RPSBLAST alignment for GI: 254780337 and conserved domain: PRK08936

>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional. Length = 261
 Score = 54.3 bits (131), Expect = 3e-08
 Identities = 56/234 (23%), Positives = 112/234 (47%), Gaps = 15/234 (6%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQ-LEKLKNALQKINKKIDIFA 73
           +L+ ++ ++TG S G+G   A+   +  A V+   RS  +    +   ++K   +     
Sbjct: 4   DLEGKVVVITGGSTGLGRAMAVRFGKEKAKVVINYRSDEEEANDVAEEIKKAGGEAIAVK 63

Query: 74  FDL-RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132
            D+  +S+ + L +T + K +G LD++I NAGI  +  P  ++  + +  VI+ N+   +
Sbjct: 64  GDVTVESDVVNLIQTAV-KEFGTLDVMINNAGIENA-VPSHEMSLEDWNKVINTNLTGAF 121

Query: 133 NIMRSFDPWLKKSHC-GRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
              R    +  +    G  I +SS       PL+  Y+ASK  ++ +  T + E     +
Sbjct: 122 LGSREAIKYFVEHDIKGNIINMSSVHEQIPWPLFVHYAASKGGVKLMTETLAMEYAPKGI 181

Query: 192 RVINIDPGPTRTSMRAK--AMPAEDPNT---VP-----HPQKVAKIISFLCATQ 235
           RV NI PG   T + A+  A P +  +    +P      P+++A + ++L +++
Sbjct: 182 RVNNIGPGAINTPINAEKFADPKQRADVESMIPMGYIGKPEEIAAVAAWLASSE 235