RPSBLAST alignment for GI: 254780337 and conserved domain: PRK12747

>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional. Length = 252
 Score = 69.7 bits (170), Expect = 6e-13
 Identities = 74/247 (29%), Positives = 112/247 (45%), Gaps = 20/247 (8%)

Query: 16  LDNRLALVTGSSRGIGYYTALELARSGAYV-IACGRSISQLEKLKNALQKINKKIDIFAF 74
           L  ++ALVTG+SRGIG   A  LA  GA V I  G    + E+    +Q           
Sbjct: 2   LKGKVALVTGASRGIGRAIAKRLANDGALVAIHYGNRKEEAEETVYEIQSNGGSAFSIGA 61

Query: 75  DLRDSNALE----LTKTYIAKRWG--KLDILIANAGILGSISPIWQIKEKSFADVISVNV 128
           +L   + +E         +  R G  K DILI NAGI G  + I +  E+ F  ++SVN 
Sbjct: 62  NLESLHGVEALYSSLDNELQNRTGSTKFDILINNAGI-GPGAFIEETTEQFFDRMVSVNA 120

Query: 129 MANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVN 188
            A + I++     L+ +   R I +SS A     P + AYS +K AI  +  T +K+   
Sbjct: 121 KAPFFIIQQALSRLRDN--SRIINISSAATRISLPDFIAYSMTKGAINTMTFTLAKQLGA 178

Query: 189 TALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIE----TGKLFS 244
             + V  I PG  +T M A+ +      + P  ++ A  IS      ++E    T    +
Sbjct: 179 RGITVNAILPGFIKTDMNAELL------SDPMMKQYATTISAFNRLGEVEDIADTAAFLA 232

Query: 245 VPQNRFV 251
            P +R+V
Sbjct: 233 SPDSRWV 239