Query gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 88 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 14:53:45 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780339.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam03827 Orexin_rec2 Orexin r 24.6 49 0.0012 15.8 1.9 37 42-78 19-61 (61) 2 TIGR00998 8a0101 efflux pump m 22.7 43 0.0011 16.0 1.3 63 7-80 284-348 (379) 3 KOG0068 consensus 19.5 52 0.0013 15.6 1.2 17 60-76 90-106 (406) 4 PRK10695 hypothetical protein; 18.1 51 0.0013 15.7 0.8 23 10-32 656-678 (876) 5 pfam10586 consensus 17.6 93 0.0024 14.2 2.2 23 59-85 27-49 (72) 6 COG3460 Uncharacterized enzyme 13.4 63 0.0016 15.1 0.3 22 25-46 92-113 (117) 7 COG0430 RCL1 RNA 3'-terminal p 13.3 93 0.0024 14.2 1.2 25 12-36 24-48 (341) 8 cd01553 EPT_RTPC-like This dom 10.5 1.2E+02 0.0032 13.5 1.1 25 12-36 20-44 (211) 9 PRK04204 RNA 3'-terminal-phosp 10.0 1.4E+02 0.0036 13.2 1.2 25 12-36 23-47 (339) 10 TIGR01697 PNPH-PUNA-XAPA inosi 9.9 1.2E+02 0.0029 13.7 0.7 39 23-61 101-140 (266) No 1 >pfam03827 Orexin_rec2 Orexin receptor type 2. Probab=24.64 E-value=49 Score=15.78 Aligned_cols=37 Identities=41% Similarity=0.495 Sum_probs=20.2 Q ss_pred CHHHHHHHHHCCCHHHHCCCCEEEEEE---CCCCC---CCCEE Q ss_conf 125456666402023330300368985---05655---41005 Q gi|254780339|r 42 MSWKILTTMIGCSSAMLGTINQVLVLN---VPTAN---SLQNW 78 (88) Q Consensus 42 mswkilttmigcssamlgtinqvlvln---vptan---slqnw 78 (88) -|-|-|+|-|.--...-.--.||+.-| .|+|| .|||| T Consensus 19 esrkslttqisnfdnvsk~se~vvlt~i~tlp~angagplqnw 61 (61) T pfam03827 19 ESRKSLTTQISNFDNVSKLSEQVVLTSISTLPAANGAGPLQNW 61 (61) T ss_pred HHHHHHHHHHCCCHHHHHHHHHEEEEECCCCCCCCCCCCCCCC T ss_conf 3577788763032126565143023320233246777666679 No 2 >TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds. EmrB encodes a highly hydrophobic 56.2-kDa peptide, with 14 potential alpha-helices to span the inner membrane. EmrA encodes a putative 42.7-kDa peptide containing a single hydrophobic domain and a large C-terminal hydrophilic domain.; GO: 0015238 drug transporter activity, 0006855 multidrug transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=22.72 E-value=43 Score=16.05 Aligned_cols=63 Identities=25% Similarity=0.546 Sum_probs=44.7 Q ss_pred CCHHHHH-HCCCCEE-EEEEEECCCCCEEEEEECCCCCHHHHHHHHHCCCHHHHCCCCEEEEEECCCCCCCCEEEE Q ss_conf 3105665-2048137-744431266761673021032125456666402023330300368985056554100578 Q gi|254780339|r 7 DSNLKEA-ITNNRVE-IANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVLNVPTANSLQNWFL 80 (88) Q Consensus 7 dsnlkea-itnnrve-ianiradmsgtsmkiqseinnmswkilttmigcssamlgtinqvlvlnvptanslqnwfl 80 (88) |.|+||. ++|=|+- -++||.||+|........++..+.-+|..--|-+-+. +|.-|+--||-- T Consensus 284 ~ANFkETqL~~vR~G~~v~i~~DlYg~dv~F~GkV~gi~~GvLPDDtG~~f~l-----------lP~qnatGNWiK 348 (379) T TIGR00998 284 EANFKETQLKNVRIGQPVTIRSDLYGSDVVFEGKVTGISMGVLPDDTGSAFSL-----------LPAQNATGNWIK 348 (379) T ss_pred EEEEECCCCCCCCCCCCEEEEEEECCCCCEEEEEEEECCCCCCCCCHHHHHHC-----------CCCCCCCCCEEE T ss_conf 87520132057457872589985438980797488422663356740455410-----------443125545289 No 3 >KOG0068 consensus Probab=19.54 E-value=52 Score=15.62 Aligned_cols=17 Identities=59% Similarity=0.690 Sum_probs=13.4 Q ss_pred CCCEEEEEECCCCCCCC Q ss_conf 30036898505655410 Q gi|254780339|r 60 TINQVLVLNVPTANSLQ 76 (88) Q Consensus 60 tinqvlvlnvptanslq 76 (88) +-+.