RPSBLAST alignment for GI: 254780337 and conserved domain: PRK09730

>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional. Length = 247
 Score = 69.5 bits (170), Expect = 8e-13
 Identities = 69/234 (29%), Positives = 103/234 (44%), Gaps = 30/234 (12%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACG--RSISQLEKLKNALQKINKKIDIFAFDLR 77
           +ALVTG SRGIG  TAL LA+ G Y +A    +++   +++ N + +   K  +   D+ 
Sbjct: 3   IALVTGGSRGIGRATALLLAQEG-YTVAVNYQQNLHAAQEVVNLITQAGGKAFVLQADIS 61

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137
           D N +    T I +    L  L+ NAGIL +   +  +  +    V+S NV   +   R 
Sbjct: 62  DENQVVAMFTAIDQHDEPLAALVNNAGILFTQCTVENLTAERINRVLSTNVTGYFLCCRE 121

Query: 138 FDPWLKKSHCGR--AIILSSGAAYKCRPLWGA------YSASKAAIEALARTWSKETVNT 189
               +   H G   AI+  S AA +     GA      Y+ASK AI+ L    S E    
Sbjct: 122 AVKRMALKHGGSGGAIVNVSSAASRL----GAPGEYVDYAASKGAIDTLTTGLSLEVAAQ 177

Query: 190 ALRVINIDPGPTRTSMRAKAMPAEDPNTVP------------HPQKVAKIISFL 231
            +RV  + PG   T M A      +P  V              P++VA+ I +L
Sbjct: 178 GIRVNCVRPGFIYTEMHAS---GGEPGRVDRVKSNIPMQRGGQPEEVAQAIVWL 228