RPSBLAST alignment for GI: 254780337 and conserved domain: PRK12745

>gnl|CDD|183717 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional. Length = 256
 Score = 80.4 bits (199), Expect = 4e-16
 Identities = 53/204 (25%), Positives = 87/204 (42%), Gaps = 18/204 (8%)

Query: 19  RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQ-LEKLKNALQKINKKIDIFAFDLR 77
            +ALVTG  RGIG   A  LA +G  +    R   + L   +  L+ +  ++  F  D+ 
Sbjct: 3   PVALVTGGRRGIGLGIARALAAAGFDLAINDRPDDEELAATQQELRALGVEVIFFPADVA 62

Query: 78  DSNALELTKTYIAKRWGKLDILIANAGILGSIS--PIWQIKEKSFADVISVN-------- 127
           D +A E         WG++D L+ NAG+ G      +  +  +SF  V+++N        
Sbjct: 63  DLSAHEAMLDAAQAAWGRIDCLVNNAGV-GVKVRGDLLDLTPESFDRVLAINLRGPFFLT 121

Query: 128 -VMANWNIMRSFDPWLKKSHCGRAII-LSSGAAYKCRPLWGAYSASKAAIEALARTWSKE 185
             +A   + +     L      R+I+ +SS  A    P  G Y  SKA +   A+ ++  
Sbjct: 122 QAVAKRMLAQPEPEELPH----RSIVFVSSVNAIMVSPNRGEYCISKAGLSMAAQLFAAR 177

Query: 186 TVNTALRVINIDPGPTRTSMRAKA 209
                + V  + PG  +T M A  
Sbjct: 178 LAEEGIGVYEVRPGLIKTDMTAPV 201