++|.|+|++||.- T Consensus 90 te~gi~Vvn~P~~Ns~s 106 (406) T KOG0068 90 TENGILVVNTPTANSRS 106 (406) T ss_pred HHCCEEEEECCCCCHHH T ss_conf 75783899589887177 No 4 >PRK10695 hypothetical protein; Provisional Probab=18.05 E-value=51 Score=15.67 Aligned_cols=23 Identities=48% Similarity=0.505 Sum_probs=17.8 Q ss_pred HHHHHCCCCEEEEEEEECCCCCE Q ss_conf 56652048137744431266761 Q gi|254780339|r 10 LKEAITNNRVEIANIRADMSGTS 32 (88) Q Consensus 10 lkeaitnnrveianiradmsgts 32 (88) |+-+--+|-+++-||+||+.|+- T Consensus 656 LrI~~i~n~~~~~nItadlqG~Y 678 (876) T PRK10695 656 LRIAELNNLVTAKNITADLQGTY 678 (876) T ss_pred EEHHHHHCCCCEEEEEEEECCCC T ss_conf 99879518665142025101437 No 5 >pfam10586 consensus Probab=17.57 E-value=93 Score=14.21 Aligned_cols=23 Identities=52% Similarity=0.603 Sum_probs=14.7 Q ss_pred CCCCEEEEEECCCCCCCCEEEEEECCC Q ss_conf 030036898505655410057871133 Q gi|254780339|r 59 GTINQVLVLNVPTANSLQNWFLLSTNL 85 (88) Q Consensus 59 gtinqvlvlnvptanslqnwfllstnl 85 (88) -.||++--+ |++| .+.||||||- T Consensus 27 eKIn~I~W~--~~~n--~~~fLLstNd 49 (72) T pfam10586 27 EKINKIRWL--PPAN--LAHFLLSTND 49 (72) T ss_pred HHHHEEEEE--CCCC--CCEEEEEECC T ss_conf 546357864--3899--8758987179 No 6 >COG3460 Uncharacterized enzyme of phenylacetate metabolism [Secondary metabolites biosynthesis, transport, and catabolism] Probab=13.42 E-value=63 Score=15.14 Aligned_cols=22 Identities=41% Similarity=0.545 Sum_probs=16.9 Q ss_pred EECCCCCEEEEEECCCCCHHHH Q ss_conf 3126676167302103212545 Q gi|254780339|r 25 RADMSGTSMKIQSEINNMSWKI 46 (88) Q Consensus 25 radmsgtsmkiqseinnmswki 46 (88) |-.-.-++|.|-.||+.||||- T Consensus 92 ~rk~h~~~~~~~De~~~m~~~~ 113 (117) T COG3460 92 RRKRHPTFYTIPDEIEHMSWKE 113 (117) T ss_pred EECCCCCEEECCCHHCEEEECC T ss_conf 0014761166654223222025 No 7 >COG0430 RCL1 RNA 3'-terminal phosphate cyclase [RNA processing and modification] Probab=13.34 E-value=93 Score=14.22 Aligned_cols=25 Identities=40% Similarity=0.502 Sum_probs=20.0 Q ss_pred HHHCCCCEEEEEEEECCCCCEEEEE Q ss_conf 6520481377444312667616730 Q gi|254780339|r 12 EAITNNRVEIANIRADMSGTSMKIQ 36 (88) Q Consensus 12 eaitnnrveianiradmsgtsmkiq 36 (88) -++|.+-|.|.||||+-+-...+-| T Consensus 24 S~ltG~pvrI~nIRa~R~~PGL~~Q 48 (341) T COG0430 24 SALTGKPVRIENIRAGRANPGLKRQ 48 (341) T ss_pred HHHCCCCEEEEEECCCCCCCCCHHH T ss_conf 9851896799987058999772799 No 8 >cd01553 EPT_RTPC-like This domain family includes the Enolpyruvate transferase (EPT) family and the RNA 3' phosphate cyclase family (RTPC). These 2 families differ in that EPT is formed by 3 repeats of an alpha-beta structural domain while RTPC has 3 similar repeats with a 4th slightly different domain inserted between the 2nd and 3rd repeat. They evidently share the same active site location, although the catalytic residues differ. Probab=10.52 E-value=1.2e+02 Score=13.52 Aligned_cols=25 Identities=24% Similarity=0.380 Sum_probs=19.1 Q ss_pred HHHCCCCEEEEEEEECCCCCEEEEE Q ss_conf 6520481377444312667616730 Q gi|254780339|r 12 EAITNNRVEIANIRADMSGTSMKIQ 36 (88) Q Consensus 12 eaitnnrveianiradmsgtsmkiq 36 (88) -+|+...