RPSBLAST alignment for GI: 254780337 and conserved domain: KOG1209

>gnl|CDD|36423 KOG1209, KOG1209, KOG1209, 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism]. Length = 289
 Score = 96.3 bits (239), Expect = 7e-21
 Identities = 59/200 (29%), Positives = 83/200 (41%), Gaps = 6/200 (3%)

Query: 20  LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDS 79
           + +   SS GIGY  A E AR+G  V A  R +  + +L         K+D+     +  
Sbjct: 10  VLITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQFGLKPYKLDV----SKPE 65

Query: 80  NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139
             + ++    A   GKLD+L  NAG      P       +      VNV  +  + R+  
Sbjct: 66  EVVTVSGEVRANPDGKLDLLYNNAGQ-SCTFPALDATIAAVEQCFKVNVFGHIRMCRALS 124

Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199
            +L K+  G  + + S A     P    YSASKAAI A ART   E     +RVIN   G
Sbjct: 125 HFLIKAK-GTIVNVGSLAGVVPFPFGSIYSASKAAIHAYARTLRLELKPFGVRVINAITG 183

Query: 200 PTRTSMRAKAMPAEDPNTVP 219
              T +  K +P       P
Sbjct: 184 GVATDIADKRLPETTIYNFP 203