RPSBLAST alignment for GI: 254780337 and conserved domain: KOG1201

>gnl|CDD|36415 KOG1201, KOG1201, KOG1201, Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism]. Length = 300
 Score = 84.1 bits (208), Expect = 3e-17
 Identities = 54/231 (23%), Positives = 94/231 (40%), Gaps = 14/231 (6%)

Query: 18  NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF--D 75
             + L+TG   G+G   ALE A+ GA ++    +    E+    ++KI +     A+  D
Sbjct: 38  GEIVLITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNEETVKEIRKIGE---AKAYTCD 94

Query: 76  LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135
           + D   +      + K  G +DIL+ NAGI+ +   +    ++       VN +A++   
Sbjct: 95  ISDREEIYRLAKKVKKEVGDVDILVNNAGIV-TGKKLLDCSDEEIQKTFDVNTIAHFWTT 153

Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195
           ++F P + +++ G  + ++S A          Y ASK A      + S E        I 
Sbjct: 154 KAFLPKMLENNNGHIVTIASVAGLFGPAGLADYCASKFAAVGFHESLSMELRALGKDGIK 213

Query: 196 ---IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLF 243
              + P    T M   A P      +  P+ VAK I      + I T +  
Sbjct: 214 TTLVCPYFINTGMFDGATPFPTLAPLLEPEYVAKRI-----VEAILTNQAG 259