|+|.|||++-+..-.+-| T Consensus 20 SaltgkpvrI~nIRa~R~~PGL~~Q 44 (211) T cd01553 20 AAISGGPITVTGIRPDRAKPGLLRQ 44 (211) T ss_pred HHHHCCCEEEEEECCCCCCCCCHHH T ss_conf 9974898899985379989885799 No 9 >PRK04204 RNA 3'-terminal-phosphate cyclase; Provisional Probab=9.97 E-value=1.4e+02 Score=13.23 Aligned_cols=25 Identities=40% Similarity=0.423 Sum_probs=18.6 Q ss_pred HHHCCCCEEEEEEEECCCCCEEEEE Q ss_conf 6520481377444312667616730 Q gi|254780339|r 12 EAITNNRVEIANIRADMSGTSMKIQ 36 (88) Q Consensus 12 eaitnnrveianiradmsgtsmkiq 36 (88) -+|+..-|+|-|||++-+..-.+-| T Consensus 23 S~itgkpi~I~nIRa~R~~PGL~~Q 47 (339) T PRK04204 23 SAITGKPVRITNIRAGRKKPGLLRQ 47 (339) T ss_pred HHHHCCCEEEEEECCCCCCCCCHHH T ss_conf 9986898799973579989895199 No 10 >TIGR01697 PNPH-PUNA-XAPA inosine guanosine and xanthosine phosphorylase family; InterPro: IPR011268 This entry describes a subset of the phosphorylase family. The entry excludes the methylthioadenosine phosphorylases (MTAP, IPR010044 from INTERPRO), which are believed to play a specific role in the recycling of methionine from methylthioadenosine. This entry consists of three clades of purine phosphorylases based on a neighbour-joining tree using the MTAP family as an out group. The highest-branching clade (IPR011269 from INTERPRO) consists of a group of sequences from both Gram-positive and Gram-negative bacteria which have been shown to act as purine nucleotide phosphorylases but whose physiological substrate and role in vivo remain unknown . Of the two remaining clades, one is xanthosine phosphorylase (XAPA, IPR010943 from INTERPRO); it is limited to certain gammaproteobacteria and constitutes a special purine phosphorylase found in a specialised operon for xanthosine catabolism . The enzyme also acts on the same purines (inosine and guanosine) as the other characterised members of this subfamily, but is only induced when xanthosine must be degraded. The remaining and largest clade consists of purine nucleotide phosphorylases (PNPH, IPR011270 from INTERPRO) from metazoa and bacteria which act primarily on guanosine and inosine, and do not act on adenosine. Sequences from Clostridium and Thermotoga fall between these last two clades and are uncharacterised with respect to substrate range. ; GO: 0004731 purine-nucleoside phosphorylase activity, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process. Probab=9.91 E-value=1.2e+02 Score=13.70 Aligned_cols=39 Identities=26% Similarity=0.364 Sum_probs=32.1 Q ss_pred EEEECCC-CCEEEEEECCCCCHHHHHHHHHCCCHHHHCCC Q ss_conf 4431266-76167302103212545666640202333030 Q gi|254780339|r 23 NIRADMS-GTSMKIQSEINNMSWKILTTMIGCSSAMLGTI 61 (88) Q Consensus 23 niradms-gtsmkiqseinnmswkilttmigcssamlgti 61 (88) -||+||. |.-|-|...||.+.---..-+|||-.-+.|+- T Consensus 101 g~n~~~~~GdLm~i~DHIN~~~~ag~nPLvGpN~~~FG~R 140 (266) T TIGR01697 101 GLNADFKPGDLMIIKDHINLPGLAGFNPLVGPNDDEFGTR 140 (266) T ss_pred CCCCCCCCCCEEEEECHHHCCCCCCCCCCCCCCCCCCCCC T ss_conf 2067889853799711211440004787869888555789 Done!