAEDPNTVPHPQ-KVAKIISFLCATQKIETGKLFSVPQ 247
            + P    T +    +      T   P+ K+A I      T KI  G   +  +
Sbjct: 180 AVIPAEVMTPLYENWI-----ATFDDPEAKLAAI------TAKIPLGHRMTTAE 222