RPSBLAST alignment for GI: 254780337 and conserved domain: PRK12748

>gnl|CDD|183720 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional. Length = 256
 Score = 70.1 bits (172), Expect = 5e-13
 Identities = 62/235 (26%), Positives = 98/235 (41%), Gaps = 19/235 (8%)

Query: 15  NLDNRLALVTGSSR--GIGYYTALELARSGA---------YVIACGRSISQLEK--LKNA 61
            L  ++ALVTG+SR  GIG      LA  G          Y       +   E   LK  
Sbjct: 2   PLMKKIALVTGASRLNGIGAAVCRRLAAKGIDIFFTYWSPYDKTMPWGMHDKEPVLLKEE 61

Query: 62  LQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFA 121
           ++    + +    DL    A       +++R G   ILI NA    + + + ++  +   
Sbjct: 62  IESYGVRCEHMEIDLSQPYAPNRVFYAVSERLGDPSILINNAAY-STHTRLEELTAEQLD 120

Query: 122 DVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALART 181
              +VNV A   +  +F         GR I L+SG +    P   AY+A+K AIEA  ++
Sbjct: 121 KHYAVNVRATMLLSSAFAKQYDGKAGGRIINLTSGQSLGPMPDELAYAATKGAIEAFTKS 180

Query: 182 WSKETVNTALRVINIDPGPTRTS-----MRAKAMPAEDPNTVPHPQKVAKIISFL 231
            + E     + V  ++PGPT T      ++   +P      V  P   A++I+FL
Sbjct: 181 LAPELAEKGITVNAVNPGPTDTGWITEELKHHLVPKFPQGRVGEPVDAARLIAFL 235