RPSBLAST alignment for GI: 254780337 and conserved domain: PRK08642

>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional. Length = 253
 Score = 42.8 bits (101), Expect = 9e-05
 Identities = 59/247 (23%), Positives = 101/247 (40%), Gaps = 41/247 (16%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKINKKIDIF 72
           + +  +  LVTG SRG+G   A   AR GA  V+   +S    E L + L   ++ I + 
Sbjct: 1   MQISEQTVLVTGGSRGLGAAIARAFAREGARVVVNYHQSEDAAEALADELG--DRAIALQ 58

Query: 73  AFDLRDSNALELTKTYIAKRWGK-LDILIANAGILGSISPIWQIKEKSFADV-------- 123
           A D+ D   ++       + +GK +  ++ NA    S     +   K   D+        
Sbjct: 59  A-DVTDREQVQAMFATATEHFGKPITTVVNNALADFSFDGDAR---KKADDITWEDFQQQ 114

Query: 124 ISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPL--WGAYSASKAAIEALART 181
           +  +V    N +++  P +++   GR  I++ G      P+  +  Y+ +KAA+  L R 
Sbjct: 115 LEGSVKGALNTIQAALPGMREQGFGR--IINIGTNLFQNPVVPYHDYTTAKAALLGLTRN 172

Query: 182 WSKE------TVNTALRVINIDPGPTRTSMRAKAMPAE--------DP-NTVPHPQKVAK 226
            + E      TVN       +  G  RT+  + A P E         P   V  PQ+ A 
Sbjct: 173 LAAELGPYGITVNM------VSGGLLRTTDASAATPDEVFDLIAATTPLRKVTTPQEFAD 226

Query: 227 IISFLCA 233
            + F  +
Sbjct: 227 AVLFFAS 233