RPSBLAST alignment for GI: 254780337 and conserved domain: COG3967

>gnl|CDD|33748 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]. Length = 245
 Score = 74.2 bits (182), Expect = 4e-14
 Identities = 48/207 (23%), Positives = 84/207 (40%), Gaps = 11/207 (5%)

Query: 14  VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73
           +       L+TG + GIG   A      G  VI CGR+  +L + K    +I+       
Sbjct: 1   MKTTGNTILITGGASGIGLALAKRFLELGNTVIICGRNEERLAEAKAENPEIHT----EV 56

Query: 74  FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKE--KSFADVISVNVMAN 131
            D+ D ++      ++ K +  L++LI NAGI  +   +   ++        I+ N++A 
Sbjct: 57  CDVADRDSRRELVEWLKKEYPNLNVLINNAGIQRNED-LTGAEDLLDDAEQEIATNLLAP 115

Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191
             +     P L +      I +SSG A+        Y A+KAAI +      ++  +T++
Sbjct: 116 IRLTALLLPHLLRQPEATIINVSSGLAFVPMASTPVYCATKAAIHSYTLALREQLKDTSV 175

Query: 192 RVINIDP----GPTRTSMRAKAMPAED 214
            VI + P         +     MP   
Sbjct: 176 EVIELAPPLVDTTEGNTQARGKMPLSA 202